BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029J09

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36872.1|  hypothetical protein MIMGU_mgv1a004875mg                176   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_006344359.1|  PREDICTED: MLO-like protein 1-like                 175   7e-49   Solanum tuberosum [potatoes]
ref|XP_009770323.1|  PREDICTED: MLO-like protein 1                      170   5e-47   Nicotiana sylvestris
ref|XP_009621845.1|  PREDICTED: MLO-like protein 1                      170   6e-47   Nicotiana tomentosiformis
emb|CDP04006.1|  unnamed protein product                                169   9e-47   Coffea canephora [robusta coffee]
gb|EPS69012.1|  hypothetical protein M569_05755                         168   2e-46   Genlisea aurea
ref|XP_008345266.1|  PREDICTED: MLO-like protein 1                      160   2e-46   Malus domestica [apple tree]
ref|XP_011089565.1|  PREDICTED: MLO-like protein 1                      167   9e-46   Sesamum indicum [beniseed]
gb|KDP39614.1|  hypothetical protein JCGZ_02634                         167   1e-45   Jatropha curcas
ref|XP_008369123.1|  PREDICTED: MLO-like protein 1                      166   3e-45   
ref|XP_007199791.1|  hypothetical protein PRUPE_ppa004508mg             166   3e-45   Prunus persica
ref|XP_008345263.1|  PREDICTED: MLO-like protein 1                      165   5e-45   
ref|XP_008235036.1|  PREDICTED: MLO-like protein 1                      164   1e-44   Prunus mume [ume]
ref|XP_010679042.1|  PREDICTED: MLO-like protein 1                      163   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002523965.1|  calmodulin binding protein, putative               160   1e-43   
ref|XP_003604072.1|  MLO-like protein                                   156   2e-43   
ref|XP_010052699.1|  PREDICTED: MLO-like protein 1                      160   4e-43   Eucalyptus grandis [rose gum]
ref|XP_008460095.1|  PREDICTED: MLO-like protein 1                      160   4e-43   
ref|NP_001284374.1|  MLO-like protein 1                                 160   4e-43   Cucumis melo [Oriental melon]
ref|XP_010251441.1|  PREDICTED: MLO-like protein 1 isoform X3           158   5e-43   Nelumbo nucifera [Indian lotus]
gb|KHN19980.1|  MLO-like protein 1                                      159   7e-43   Glycine soja [wild soybean]
ref|XP_010097666.1|  MLO-like protein 1                                 157   1e-42   
ref|XP_010251437.1|  PREDICTED: MLO-like protein 1 isoform X1           158   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010277858.1|  PREDICTED: MLO-like protein 1                      157   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_003604071.1|  MLO-like protein                                   157   6e-42   Medicago truncatula
ref|XP_003522288.1|  PREDICTED: MLO-like protein 1-like                 156   1e-41   Glycine max [soybeans]
ref|XP_003527594.1|  PREDICTED: MLO-like protein 1-like                 155   1e-41   Glycine max [soybeans]
gb|KGN46257.1|  hypothetical protein Csa_6G078520                       155   1e-41   Cucumis sativus [cucumbers]
gb|ABK96389.1|  unknown                                                 156   1e-41   Populus trichocarpa x Populus deltoides
ref|XP_004145008.1|  PREDICTED: MLO-like protein 1-like                 155   2e-41   Cucumis sativus [cucumbers]
ref|XP_004510198.1|  PREDICTED: MLO-like protein 1-like                 155   2e-41   Cicer arietinum [garbanzo]
ref|XP_004290766.1|  PREDICTED: MLO-like protein 1                      154   4e-41   Fragaria vesca subsp. vesca
ref|XP_011011038.1|  PREDICTED: MLO-like protein 1 isoform X2           154   5e-41   Populus euphratica
ref|XP_011011036.1|  PREDICTED: MLO-like protein 1 isoform X1           154   6e-41   Populus euphratica
ref|XP_004500714.1|  PREDICTED: MLO-like protein 1-like isoform X2      153   1e-40   
ref|XP_004500713.1|  PREDICTED: MLO-like protein 1-like isoform X1      152   2e-40   Cicer arietinum [garbanzo]
gb|AIZ94062.1|  Mlo protein                                             152   2e-40   Hevea brasiliensis [jebe]
ref|XP_007137327.1|  hypothetical protein PHAVU_009G117900g             152   3e-40   Phaseolus vulgaris [French bean]
ref|XP_010528781.1|  PREDICTED: MLO-like protein 1                      152   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_007134284.1|  hypothetical protein PHAVU_010G034400g             150   9e-40   Phaseolus vulgaris [French bean]
ref|XP_004244787.1|  PREDICTED: MLO-like protein 1                      149   2e-39   
ref|XP_010422570.1|  PREDICTED: MLO-like protein 1                      149   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008232215.1|  PREDICTED: MLO-like protein 1                      148   5e-39   
ref|XP_006287341.1|  hypothetical protein CARUB_v10000540mg             149   5e-39   
ref|NP_192169.1|  MLO-like protein 1                                    148   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520359.1|  PREDICTED: MLO-like protein 1-like                 148   8e-39   Glycine max [soybeans]
ref|XP_007217923.1|  hypothetical protein PRUPE_ppa004866mg             147   2e-38   Prunus persica
gb|KJB28899.1|  hypothetical protein B456_005G074900                    147   2e-38   Gossypium raimondii
ref|XP_006858689.1|  hypothetical protein AMTR_s00066p00091160          146   3e-38   Amborella trichopoda
ref|XP_010456010.1|  PREDICTED: MLO-like protein 1                      146   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003547751.1|  PREDICTED: MLO-like protein 1-like                 145   5e-38   Glycine max [soybeans]
ref|XP_010429895.1|  PREDICTED: MLO-like protein 1                      145   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002874907.1|  predicted protein                                  144   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009794451.1|  PREDICTED: MLO-like protein 1 isoform X2           143   3e-37   Nicotiana sylvestris
ref|XP_009615189.1|  PREDICTED: MLO-like protein 1 isoform X2           142   7e-37   Nicotiana tomentosiformis
ref|XP_006396473.1|  hypothetical protein EUTSA_v10028582mg             142   7e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007020280.1|  Seven transmembrane MLO family protein             142   8e-37   
ref|XP_009615188.1|  PREDICTED: MLO-like protein 1 isoform X1           142   8e-37   Nicotiana tomentosiformis
ref|XP_010908325.1|  PREDICTED: MLO-like protein 1 isoform X2           141   8e-37   
ref|XP_009794450.1|  PREDICTED: MLO-like protein 1 isoform X1           142   1e-36   Nicotiana sylvestris
ref|XP_009413424.1|  PREDICTED: MLO-like protein 1                      141   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366803.1|  PREDICTED: MLO-like protein 1-like                 142   2e-36   
gb|KDO49431.1|  hypothetical protein CISIN_1g0104501mg                  138   2e-36   Citrus sinensis [apfelsine]
ref|XP_010908317.1|  PREDICTED: MLO-like protein 1 isoform X1           141   2e-36   Elaeis guineensis
ref|NP_001268003.1|  MLO5 protein                                       141   2e-36   Vitis vinifera
ref|XP_009757992.1|  PREDICTED: MLO-like protein 1                      141   2e-36   Nicotiana sylvestris
ref|XP_009600158.1|  PREDICTED: MLO-like protein 1 isoform X3           140   2e-36   Nicotiana tomentosiformis
ref|XP_006437325.1|  hypothetical protein CICLE_v10031281mg             139   3e-36   
ref|XP_009600156.1|  PREDICTED: MLO-like protein 1 isoform X2           140   3e-36   Nicotiana tomentosiformis
ref|XP_006351085.1|  PREDICTED: MLO-like protein 1-like                 140   4e-36   Solanum tuberosum [potatoes]
ref|XP_010672534.1|  PREDICTED: MLO-like protein 15                     140   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009600155.1|  PREDICTED: MLO-like protein 1 isoform X1           140   6e-36   Nicotiana tomentosiformis
gb|KJB82477.1|  hypothetical protein B456_013G197800                    140   6e-36   Gossypium raimondii
emb|CDY21899.1|  BnaC09g00050D                                          140   8e-36   Brassica napus [oilseed rape]
gb|KHG28286.1|  MLO-like protein 1                                      139   9e-36   Gossypium arboreum [tree cotton]
gb|KDO49430.1|  hypothetical protein CISIN_1g0104501mg                  138   9e-36   Citrus sinensis [apfelsine]
gb|KHG28287.1|  MLO-like protein 1                                      139   1e-35   Gossypium arboreum [tree cotton]
gb|KHG28285.1|  MLO-like protein 1                                      139   1e-35   Gossypium arboreum [tree cotton]
ref|XP_010040798.1|  PREDICTED: MLO-like protein 1                      139   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010251439.1|  PREDICTED: MLO-like protein 1 isoform X2           139   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009111270.1|  PREDICTED: MLO-like protein 1                      139   1e-35   Brassica rapa
ref|XP_009355375.1|  PREDICTED: MLO-like protein 13                     139   2e-35   Pyrus x bretschneideri [bai li]
gb|EYU22368.1|  hypothetical protein MIMGU_mgv1a0228201mg               132   2e-35   Erythranthe guttata [common monkey flower]
gb|KDO49428.1|  hypothetical protein CISIN_1g0104501mg                  138   2e-35   Citrus sinensis [apfelsine]
ref|XP_008798739.1|  PREDICTED: MLO-like protein 13                     138   2e-35   Phoenix dactylifera
ref|XP_008802190.1|  PREDICTED: MLO-like protein 1                      133   4e-35   
ref|XP_006437326.1|  hypothetical protein CICLE_v10031281mg             137   4e-35   Citrus clementina [clementine]
emb|CDP19084.1|  unnamed protein product                                137   5e-35   Coffea canephora [robusta coffee]
ref|XP_008788294.1|  PREDICTED: MLO-like protein 1                      137   5e-35   Phoenix dactylifera
ref|XP_003636499.1|  MLO-like protein                                   137   6e-35   
gb|EYU36622.1|  hypothetical protein MIMGU_mgv1a005184mg                137   8e-35   Erythranthe guttata [common monkey flower]
ref|XP_007029886.1|  Seven transmembrane MLO family protein             136   1e-34   
ref|XP_006478537.1|  PREDICTED: MLO-like protein 1-like                 136   1e-34   Citrus sinensis [apfelsine]
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        139   2e-34   Fragaria vesca subsp. vesca
ref|XP_010930330.1|  PREDICTED: MLO-like protein 1                      135   3e-34   
ref|XP_008812869.1|  PREDICTED: MLO-like protein 1 isoform X2           134   3e-34   
ref|XP_008812868.1|  PREDICTED: MLO-like protein 1 isoform X1           135   3e-34   Phoenix dactylifera
emb|CDX97279.1|  BnaA02g20700D                                          135   3e-34   
ref|XP_004959126.1|  PREDICTED: MLO-like protein 1-like                 135   4e-34   
ref|XP_009144550.1|  PREDICTED: MLO-like protein 1                      135   4e-34   Brassica rapa
ref|XP_008378938.1|  PREDICTED: MLO-like protein 13                     134   5e-34   
emb|CDX91294.1|  BnaC02g27050D                                          134   5e-34   
ref|XP_009137855.1|  PREDICTED: MLO-like protein 13                     134   7e-34   Brassica rapa
ref|XP_010065098.1|  PREDICTED: MLO-like protein 1                      134   7e-34   
ref|XP_006441977.1|  hypothetical protein CICLE_v10019784mg             134   1e-33   Citrus clementina [clementine]
ref|XP_008467033.1|  PREDICTED: MLO-like protein 1                      128   1e-33   
ref|XP_010930335.1|  PREDICTED: MLO-like protein 1 isoform X4           131   1e-33   
ref|XP_010930332.1|  PREDICTED: MLO-like protein 1 isoform X2           133   1e-33   
ref|XP_010930336.1|  PREDICTED: MLO-like protein 1 isoform X5           131   1e-33   
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             136   2e-33   
gb|KEH18066.1|  seven transmembrane MLO family protein                  133   2e-33   Medicago truncatula
ref|XP_010907544.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    133   2e-33   Elaeis guineensis
ref|XP_010930331.1|  PREDICTED: MLO-like protein 1 isoform X1           133   2e-33   Elaeis guineensis
emb|CDY34270.1|  BnaA01g13730D                                          132   3e-33   Brassica napus [oilseed rape]
gb|EAY98072.1|  hypothetical protein OsI_19990                          132   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        135   4e-33   
ref|XP_007203635.1|  hypothetical protein PRUPE_ppa004012mg             132   4e-33   Prunus persica
gb|EEE63750.1|  hypothetical protein OsJ_18569                          132   5e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KHG23854.1|  MLO-like protein 1                                      131   7e-33   Gossypium arboreum [tree cotton]
ref|XP_003564808.1|  PREDICTED: MLO-like protein 1                      131   8e-33   Brachypodium distachyon [annual false brome]
ref|XP_010517996.1|  PREDICTED: MLO-like protein 15 isoform X1          131   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010508339.1|  PREDICTED: MLO-like protein 15                     131   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010506316.1|  PREDICTED: MLO-like protein 15                     131   9e-33   Camelina sativa [gold-of-pleasure]
emb|CAN68336.1|  hypothetical protein VITISV_025977                     127   1e-32   Vitis vinifera
ref|XP_010439065.1|  PREDICTED: MLO-like protein 13                     130   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        133   2e-32   
gb|AFW62649.1|  hypothetical protein ZEAMMB73_842608                    127   2e-32   
ref|XP_006645146.1|  PREDICTED: MLO-like protein 1-like                 130   2e-32   Oryza brachyantha
ref|NP_001045040.1|  Os01g0888600                                       130   2e-32   
ref|XP_007026460.1|  Seven transmembrane MLO family protein             130   2e-32   
dbj|BAJ24152.1|  seven trans-membrane protein                           126   3e-32   Triticum aestivum [Canadian hard winter wheat]
gb|EMS45065.1|  MLO-like protein 1                                      129   3e-32   Triticum urartu
ref|XP_006441984.1|  hypothetical protein CICLE_v10020313mg             129   3e-32   
gb|EMT10343.1|  MLO-like protein 1                                      129   3e-32   
ref|XP_006655330.1|  PREDICTED: MLO-like protein 1-like                 129   4e-32   Oryza brachyantha
gb|KJB28898.1|  hypothetical protein B456_005G074900                    129   4e-32   Gossypium raimondii
emb|CDY03468.1|  BnaC01g16140D                                          129   4e-32   
ref|XP_006478504.1|  PREDICTED: MLO-like protein 1-like                 129   5e-32   Citrus sinensis [apfelsine]
ref|XP_006358492.1|  PREDICTED: MLO-like protein 13-like                129   5e-32   Solanum tuberosum [potatoes]
ref|XP_004287195.1|  PREDICTED: MLO-like protein 15                     129   6e-32   Fragaria vesca subsp. vesca
ref|NP_001105171.1|  barley mlo defense gene homolog8                   129   6e-32   Zea mays [maize]
ref|XP_008243092.1|  PREDICTED: MLO-like protein 1                      129   7e-32   Prunus mume [ume]
ref|XP_008678707.1|  PREDICTED: MLO-like protein 1                      128   7e-32   Zea mays [maize]
dbj|BAH00347.1|  unnamed protein product                                124   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383732.1|  PREDICTED: MLO-like protein 1                      128   1e-31   Malus domestica [apple tree]
gb|ABY77906.1|  mildew resistance locus o 15                            128   1e-31   Vitis vinifera
gb|KJB44399.1|  hypothetical protein B456_007G250700                    128   1e-31   Gossypium raimondii
ref|XP_011004548.1|  PREDICTED: MLO-like protein 1                      128   1e-31   Populus euphratica
ref|XP_010088714.1|  MLO-like protein 13                                127   1e-31   
ref|XP_009399143.1|  PREDICTED: MLO-like protein 1                      127   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006857534.1|  hypothetical protein AMTR_s00061p00034560          127   2e-31   
ref|XP_006648751.1|  PREDICTED: MLO-like protein 1-like                 127   2e-31   Oryza brachyantha
dbj|BAJ24148.1|  seven trans-membrane protein                           127   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009366270.1|  PREDICTED: MLO-like protein 1                      127   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_006372312.1|  hypothetical protein POPTR_0017s00450g             127   2e-31   
ref|XP_006372313.1|  hypothetical protein POPTR_0017s00470g             127   2e-31   
ref|XP_010682204.1|  PREDICTED: MLO-like protein 13                     127   3e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002309708.1|  hypothetical protein POPTR_0007s00240g             127   3e-31   
ref|NP_001267997.1|  mildew resistance locus o 15                       127   3e-31   Vitis vinifera
gb|AFW81913.1|  hypothetical protein ZEAMMB73_691352                    126   3e-31   
gb|KCW44764.1|  hypothetical protein EUGRSUZ_L01672                     124   4e-31   Eucalyptus grandis [rose gum]
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    129   4e-31   
ref|XP_010913232.1|  PREDICTED: MLO-like protein 13 isoform X5          125   4e-31   
ref|XP_010433797.1|  PREDICTED: MLO-like protein 13                     126   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006597646.1|  PREDICTED: MLO-like protein 13-like                126   5e-31   Glycine max [soybeans]
ref|XP_008656279.1|  PREDICTED: MLO-like protein 1                      126   5e-31   Zea mays [maize]
ref|XP_010913231.1|  PREDICTED: MLO-like protein 13 isoform X4          125   6e-31   
ref|XP_008806171.1|  PREDICTED: MLO-like protein 13 isoform X2          126   6e-31   
ref|XP_010913228.1|  PREDICTED: MLO-like protein 13 isoform X1          126   6e-31   Elaeis guineensis
ref|XP_009603524.1|  PREDICTED: MLO-like protein 13                     125   6e-31   Nicotiana tomentosiformis
emb|CBI29605.3|  unnamed protein product                                125   7e-31   Vitis vinifera
ref|XP_004294225.1|  PREDICTED: MLO-like protein 15 isoform X1          126   7e-31   Fragaria vesca subsp. vesca
ref|XP_003568437.1|  PREDICTED: MLO-like protein 1                      125   7e-31   Brachypodium distachyon [annual false brome]
ref|XP_011014744.1|  PREDICTED: MLO-like protein 1                      125   7e-31   Populus euphratica
ref|XP_010913229.1|  PREDICTED: MLO-like protein 13 isoform X2          125   7e-31   Elaeis guineensis
gb|KDO53880.1|  hypothetical protein CISIN_1g010805mg                   124   8e-31   Citrus sinensis [apfelsine]
ref|XP_009391802.1|  PREDICTED: MLO-like protein 13                     125   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806170.1|  PREDICTED: MLO-like protein 13 isoform X1          126   9e-31   
ref|XP_009410721.1|  PREDICTED: MLO-like protein 1 isoform X1           125   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006375949.1|  hypothetical protein POPTR_0013s06670g             120   1e-30   
gb|KDP29534.1|  hypothetical protein JCGZ_19247                         125   1e-30   Jatropha curcas
ref|XP_009410722.1|  PREDICTED: MLO-like protein 1 isoform X2           125   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004242449.1|  PREDICTED: MLO-like protein 1                      125   1e-30   Solanum lycopersicum
gb|EAY86311.1|  hypothetical protein OsI_07684                          124   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009142246.1|  PREDICTED: MLO-like protein 15                     125   1e-30   Brassica rapa
ref|XP_006283629.1|  hypothetical protein CARUB_v10004686mg             124   2e-30   Capsella rubella
gb|KDO53879.1|  hypothetical protein CISIN_1g010805mg                   124   2e-30   Citrus sinensis [apfelsine]
gb|KDO53878.1|  hypothetical protein CISIN_1g010805mg                   124   2e-30   Citrus sinensis [apfelsine]
gb|ABR16800.1|  unknown                                                 124   2e-30   Picea sitchensis
ref|XP_006470774.1|  PREDICTED: MLO-like protein 13-like                124   2e-30   Citrus sinensis [apfelsine]
ref|XP_003594424.1|  MLO-like protein                                   124   2e-30   
gb|ABD32919.1|  Mlo-related protein                                     124   2e-30   Medicago truncatula
ref|XP_006431344.1|  hypothetical protein CICLE_v10000909mg             124   2e-30   
gb|AES64675.2|  seven transmembrane MLO family protein                  124   2e-30   Medicago truncatula
ref|XP_006431345.1|  hypothetical protein CICLE_v10000909mg             124   2e-30   Citrus clementina [clementine]
ref|XP_011005242.1|  PREDICTED: MLO-like protein 1                      124   2e-30   Populus euphratica
ref|XP_009779220.1|  PREDICTED: MLO-like protein 13                     124   2e-30   Nicotiana sylvestris
gb|EEE57203.1|  hypothetical protein OsJ_07160                          124   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567697.1|  MLO-like protein 13                                   124   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010040939.1|  PREDICTED: MLO-like protein 1                      123   3e-30   Eucalyptus grandis [rose gum]
ref|XP_004231310.1|  PREDICTED: MLO-like protein 13                     124   4e-30   Solanum lycopersicum
ref|XP_010448588.1|  PREDICTED: MLO-like protein 13                     124   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004486414.1|  PREDICTED: MLO-like protein 13-like                123   4e-30   Cicer arietinum [garbanzo]
emb|CDY30455.1|  BnaA04g25560D                                          125   5e-30   Brassica napus [oilseed rape]
ref|XP_002533335.1|  Protein MLO, putative                              123   5e-30   
ref|XP_002454019.1|  hypothetical protein SORBIDRAFT_04g023170          123   6e-30   Sorghum bicolor [broomcorn]
ref|XP_009799525.1|  PREDICTED: MLO-like protein 13                     121   7e-30   Nicotiana sylvestris
emb|CDY23418.1|  BnaC04g49460D                                          123   7e-30   Brassica napus [oilseed rape]
ref|XP_006413455.1|  hypothetical protein EUTSA_v10024937mg             123   7e-30   
ref|XP_002867673.1|  hypothetical protein ARALYDRAFT_914165             122   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_011469571.1|  PREDICTED: MLO-like protein 1                      122   1e-29   Fragaria vesca subsp. vesca
ref|XP_007147546.1|  hypothetical protein PHAVU_006G133800g             122   1e-29   Phaseolus vulgaris [French bean]
ref|XP_003636206.1|  MLO-like protein                                   122   2e-29   
ref|XP_009137434.1|  PREDICTED: MLO-like protein 13                     121   2e-29   Brassica rapa
ref|XP_009376309.1|  PREDICTED: MLO-like protein 1                      121   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_008344996.1|  PREDICTED: MLO-like protein 1 isoform X1           121   2e-29   
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        124   3e-29   Populus euphratica
gb|KFK37229.1|  hypothetical protein AALP_AA4G230500                    121   3e-29   Arabis alpina [alpine rockcress]
gb|KDP32468.1|  hypothetical protein JCGZ_13393                         121   3e-29   Jatropha curcas
gb|KJB70716.1|  hypothetical protein B456_011G089600                    121   3e-29   Gossypium raimondii
ref|XP_008674721.1|  PREDICTED: MLO-like protein 1                      121   3e-29   
ref|XP_009361360.1|  PREDICTED: MLO-like protein 1                      121   3e-29   Pyrus x bretschneideri [bai li]
gb|KJB70717.1|  hypothetical protein B456_011G089600                    120   4e-29   Gossypium raimondii
ref|XP_009399302.1|  PREDICTED: MLO-like protein 1                      121   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345009.1|  PREDICTED: MLO-like protein 1 isoform X2           120   4e-29   
ref|XP_010253612.1|  PREDICTED: MLO-like protein 6 isoform X2           119   4e-29   
ref|NP_973686.1|  MLO-like protein 15                                   120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181939.1|  MLO-like protein 15                                   120   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      121   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003636497.1|  MLO-like protein                                   122   5e-29   
gb|EMT15554.1|  MLO-like protein 1                                      120   5e-29   
ref|XP_003575162.1|  PREDICTED: MLO-like protein 1                      120   6e-29   Brachypodium distachyon [annual false brome]
ref|XP_002299404.2|  hypothetical protein POPTR_0001s11880g             120   9e-29   
ref|XP_010521420.1|  PREDICTED: MLO-like protein 13 isoform X1          119   9e-29   Tarenaya hassleriana [spider flower]
ref|XP_010521421.1|  PREDICTED: MLO-like protein 13 isoform X2          119   9e-29   Tarenaya hassleriana [spider flower]
ref|XP_010253610.1|  PREDICTED: MLO-like protein 6 isoform X1           120   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006397586.1|  hypothetical protein EUTSA_v10001415mg             119   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_004952743.1|  PREDICTED: MLO-like protein 1-like                 119   1e-28   Setaria italica
ref|XP_010247041.1|  PREDICTED: MLO-like protein 13 isoform X2          119   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010069192.1|  PREDICTED: MLO-like protein 1 isoform X2           117   1e-28   
ref|XP_002967927.1|  hypothetical protein SELMODRAFT_88157              119   1e-28   
ref|XP_010247040.1|  PREDICTED: MLO-like protein 13 isoform X1          119   2e-28   Nelumbo nucifera [Indian lotus]
gb|EMS49775.1|  MLO-like protein 1                                      119   2e-28   Triticum urartu
ref|XP_011026716.1|  PREDICTED: MLO-like protein 13 isoform X2          119   2e-28   Populus euphratica
ref|XP_008375669.1|  PREDICTED: MLO-like protein 1                      119   2e-28   
ref|XP_010559057.1|  PREDICTED: MLO-like protein 15 isoform X2          119   2e-28   
ref|XP_011026715.1|  PREDICTED: MLO-like protein 13 isoform X1          119   2e-28   Populus euphratica
dbj|BAJ86219.1|  predicted protein                                      118   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK08220.1|  predicted protein                                      119   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002519395.1|  calmodulin binding protein, putative               118   2e-28   
ref|XP_004970845.1|  PREDICTED: MLO-like protein 1-like isoform X2      119   2e-28   
ref|XP_004970844.1|  PREDICTED: MLO-like protein 1-like isoform X1      119   2e-28   Setaria italica
ref|XP_006343449.1|  PREDICTED: MLO-like protein 6-like                 119   2e-28   Solanum tuberosum [potatoes]
gb|EMT12339.1|  MLO-like protein 1                                      118   3e-28   
ref|XP_010559056.1|  PREDICTED: MLO-like protein 15 isoform X1          119   3e-28   
ref|XP_002984361.1|  hypothetical protein SELMODRAFT_120181             119   3e-28   
dbj|BAJ91124.1|  predicted protein                                      118   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94381.1|  predicted protein                                      118   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972783.1|  hypothetical protein SELMODRAFT_97970              119   3e-28   
ref|XP_008796803.1|  PREDICTED: MLO-like protein 6                      119   3e-28   
ref|XP_002441108.1|  hypothetical protein SORBIDRAFT_09g020560          117   4e-28   
ref|XP_003560590.1|  PREDICTED: MLO-like protein 13                     118   4e-28   Brachypodium distachyon [annual false brome]
ref|XP_008802140.1|  PREDICTED: MLO-like protein 1                      117   5e-28   
ref|XP_004962062.1|  PREDICTED: MLO-like protein 1-like                 117   5e-28   Setaria italica
gb|EMT27451.1|  MLO-like protein 1                                      119   5e-28   
emb|CDP17759.1|  unnamed protein product                                117   5e-28   Coffea canephora [robusta coffee]
ref|XP_011087587.1|  PREDICTED: MLO-like protein 13                     117   5e-28   Sesamum indicum [beniseed]
ref|XP_010905123.1|  PREDICTED: MLO-like protein 6                      119   6e-28   Elaeis guineensis
emb|CDM85394.1|  unnamed protein product                                117   6e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010030234.1|  PREDICTED: MLO-like protein 13                     117   7e-28   
ref|XP_004240581.1|  PREDICTED: MLO-like protein 6                      118   7e-28   Solanum lycopersicum
gb|KJB56407.1|  hypothetical protein B456_009G118700                    117   8e-28   Gossypium raimondii
ref|XP_010069191.1|  PREDICTED: MLO-like protein 1 isoform X1           117   9e-28   Eucalyptus grandis [rose gum]
gb|AFW78024.1|  hypothetical protein ZEAMMB73_212423                    115   1e-27   
ref|XP_011085086.1|  PREDICTED: MLO-like protein 1 isoform X2           117   1e-27   Sesamum indicum [beniseed]
ref|XP_011085087.1|  PREDICTED: MLO-like protein 1 isoform X3           117   1e-27   
ref|XP_010101311.1|  MLO-like protein 1                                 115   2e-27   
ref|XP_011085085.1|  PREDICTED: MLO-like protein 15 isoform X1          116   2e-27   
emb|CDP17762.1|  unnamed protein product                                116   2e-27   Coffea canephora [robusta coffee]
dbj|BAJ24153.1|  seven trans-membrane protein                           115   2e-27   
ref|XP_003636203.1|  MLO-like protein                                   115   2e-27   
gb|ACR35515.1|  unknown                                                 114   3e-27   
ref|XP_008649647.1|  PREDICTED: MLO-like protein 1 isoform X1           115   3e-27   
ref|XP_009596416.1|  PREDICTED: MLO-like protein 6                      117   3e-27   
ref|XP_007150220.1|  hypothetical protein PHAVU_005G136700g             115   3e-27   
ref|XP_008649648.1|  PREDICTED: MLO-like protein 1 isoform X2           115   3e-27   
ref|XP_008649649.1|  PREDICTED: MLO-like protein 1 isoform X3           115   4e-27   
emb|CAN71968.1|  hypothetical protein VITISV_007362                     114   4e-27   
ref|XP_008804596.1|  PREDICTED: MLO-like protein 10 isoform X3          114   6e-27   
ref|XP_009777573.1|  PREDICTED: MLO-like protein 6                      116   6e-27   
gb|EYU29404.1|  hypothetical protein MIMGU_mgv1a004805mg                115   6e-27   
ref|NP_176350.1|  MLO-like protein 6                                    115   8e-27   
ref|XP_004965903.1|  PREDICTED: MLO-like protein 13-like                114   8e-27   
ref|XP_002510710.1|  Protein MLO, putative                              114   1e-26   
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           115   1e-26   
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      114   1e-26   
gb|AFW87491.1|  hypothetical protein ZEAMMB73_829191                    113   1e-26   
ref|XP_006657125.1|  PREDICTED: MLO-like protein 1-like                 114   2e-26   
ref|XP_007150219.1|  hypothetical protein PHAVU_005G136700g             114   2e-26   
ref|XP_008448445.1|  PREDICTED: MLO-like protein 10 isoform X1          114   2e-26   
ref|XP_008796805.1|  PREDICTED: MLO-like protein 6                      114   2e-26   
ref|NP_001105661.1|  barley mlo defense gene homolog7                   113   2e-26   
ref|XP_008659032.1|  PREDICTED: barley mlo defense gene homolog7 ...    113   2e-26   
emb|CDP06355.1|  unnamed protein product                                114   3e-26   
ref|XP_010066114.1|  PREDICTED: MLO-like protein 1                      112   4e-26   
gb|EMT22302.1|  MLO-like protein 1                                      112   4e-26   
ref|XP_002441107.1|  hypothetical protein SORBIDRAFT_09g020550          112   5e-26   
gb|KEH25655.1|  seven transmembrane MLO family protein                  111   5e-26   
gb|AAK94907.1|AF384030_1  seven transmembrane protein MLO2              113   5e-26   
ref|NP_001048845.1|  Os03g0129100                                       113   5e-26   
ref|XP_009603532.1|  PREDICTED: MLO-like protein 6                      113   7e-26   
ref|XP_006649324.1|  PREDICTED: MLO protein homolog 1-like              112   9e-26   
gb|KJB09234.1|  hypothetical protein B456_001G130800                    110   1e-25   
ref|XP_009392167.1|  PREDICTED: MLO-like protein 13 isoform X2          110   1e-25   
ref|XP_010264736.1|  PREDICTED: MLO-like protein 6 isoform X2           110   1e-25   
ref|XP_002438667.1|  hypothetical protein SORBIDRAFT_10g023955          111   1e-25   
ref|XP_001752870.1|  predicted protein                                  110   1e-25   
ref|XP_002886534.1|  hypothetical protein ARALYDRAFT_315221             112   1e-25   
gb|KCW44918.1|  hypothetical protein EUGRSUZ_L01503                     105   1e-25   
gb|AAN17391.1|  Putative OsMlo-h1                                       112   2e-25   
ref|XP_010313404.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    111   2e-25   
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 112   2e-25   
ref|XP_004149543.1|  PREDICTED: MLO-like protein 6-like                 110   2e-25   
emb|CDY03836.1|  BnaC01g29530D                                          110   2e-25   
gb|AAK72963.1|AF388195_1  Mlo                                           111   2e-25   
ref|XP_010473363.1|  PREDICTED: MLO-like protein 6 isoform X2           110   2e-25   
ref|XP_006340147.1|  PREDICTED: MLO-like protein 6-like                 111   2e-25   
gb|KDO49757.1|  hypothetical protein CISIN_1g0113631mg                  105   2e-25   
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             111   2e-25   
ref|XP_009801961.1|  PREDICTED: MLO-like protein 6                      111   3e-25   
ref|XP_009392166.1|  PREDICTED: MLO-like protein 13 isoform X1          110   3e-25   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      110   4e-25   
dbj|BAJ24151.1|  seven trans-membrane protein                           110   4e-25   
ref|XP_010054950.1|  PREDICTED: MLO-like protein 1                      110   4e-25   
ref|XP_009385958.1|  PREDICTED: MLO-like protein 6                      111   4e-25   
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      110   4e-25   
ref|XP_008463927.1|  PREDICTED: MLO-like protein 6 isoform X2           109   4e-25   
gb|KJB09233.1|  hypothetical protein B456_001G130800                    110   4e-25   
gb|ADV40949.1|  MLO1                                                    110   5e-25   
ref|XP_010065121.1|  PREDICTED: MLO-like protein 15                     110   5e-25   
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 110   5e-25   
gb|AAX31277.1|  MLO1                                                    110   5e-25   
ref|XP_010264735.1|  PREDICTED: MLO-like protein 6 isoform X1           110   6e-25   
ref|XP_010430163.1|  PREDICTED: MLO-like protein 6 isoform X2           110   6e-25   
ref|XP_010430162.1|  PREDICTED: MLO-like protein 6 isoform X1           110   6e-25   
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      110   6e-25   
ref|XP_009347227.1|  PREDICTED: MLO-like protein 8                      105   7e-25   
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                110   7e-25   
ref|XP_010418123.1|  PREDICTED: MLO-like protein 6                      110   8e-25   
ref|XP_010473362.1|  PREDICTED: MLO-like protein 6 isoform X1           110   8e-25   
gb|KHN35943.1|  MLO-like protein 8                                      109   9e-25   
gb|ACU13145.1|  unknown                                                 105   9e-25   
gb|KHN25050.1|  MLO-like protein 6                                      108   1e-24   
ref|XP_008440929.1|  PREDICTED: MLO-like protein 8                      109   1e-24   
emb|CDY57371.1|  BnaCnng31840D                                          108   1e-24   
ref|XP_002510708.1|  Protein MLO, putative                              109   1e-24   
gb|EMS64374.1|  MLO-like protein 1                                      108   1e-24   
gb|KJB63473.1|  hypothetical protein B456_010G000800                    108   1e-24   
ref|XP_009133347.1|  PREDICTED: MLO-like protein 12                     109   1e-24   
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      109   1e-24   
ref|XP_006441978.1|  hypothetical protein CICLE_v10023336mg             108   1e-24   
ref|XP_006478540.1|  PREDICTED: MLO-like protein 1-like                 108   1e-24   
gb|KGN47314.1|  hypothetical protein Csa_6G292430                       109   1e-24   
ref|XP_004163384.1|  PREDICTED: MLO-like protein 6-like                 109   1e-24   
ref|XP_009133342.1|  PREDICTED: MLO-like protein 12 isoform X1          109   1e-24   
gb|ACO07297.1|  MLO1                                                    109   1e-24   
emb|CBI40748.3|  unnamed protein product                                108   1e-24   
gb|AAS93431.1|  Mlo3                                                    108   1e-24   
ref|XP_010094531.1|  MLO-like protein 5                                 108   1e-24   
ref|XP_008460872.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    108   2e-24   
ref|XP_003558907.1|  PREDICTED: protein MLO-like                        108   2e-24   
gb|EPS72820.1|  hypothetical protein M569_01928                         103   2e-24   
ref|XP_007158026.1|  hypothetical protein PHAVU_002G117900g             109   2e-24   
gb|KFK36813.1|  hypothetical protein AALP_AA4G174800                    108   2e-24   
ref|NP_001268013.1|  MLO11 protein                                      108   2e-24   
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          108   2e-24   
ref|XP_004134822.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    108   2e-24   
gb|KGN49000.1|  hypothetical protein Csa_6G509690                       108   2e-24   
ref|XP_010905121.1|  PREDICTED: MLO-like protein 6                      108   2e-24   
ref|XP_008233336.1|  PREDICTED: MLO-like protein 6                      108   2e-24   
gb|EMS51317.1|  MLO-like protein 1                                      107   2e-24   
ref|XP_004169166.1|  PREDICTED: MLO-like protein 8-like                 108   2e-24   
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       108   2e-24   
gb|AGV68801.1|  MLO4                                                    108   2e-24   
ref|XP_003539406.1|  PREDICTED: MLO-like protein 6-like                 108   2e-24   
ref|XP_002988219.1|  hypothetical protein SELMODRAFT_127490             107   2e-24   
ref|XP_004985865.1|  PREDICTED: MLO protein homolog 1-like              108   2e-24   
gb|EPS67078.1|  hypothetical protein M569_07698                         106   2e-24   
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           108   3e-24   
gb|KHG04571.1|  MLO-like protein 1                                      107   3e-24   
gb|KDO49760.1|  hypothetical protein CISIN_1g0474501mg                  106   3e-24   
emb|CAN64133.1|  hypothetical protein VITISV_032771                     108   3e-24   
ref|XP_001784403.1|  predicted protein                                  108   4e-24   
ref|XP_009390757.1|  PREDICTED: MLO-like protein 9 isoform X2           107   4e-24   
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           107   4e-24   
gb|EYU33241.1|  hypothetical protein MIMGU_mgv1a017858mg                106   4e-24   
ref|XP_006592218.1|  PREDICTED: MLO-like protein 6-like isoform X2      106   5e-24   
ref|XP_010065156.1|  PREDICTED: MLO-like protein 15                     103   6e-24   
tpg|DAA46107.1|  TPA: hypothetical protein ZEAMMB73_604520              105   7e-24   
ref|XP_006293900.1|  hypothetical protein CARUB_v10022893mg             107   7e-24   
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                107   7e-24   
ref|XP_010104115.1|  MLO-like protein 6                                 107   8e-24   
emb|CDY47582.1|  BnaA01g22680D                                          107   9e-24   
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             107   9e-24   
ref|XP_009113127.1|  PREDICTED: MLO-like protein 6                      107   1e-23   
ref|XP_009372611.1|  PREDICTED: MLO-like protein 9                      106   1e-23   
ref|XP_009133345.1|  PREDICTED: MLO-like protein 12                     107   1e-23   
gb|KHN05728.1|  MLO-like protein 6                                      106   1e-23   
ref|XP_001781175.1|  predicted protein                                  105   1e-23   
ref|XP_010534417.1|  PREDICTED: MLO-like protein 12                     107   1e-23   
ref|XP_004515994.1|  PREDICTED: MLO-like protein 2-like                 106   1e-23   
ref|XP_007151752.1|  hypothetical protein PHAVU_004G071700g             106   1e-23   
emb|CDP07267.1|  unnamed protein product                                106   1e-23   
emb|CDY12904.1|  BnaA09g13700D                                          106   1e-23   
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      106   1e-23   
ref|XP_009104728.1|  PREDICTED: MLO-like protein 6                      106   1e-23   
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      106   1e-23   
ref|XP_003571073.1|  PREDICTED: MLO-like protein 13                     105   2e-23   
gb|ACG47212.1|  hypothetical protein                                    102   2e-23   
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      106   2e-23   
emb|CDX97946.1|  BnaA06g06970D                                          105   2e-23   
gb|KDO73205.1|  hypothetical protein CISIN_1g023637mg                   102   2e-23   
ref|XP_004959125.1|  PREDICTED: MLO-like protein 15-like                102   2e-23   
ref|XP_009148458.1|  PREDICTED: MLO-like protein 2                      106   2e-23   
ref|XP_011044385.1|  PREDICTED: MLO-like protein 6 isoform X2           106   2e-23   
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      105   2e-23   
ref|XP_007216411.1|  hypothetical protein PRUPE_ppa022716mg             101   2e-23   
ref|XP_010097644.1|  MLO-like protein 8                                 106   2e-23   
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      105   2e-23   
gb|KEH36351.1|  seven transmembrane MLO family protein                  105   3e-23   
ref|XP_010065150.1|  PREDICTED: MLO-like protein 15                     104   3e-23   
ref|XP_010030236.1|  PREDICTED: MLO-like protein 13                     104   3e-23   
ref|XP_006411145.1|  hypothetical protein EUTSA_v10016436mg             105   3e-23   
gb|KEH36352.1|  seven transmembrane MLO family protein                  103   3e-23   
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 105   3e-23   
ref|XP_008648416.1|  PREDICTED: barley mlo defense gene homolog2 ...    105   3e-23   
ref|XP_006488133.1|  PREDICTED: MLO-like protein 6-like isoform X2      103   3e-23   
ref|XP_002532472.1|  calmodulin binding protein, putative               103   3e-23   
ref|XP_001776768.1|  predicted protein                                  105   4e-23   
gb|KDO73203.1|  hypothetical protein CISIN_1g023637mg                   102   4e-23   
ref|XP_004245231.1|  PREDICTED: MLO-like protein 9                      105   4e-23   
gb|KDO73204.1|  hypothetical protein CISIN_1g023637mg                   102   4e-23   
ref|NP_001046197.1|  Os02g0197200                                       103   4e-23   
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   105   4e-23   
ref|XP_004287711.1|  PREDICTED: MLO-like protein 10                     105   4e-23   
emb|CDP01770.1|  unnamed protein product                                105   4e-23   
ref|NP_001105168.1|  barley mlo defense gene homolog2                   105   4e-23   
emb|CDY15021.1|  BnaCnng04240D                                          105   4e-23   
ref|XP_003603854.1|  MLO protein-like protein                           105   4e-23   
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      105   4e-23   
ref|XP_002301905.2|  hypothetical protein POPTR_0002s00800g             104   5e-23   
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      105   5e-23   
ref|XP_006391995.1|  hypothetical protein EUTSA_v10023372mg             105   5e-23   
emb|CDP07138.1|  unnamed protein product                                105   5e-23   
ref|XP_010043721.1|  PREDICTED: MLO-like protein 6 isoform X2           103   5e-23   
gb|KCW56485.1|  hypothetical protein EUGRSUZ_I02212                     104   5e-23   
ref|XP_010029568.1|  PREDICTED: MLO-like protein 10                     104   6e-23   
gb|EYU25264.1|  hypothetical protein MIMGU_mgv1a024934mg                100   6e-23   
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             104   6e-23   
ref|XP_010476040.1|  PREDICTED: MLO-like protein 2 isoform X2           104   7e-23   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      104   7e-23   
ref|XP_011034832.1|  PREDICTED: MLO-like protein 9 isoform X1           104   7e-23   
ref|XP_002881634.1|  hypothetical protein ARALYDRAFT_903160             104   7e-23   
gb|KDO73202.1|  hypothetical protein CISIN_1g023637mg                   101   7e-23   
gb|KDO73201.1|  hypothetical protein CISIN_1g023637mg                   101   7e-23   
ref|XP_010033601.1|  PREDICTED: MLO-like protein 8                      104   7e-23   
gb|KHN25048.1|  MLO-like protein 6                                      104   7e-23   
ref|XP_003539407.1|  PREDICTED: MLO-like protein 6-like                 104   7e-23   
gb|EEC72681.1|  hypothetical protein OsI_06239                          103   8e-23   
ref|XP_003537693.1|  PREDICTED: MLO-like protein 8-like                 104   8e-23   
ref|XP_007204311.1|  hypothetical protein PRUPE_ppa003435mg             104   8e-23   
gb|EEC80635.1|  hypothetical protein OsI_23017                          103   8e-23   
emb|CDY26348.1|  BnaA03g60240D                                          104   8e-23   
gb|KGN62216.1|  hypothetical protein Csa_2G336140                       103   8e-23   
sp|A2YD22.2|MLOH1_ORYSI  RecName: Full=MLO protein homolog 1; Alt...    103   8e-23   
ref|XP_009124631.1|  PREDICTED: MLO-like protein 6                      104   1e-22   
ref|XP_010256542.1|  PREDICTED: MLO-like protein 9                      103   1e-22   
gb|KCW71437.1|  hypothetical protein EUGRSUZ_E000082                    100   1e-22   
ref|XP_010547373.1|  PREDICTED: MLO-like protein 6                      103   1e-22   
ref|XP_002310696.2|  hypothetical protein POPTR_0007s08570g             103   1e-22   
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      103   1e-22   
gb|EEE65742.1|  hypothetical protein OsJ_21392                          103   1e-22   
ref|NP_565902.1|  protein MILDEW RESISTANCE LOCUS O 12                  103   1e-22   
ref|XP_010917470.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    103   1e-22   
ref|NP_001057664.1|  Os06g0486300                                       103   1e-22   
sp|Q0DC45.2|MLOH1_ORYSJ  RecName: Full=MLO protein homolog 1; Alt...    103   1e-22   
ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      103   1e-22   
ref|XP_010906858.1|  PREDICTED: MLO-like protein 10                     102   1e-22   
ref|XP_008242102.1|  PREDICTED: MLO-like protein 8                      103   2e-22   
ref|NP_001284458.1|  MLO-like protein 12                                103   2e-22   
ref|XP_007018110.1|  Seven transmembrane MLO family protein             103   2e-22   
ref|XP_006579025.1|  PREDICTED: MLO protein homolog 1-like              101   2e-22   
ref|XP_010412940.1|  PREDICTED: MLO-like protein 12                     102   2e-22   
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           103   2e-22   
ref|XP_010680632.1|  PREDICTED: MLO-like protein 10 isoform X2          102   2e-22   
ref|XP_006424615.1|  hypothetical protein CICLE_v10028092mg             103   2e-22   
ref|XP_002465934.1|  hypothetical protein SORBIDRAFT_01g048500          102   2e-22   
emb|CDY19353.1|  BnaC05g08620D                                          102   2e-22   
ref|XP_010680631.1|  PREDICTED: MLO-like protein 10 isoform X1          102   3e-22   
gb|EYU45068.1|  hypothetical protein MIMGU_mgv1a009898mg                100   3e-22   



>gb|EYU36872.1| hypothetical protein MIMGU_mgv1a004875mg [Erythranthe guttata]
Length=506

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 101/126 (80%), Gaps = 6/126 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER +HFTGKYLKKKNQKPL+EA+QK+KEELMLLGFISL+LTV Q RI KICVP   
Sbjct  31   SLAAERGIHFTGKYLKKKNQKPLFEAIQKVKEELMLLGFISLMLTVFQGRIVKICVPAST  90

Query  298  MRHLLPCSLSDKA-----VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
            M HLLPCSLS ++      HAAPE  S HRRLL+   + GYCA KHKVP+LSLE LHHLH
Sbjct  91   MEHLLPCSLSAESSGGEESHAAPE-GSGHRRLLAEELAGGYCAAKHKVPMLSLEALHHLH  149

Query  463  IFIFVL  480
            IFIFVL
Sbjct  150  IFIFVL  155



>ref|XP_006344359.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=477

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 112/137 (82%), Gaps = 7/137 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ERL+H+TGKYLKKKNQKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLAAERLIHYTGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVL  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHHRRLL---SGGDSVGYCAKKHKVP  429
            QS I KICVP+D++ HLLPCSLSD   H     + HHRRLL       + GYC  KHKVP
Sbjct  76   QSSIVKICVPKDVVMHLLPCSLSDAPSHE----SQHHRRLLVEEEEAAAAGYCTAKHKVP  131

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSLE LHHLHIFIFVL
Sbjct  132  LLSLEALHHLHIFIFVL  148



>ref|XP_009770323.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=492

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 111/141 (79%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ER LHF GKYLKKKNQKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  18   WVVAAVCTVIVAISLAAERFLHFLGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVL  77

Query  259  QSRITKICVPEDIMRHLLPCSLS-------DKAVHAAPETNSHHRRLLSGGDSVGYCAKK  417
            Q  I KICVPED++ HLLPCSLS       ++  HA+P +  H R L     + GYC+ K
Sbjct  78   QGSIVKICVPEDVVMHLLPCSLSEAPSSSANETAHASPGSEHHRRLLAEEAAAAGYCSAK  137

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
            HKVPLLSLE LHHLHIFIFVL
Sbjct  138  HKVPLLSLEALHHLHIFIFVL  158



>ref|XP_009621845.1| PREDICTED: MLO-like protein 1 [Nicotiana tomentosiformis]
Length=490

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 111/141 (79%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ER LHF GKYLKKKNQKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLAAERFLHFLGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVL  75

Query  259  QSRITKICVPEDIMRHLLPCSLS-------DKAVHAAPETNSHHRRLLSGGDSVGYCAKK  417
            Q  I KICVPED++ HLLPCSLS       ++  HA+P +  H R L     + GYC+ K
Sbjct  76   QGSIVKICVPEDVVMHLLPCSLSEAPSSSANETAHASPGSEHHRRLLAEEAAAAGYCSAK  135

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
            HKVPLLSLE LHHLHIFIFVL
Sbjct  136  HKVPLLSLEALHHLHIFIFVL  156



>emb|CDP04006.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER+LH+TGKYLK KNQKPLYEALQK+KEELMLLGFISLLLTV Q  I K+CV E +
Sbjct  31   SLAAERILHYTGKYLKHKNQKPLYEALQKVKEELMLLGFISLLLTVFQGSIVKLCVKESV  90

Query  298  MRHLLPCSLSDK--AVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFI  471
              HLLPCS +++  + H  PET +H R L  G  + GYCA KHKVPLLS+E LHHLHIFI
Sbjct  91   TLHLLPCSSNERNGSSHTIPETPAHGRLLAEGSANAGYCAAKHKVPLLSVEALHHLHIFI  150

Query  472  FVL  480
            FVL
Sbjct  151  FVL  153



>gb|EPS69012.1| hypothetical protein M569_05755 [Genlisea aurea]
Length=477

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 109/136 (80%), Gaps = 4/136 (3%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ER LH+ GKYLKKKNQKPLYEAL K+KEELMLLGFISLLLTV 
Sbjct  18   WVVAAVCTVIVAISLAAERGLHYAGKYLKKKNQKPLYEALLKVKEELMLLGFISLLLTVF  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE-TNSHHRRLLS-GGDSVGYCAKKHKVPL  432
            Q+ + KICVP  +M HLLPC L       +PE   SHHRRLL+ G   VGYCA KHKVPL
Sbjct  78   QNSLVKICVPPGVMDHLLPCPLHSNP--TSPEAAASHHRRLLAEGASGVGYCAAKHKVPL  135

Query  433  LSLEGLHHLHIFIFVL  480
            LSLE LHHLHIFIFVL
Sbjct  136  LSLEALHHLHIFIFVL  151



>ref|XP_008345266.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=170

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV +SLA ER LH+  KYLK+KNQ  LYEALQKIKEELML+GFISLLLTV 
Sbjct  18   WVVAAVCTVIVPLSLAAERFLHYGDKYLKRKNQTSLYEALQKIKEELMLMGFISLLLTVF  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETN-SHHRRLLS--GGDSVGYCAKKHKVP  429
            Q+ I+K C  ED+M HLLPC L  KA  A P ++    RRL +  G   +GYCAKKHKVP
Sbjct  78   QNLISKFCASEDVMAHLLPCKLPGKAEGAEPTSHLRGMRRLFAEEGSSQIGYCAKKHKVP  137

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSLE LHHLHIFIFVL
Sbjct  138  LLSLEALHHLHIFIFVL  154



>ref|XP_011089565.1| PREDICTED: MLO-like protein 1 [Sesamum indicum]
Length=498

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 116/141 (82%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ERLLH+ GKYLKKKNQKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  18   WVVAAVCTVIVAISLAAERLLHYAGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVF  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAV------HAAPETNSHHRRLL-SGGDSVGYCAKK  417
            Q RI K+CVP DIM+HLLPCSLS ++       +A+PE + HHRRLL     + GYCA K
Sbjct  78   QGRIVKLCVPPDIMKHLLPCSLSSESASGGEESNASPEVSGHHRRLLAEEAAAAGYCAAK  137

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE LHHLHIFIFVL
Sbjct  138  DKVPLLSLEALHHLHIFIFVL  158



>gb|KDP39614.1| hypothetical protein JCGZ_02634 [Jatropha curcas]
Length=536

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 115/149 (77%), Gaps = 15/149 (10%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLAVER +H+ GKYLKKKNQKPLYEALQK+KEELMLLGFISLLLTVS
Sbjct  18   WVVAAVCTVIVAISLAVERSIHYGGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVS  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHH-------------RRLL--SGGD  393
            Q  ++KICVPE ++ ++LPCSLS+K  H +  T + H             RRLL  S   
Sbjct  78   QGLLSKICVPEHVINNMLPCSLSEKGGHESNTTTTEHFQRFSTSRISGTARRLLAESAES  137

Query  394  SVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             +GYCA+K KVPLLS+E LHHLHIFIFVL
Sbjct  138  QLGYCARKGKVPLLSIEALHHLHIFIFVL  166



>ref|XP_008369123.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GKYLKKKNQ  LYEALQKIKEELMLLGFISLLLTV Q+ I+K CV ED+
Sbjct  31   SLAAERFLHYGGKYLKKKNQTSLYEALQKIKEELMLLGFISLLLTVFQNPISKFCVSEDV  90

Query  298  MRHLLPCSLSDKAVHAAPETN-SHHRRLLS--GGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            M HLLPC L  +A  A P ++    RRL +  G   +GYCAKKHKVPLLSLE LHHLHIF
Sbjct  91   MAHLLPCKLPXEAEXAEPTSHLGGMRRLFAEEGSXQIGYCAKKHKVPLLSLEALHHLHIF  150

Query  469  IFVL  480
            IFVL
Sbjct  151  IFVL  154



>ref|XP_007199791.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
 gb|EMJ00990.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
Length=506

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAAVCTVIVAISLAVERLLH+ GKYLKKKNQKPL+EALQKIKEELMLLGFISLLLTV 
Sbjct  17   WIVAAVCTVIVAISLAVERLLHYGGKYLKKKNQKPLFEALQKIKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHHRRLLSGGD---SVGYCAKKHKVP  429
            Q+ I+KICV   +M HLLPC L  +   A P ++   R+L +       +GYCAKKHKVP
Sbjct  77   QNVISKICVAHQVMEHLLPCKLPSEEEAAKPTSHFGRRKLFAEESFEMQIGYCAKKHKVP  136

Query  430  LLSLEGLHHLHIFIFVL  480
            LLS+E LHHLHIFIFVL
Sbjct  137  LLSVEALHHLHIFIFVL  153



>ref|XP_008345263.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVA+SLA ER LH+ GKYLKKKNQ  LYEALQKIKEELMLLGFISLLLTV 
Sbjct  18   WVVAAVCTVIVALSLAAERFLHYGGKYLKKKNQTSLYEALQKIKEELMLLGFISLLLTVF  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETN-SHHRRLLS--GGDSVGYCAKKHKVP  429
            Q+ I+K CV ED+M HLLPC L  +A  A P ++    RRL +  G   +GYCAKKHKVP
Sbjct  78   QNPISKFCVSEDVMAHLLPCKLPXEAEXAEPTSHLGGMRRLFAEEGSLQIGYCAKKHKVP  137

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSLE LHHLHIFIFVL
Sbjct  138  LLSLEALHHLHIFIFVL  154



>ref|XP_008235036.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=504

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ERLLH+ GKYLKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q+ I+KICV   +
Sbjct  30   SLALERLLHYGGKYLKKKNQKPLFEALQKIKEELMLLGFISLLLTVFQNVISKICVAHQV  89

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGD---SVGYCAKKHKVPLLSLEGLHHLHIF  468
            M HLLPC L  +   A P ++   R+L +       +GYCAKKHKVPLLS+E LHHLHIF
Sbjct  90   MEHLLPCKLPSEEGSAKPTSHFGRRKLFAEESFEMQIGYCAKKHKVPLLSVEALHHLHIF  149

Query  469  IFVL  480
            IFVL
Sbjct  150  IFVL  153



>ref|XP_010679042.1| PREDICTED: MLO-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=497

 Score =   163 bits (413),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 83/125 (66%), Positives = 95/125 (76%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER +H+ GKYLKKKNQKPL+EALQK+KEELMLLGFISLLLTV Q  I+K+C+ E  
Sbjct  31   SLAVERCIHYGGKYLKKKNQKPLFEALQKVKEELMLLGFISLLLTVFQGAISKVCISEKY  90

Query  298  MRHLLPCSLSDKAVHAAPETN--SHHRRLLSGG--DSVGYCAKKHKVPLLSLEGLHHLHI  465
            +RH+LPCSL +K   A P T      RRLLS        YCA KH+VP LS+EGLHHLHI
Sbjct  91   VRHMLPCSLEEKEAAALPTTKHIGGFRRLLSEAAVSQSAYCANKHQVPFLSIEGLHHLHI  150

Query  466  FIFVL  480
            FIFVL
Sbjct  151  FIFVL  155



>ref|XP_002523965.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38333.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 114/151 (75%), Gaps = 17/151 (11%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLAVERL+H+ G YLKKKNQKPLYEALQK+KEELMLLGFISLLLTVS
Sbjct  16   WVVAAVCTVIVAISLAVERLIHYGGLYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVS  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAV--HAAPETNSHH-------------RRLL--SG  387
            Q+ I+KICV E +M ++LPC L+DK     +   T + H             RRLL  S 
Sbjct  76   QNLISKICVSEHVMTNMLPCKLADKGEGHESNSTTTAEHFQRSFITSISGTARRLLAESA  135

Query  388  GDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
               +GYCAKK KVPLLS+EGLHHLHIFIFVL
Sbjct  136  ESQMGYCAKKGKVPLLSIEGLHHLHIFIFVL  166



>ref|XP_003604072.1| MLO-like protein [Medicago truncatula]
Length=297

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 114/154 (74%), Gaps = 25/154 (16%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVA VCTVIVAISLAVERLLH+ GK+LK K+QK LYEALQKIKEELMLLGFISLLLTVS
Sbjct  20   WVVAGVCTVIVAISLAVERLLHYGGKFLKSKDQKSLYEALQKIKEELMLLGFISLLLTVS  79

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHH--------------RRLLSGGDS  396
            Q+R+TKICVP  ++RH+LPCSL DK      E++SH                RLL+  +S
Sbjct  80   QNRLTKICVPPGVLRHMLPCSLEDKK-----ESHSHSAFSFPGRIARRLLADRLLAESES  134

Query  397  ------VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                   G+C +K+KVPLLS+E LHHLHIFIFVL
Sbjct  135  AEEPLKTGFCGRKNKVPLLSVEALHHLHIFIFVL  168



>ref|XP_010052699.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
 gb|KCW76769.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
 gb|KCW76770.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
Length=514

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 18/152 (12%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL VERLLH+TGKYLK+K+QKPL+EALQK+KEELML+GFISLLLTV 
Sbjct  17   WVVAAVCTVIVAISLGVERLLHYTGKYLKRKDQKPLFEALQKVKEELMLMGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLS---DKAVHAAPETNSHH-----------RRLLSGGDS  396
            Q+ I+K+CVP+D+M H+LPCSLS   D+   A+  T SH            RRLL+   +
Sbjct  77   QNPISKVCVPKDLMEHMLPCSLSEAPDEGETASNATTSHFQLSFSMAPGRIRRLLTETST  136

Query  397  V----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            V    G CA K+KVPLLS E LHHLHIFIFVL
Sbjct  137  VSSEAGTCAAKNKVPLLSTEALHHLHIFIFVL  168



>ref|XP_008460095.1| PREDICTED: MLO-like protein 1 [Cucumis melo]
Length=514

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 114/156 (73%), Gaps = 22/156 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLHF G+YLK KNQKPL EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAP--ETNSH----------------HRRL  378
            Q  I+K+CVPE +  HLLPC L D  KA H +P  ET S                  RRL
Sbjct  76   QGTISKLCVPESLTEHLLPCDLKDKPKAEHGSPSGETGSSTTKHFQTFFVSSISGTARRL  135

Query  379  LSGGDS--VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            L+ G +   GYCAKK+KVPLLSLE LHHLHIFIF+L
Sbjct  136  LAEGSASQAGYCAKKNKVPLLSLEALHHLHIFIFIL  171



>ref|NP_001284374.1| MLO-like protein 1 [Cucumis melo]
 gb|ACX55085.1| Mlo1 [Cucumis melo]
Length=516

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 114/156 (73%), Gaps = 22/156 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLHF G+YLK KNQKPL EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAP--ETNSH----------------HRRL  378
            Q  I+K+CVPE +  HLLPC L D  KA H +P  ET S                  RRL
Sbjct  76   QGTISKLCVPESLTEHLLPCDLKDKPKAEHGSPSGETGSSTTKHFQTFFVSSISGTARRL  135

Query  379  LSGGDS--VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            L+ G +   GYCAKK+KVPLLSLE LHHLHIFIF+L
Sbjct  136  LAEGSASQAGYCAKKNKVPLLSLEALHHLHIFIFIL  171



>ref|XP_010251441.1| PREDICTED: MLO-like protein 1 isoform X3 [Nelumbo nucifera]
Length=410

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER++HF GKYLKKKNQKPL+EAL K+KEELMLLGFISLLLTV Q RI KIC+ +D+
Sbjct  29   SLAVERIIHFIGKYLKKKNQKPLFEALLKVKEELMLLGFISLLLTVLQERIGKICISKDL  88

Query  298  MRHLLPCSLSDKAVH------AAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
             RH+LPC L + +        + P  +   RRLL+ G   GYC KK KVPLLS+  LHHL
Sbjct  89   ARHMLPCKLHEMSSTEHYQSISTPFISGIGRRLLTSGAGSGYCLKKEKVPLLSITALHHL  148

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  149  HIFIFVL  155



>gb|KHN19980.1| MLO-like protein 1 [Glycine soja]
Length=488

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 107/134 (80%), Gaps = 9/134 (7%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ERLLH+ GK+LK K+QKPLYEALQKIKEELMLLGFISLLLTV+
Sbjct  19   WVVAAVCTVIVAISLAAERLLHYGGKFLKAKDQKPLYEALQKIKEELMLLGFISLLLTVT  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLS  438
            Q+ ITKICV   + RH+LPC+L D   H+ PE+ S           +GYC +K+KVPLLS
Sbjct  79   QNGITKICVRPSLTRHMLPCNL-DAGEHSTPESES--------ATKIGYCVRKNKVPLLS  129

Query  439  LEGLHHLHIFIFVL  480
            LE LHHLHIFIFVL
Sbjct  130  LEALHHLHIFIFVL  143



>ref|XP_010097666.1| MLO-like protein 1 [Morus notabilis]
 gb|EXB70621.1| MLO-like protein 1 [Morus notabilis]
Length=432

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ERLLH+ G+ LK+KNQKPLYEALQK+KEELMLLGFISLLLTVSQ+ I+K CV + +
Sbjct  31   SLAAERLLHYLGQVLKRKNQKPLYEALQKVKEELMLLGFISLLLTVSQNAISKFCVSKSL  90

Query  298  MRHLLPCSLSD----KAVHAAPETNSHH----------RRLL---SGGDSVGYCAKKHKV  426
            M +LLPC LS+    K       + SHH          RRLL   + G+ +GYCA+K+KV
Sbjct  91   MDNLLPCKLSEAEEAKGHGGESASTSHHLGVATITGVFRRLLAEEASGEQIGYCARKNKV  150

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLS+E LHHLHIFIFVL
Sbjct  151  PLLSVEALHHLHIFIFVL  168



>ref|XP_010251437.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
 ref|XP_010251438.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
Length=484

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER++HF GKYLKKKNQKPL+EAL K+KEELMLLGFISLLLTV Q RI KIC+ +D+
Sbjct  29   SLAVERIIHFIGKYLKKKNQKPLFEALLKVKEELMLLGFISLLLTVLQERIGKICISKDL  88

Query  298  MRHLLPCSLSDKAVH------AAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
             RH+LPC L + +        + P  +   RRLL+ G   GYC KK KVPLLS+  LHHL
Sbjct  89   ARHMLPCKLHEMSSTEHYQSISTPFISGIGRRLLTSGAGSGYCLKKEKVPLLSITALHHL  148

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  149  HIFIFVL  155



>ref|XP_010277858.1| PREDICTED: MLO-like protein 1 [Nelumbo nucifera]
Length=498

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER+LHFTGKYLKKKNQKPL+EALQK+KEELMLLGFISLLLTV Q RI+K C+ E +
Sbjct  27   SLAVERILHFTGKYLKKKNQKPLFEALQKVKEELMLLGFISLLLTVFQDRISKFCISESL  86

Query  298  MRHLLPCSLSDKAVHAA---------PETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGL  450
              H+LPC L+  +  ++         P  +   RRLL+ G +  YC KK +VPLLS+  L
Sbjct  87   AHHMLPCKLTSDSKTSSTAHYQSFFLPFVSGTGRRLLAEGSNSDYCTKKGEVPLLSITAL  146

Query  451  HHLHIFIFVL  480
            HHLHIFIFVL
Sbjct  147  HHLHIFIFVL  156



>ref|XP_003604071.1| MLO-like protein [Medicago truncatula]
 gb|AES74322.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=517

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 102/141 (72%), Gaps = 25/141 (18%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ GK+LK K+QK LYEALQKIKEELMLLGFISLLLTVSQ+R+TKICVP  +
Sbjct  33   SLAVERLLHYGGKFLKSKDQKSLYEALQKIKEELMLLGFISLLLTVSQNRLTKICVPPGV  92

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------------RRLLSGGDS------VGYCAKK  417
            +RH+LPCSL DK      E++SH                RLL+  +S       G+C +K
Sbjct  93   LRHMLPCSLEDKK-----ESHSHSAFSFPGRIARRLLADRLLAESESAEEPLKTGFCGRK  147

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
            +KVPLLS+E LHHLHIFIFVL
Sbjct  148  NKVPLLSVEALHHLHIFIFVL  168



>ref|XP_003522288.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN33659.1| MLO-like protein 1 [Glycine soja]
Length=506

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 111/150 (74%), Gaps = 21/150 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAA CTVIVAISLA ERLLH+ GK+LK K+QKPLYEALQKIKEELMLLGFISLLLTV+
Sbjct  17   WVVAAFCTVIVAISLAAERLLHYGGKFLKAKDQKPLYEALQKIKEELMLLGFISLLLTVT  76

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHH---------RRLLSGGDS-----  396
            Q+ ITKICV   +  H+LPC+L     H AP  +  H         RRLLSG  S     
Sbjct  77   QNGITKICVRPSLTLHMLPCNL-----HDAPANHESHFQTFFPGTARRLLSGEHSTPESA  131

Query  397  --VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
              +GYC++KHKVPLLS+E LHHLHIFIFVL
Sbjct  132  SKIGYCSRKHKVPLLSVEALHHLHIFIFVL  161



>ref|XP_003527594.1| PREDICTED: MLO-like protein 1-like [Glycine max]
Length=488

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 106/134 (79%), Gaps = 9/134 (7%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ERLLH+ GK+LK K+QK LYEALQKIKEELMLLGFISLLLTV+
Sbjct  19   WVVAAVCTVIVAISLAAERLLHYGGKFLKAKDQKSLYEALQKIKEELMLLGFISLLLTVT  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLS  438
            Q+ ITKICV   + RH+LPC+L D   H+ PE+ S           +GYC +K+KVPLLS
Sbjct  79   QNGITKICVRPSLTRHMLPCNL-DAGEHSTPESES--------ATKIGYCVRKNKVPLLS  129

Query  439  LEGLHHLHIFIFVL  480
            LE LHHLHIFIFVL
Sbjct  130  LEALHHLHIFIFVL  143



>gb|KGN46257.1| hypothetical protein Csa_6G078520 [Cucumis sativus]
Length=464

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 112/156 (72%), Gaps = 22/156 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLHF G+YLK KNQKPL EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVH------AAPETNSHH------------RRL  378
            Q  I+K+CVPE +  HLLPC L D  KA H      +   T  H             RRL
Sbjct  76   QGTISKLCVPESLTEHLLPCDLKDKPKAEHGSPSGESGSSTTKHFQTLFVSSISGTARRL  135

Query  379  LSGGDS--VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            LS G +   GYCAKK+KVPLLSLE LHHLHIFIF+L
Sbjct  136  LSEGSASQAGYCAKKNKVPLLSLEALHHLHIFIFIL  171



>gb|ABK96389.1| unknown [Populus trichocarpa x Populus deltoides]
Length=527

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 101/140 (72%), Gaps = 19/140 (14%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ERLLH+ G +L++KNQKPLYEALQK+KEELMLLGFISLLLTVSQ+ ITK CVPE++
Sbjct  29   SLAAERLLHYCGIFLRRKNQKPLYEALQKVKEELMLLGFISLLLTVSQNSITKTCVPENV  88

Query  298  MRHLLPCSLSDKAVHAAPETNS-----HH------------RRLLSGGD--SVGYCAKKH  420
            +  LLPC LS+K       +NS     H+            RRLL+     ++GYCAKK 
Sbjct  89   VNDLLPCRLSEKQKEEGLGSNSTTTPKHYQSFFPGTISGTVRRLLAEASEANLGYCAKKG  148

Query  421  KVPLLSLEGLHHLHIFIFVL  480
            KVPLLSLE +HHLHIFIFVL
Sbjct  149  KVPLLSLEAIHHLHIFIFVL  168



>ref|XP_004145008.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004154026.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004160672.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
Length=516

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 112/156 (72%), Gaps = 22/156 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLHF G+YLK KNQKPL EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVH------AAPETNSHH------------RRL  378
            Q  I+K+CVPE +  HLLPC L D  KA H      +   T  H             RRL
Sbjct  76   QGTISKLCVPESLTEHLLPCDLKDKPKAEHGSPSGESGSSTTKHFQTLFVSSISGTARRL  135

Query  379  LSGGDS--VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            LS G +   GYCAKK+KVPLLSLE LHHLHIFIF+L
Sbjct  136  LSEGSASQAGYCAKKNKVPLLSLEALHHLHIFIFIL  171



>ref|XP_004510198.1| PREDICTED: MLO-like protein 1-like [Cicer arietinum]
Length=513

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 19/139 (14%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER LH+ GK+LKKKNQK L++ALQKIKEELMLLGFISL LTV+Q+RITKICVPE+ 
Sbjct  33   SFAVERSLHYVGKFLKKKNQKALFQALQKIKEELMLLGFISLFLTVTQNRITKICVPENW  92

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGD------------------SVGYCAKKHK  423
              H+LPCSL +K    + ++ SH +   S  D                  ++GYCA K K
Sbjct  93   THHMLPCSLDEKD-EESKKSTSHFQTFFSSNDVFGTTRRLLGDDHPSTEETLGYCAAKGK  151

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VPLLS+E LHHLHIFIFVL
Sbjct  152  VPLLSVEALHHLHIFIFVL  170



>ref|XP_004290766.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=514

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLH+ GK+LKKK QKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  17   WVVAAVCTVIVAISLALERLLHYGGKFLKKKGQKPLYEALQKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNS---HHRRLL--SGGDSVGYCAKKHK  423
            Q+ I+KICV   +M HLLPC L D A   A  T+    H RRL   +  +   YCAK  K
Sbjct  77   QNVISKICVQHGVMEHLLPCKLEDAASETATPTSHFTLHFRRLAEETAEEQNTYCAKTGK  136

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VPLLS+E LHHLHIFIFVL
Sbjct  137  VPLLSVEALHHLHIFIFVL  155



>ref|XP_011011038.1| PREDICTED: MLO-like protein 1 isoform X2 [Populus euphratica]
Length=502

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 19/140 (14%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ G +L++KNQKPLYEALQK+KEELMLLGFISLLLTVSQ+ I K CVPE++
Sbjct  29   SLAVERLLHYCGIFLRRKNQKPLYEALQKVKEELMLLGFISLLLTVSQNTIAKTCVPENV  88

Query  298  MRHLLPCSLSDKAVHAAPE----TNSHH-------------RRLLSGGDSV--GYCAKKH  420
            +  LLPC LS+K      E    T + H             RRLL+       GYCAKK 
Sbjct  89   VNDLLPCRLSEKQKEKGHESYSTTTTKHFQSFSPGTISGTFRRLLAEASEANHGYCAKKG  148

Query  421  KVPLLSLEGLHHLHIFIFVL  480
            KVPLLSLE +HHLHIFIFVL
Sbjct  149  KVPLLSLEAIHHLHIFIFVL  168



>ref|XP_011011036.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
 ref|XP_011011037.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
Length=527

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 19/140 (14%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ G +L++KNQKPLYEALQK+KEELMLLGFISLLLTVSQ+ I K CVPE++
Sbjct  29   SLAVERLLHYCGIFLRRKNQKPLYEALQKVKEELMLLGFISLLLTVSQNTIAKTCVPENV  88

Query  298  MRHLLPCSLSDKAVHAAPE----TNSHH-------------RRLLSGGDSV--GYCAKKH  420
            +  LLPC LS+K      E    T + H             RRLL+       GYCAKK 
Sbjct  89   VNDLLPCRLSEKQKEKGHESYSTTTTKHFQSFSPGTISGTFRRLLAEASEANHGYCAKKG  148

Query  421  KVPLLSLEGLHHLHIFIFVL  480
            KVPLLSLE +HHLHIFIFVL
Sbjct  149  KVPLLSLEAIHHLHIFIFVL  168



>ref|XP_004500714.1| PREDICTED: MLO-like protein 1-like isoform X2 [Cicer arietinum]
Length=508

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH+ GK+LK+K+QKPLYEALQKIKEELMLLGFISLLLTVSQ+ +TKICVP  +
Sbjct  31   SLVAERLLHYGGKFLKRKDQKPLYEALQKIKEELMLLGFISLLLTVSQNSLTKICVPPSV  90

Query  298  MRHLLPCSLSDK------AVHAAPETNSHHRRLLSGGDS----VGYCAKKHKVPLLSLEG  447
            +RH+LPC+L +K      + ++A       RR+L+  +       +CA+K+KVPLLSLE 
Sbjct  91   LRHMLPCTLKEKEKANQVSHYSAFSFPGLARRILANEEDEHPKTPFCARKNKVPLLSLEA  150

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  151  LHHLHIFIFVL  161



>ref|XP_004500713.1| PREDICTED: MLO-like protein 1-like isoform X1 [Cicer arietinum]
Length=533

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH+ GK+LK+K+QKPLYEALQKIKEELMLLGFISLLLTVSQ+ +TKICVP  +
Sbjct  31   SLVAERLLHYGGKFLKRKDQKPLYEALQKIKEELMLLGFISLLLTVSQNSLTKICVPPSV  90

Query  298  MRHLLPCSLSDK------AVHAAPETNSHHRRLLSGGDS----VGYCAKKHKVPLLSLEG  447
            +RH+LPC+L +K      + ++A       RR+L+  +       +CA+K+KVPLLSLE 
Sbjct  91   LRHMLPCTLKEKEKANQVSHYSAFSFPGLARRILANEEDEHPKTPFCARKNKVPLLSLEA  150

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  151  LHHLHIFIFVL  161



>gb|AIZ94062.1| Mlo protein [Hevea brasiliensis]
Length=516

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 95/139 (68%), Gaps = 18/139 (13%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GKYLK KNQKPLYEALQKIKEELMLLGFISLLLTVSQ+ I+K CV E +
Sbjct  31   SLAAERFLHYGGKYLKSKNQKPLYEALQKIKEELMLLGFISLLLTVSQATISKFCVHEHV  90

Query  298  MRHLLPCSLSDKAVHA----APETNSH------------HRRLL--SGGDSVGYCAKKHK  423
            + ++LPC LS+K           T  H            +RRLL  S    +GYC KK K
Sbjct  91   LTNMLPCDLSEKGEEGQGSNTTATTEHFQRFFTTSISGTNRRLLAESTESQIGYCEKKGK  150

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VPLLS+E LHHLHIFIFVL
Sbjct  151  VPLLSIEALHHLHIFIFVL  169



>ref|XP_007137327.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
 gb|ESW09321.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
Length=513

 Score =   152 bits (384),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 96/157 (61%), Positives = 109/157 (69%), Gaps = 28/157 (18%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA ER LH+ GK+LK K+QKPLYEALQKIKEELMLLGFISLLLTV+
Sbjct  18   WVVAAVCTVIVAISLAAERFLHYGGKFLKAKDQKPLYEALQKIKEELMLLGFISLLLTVT  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHH---------RRLLSGG-------  390
            Q+ ITKICVP    RH+LPCSL       AP   SH          RRLL+         
Sbjct  78   QNGITKICVPPGFTRHMLPCSLD-----LAPNHESHFQTFYFPGTPRRLLAATAEEHAPP  132

Query  391  -------DSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                    + G+C++K+KVPLLS+E LHHLHIFIFVL
Sbjct  133  HSKAETETATGFCSRKNKVPLLSVEALHHLHIFIFVL  169



>ref|XP_010528781.1| PREDICTED: MLO-like protein 1 [Tarenaya hassleriana]
Length=510

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 109/151 (72%), Gaps = 17/151 (11%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLAVERLLH+ G+ LK+K QKPL+EALQK+KEELMLLGFISLLLTV 
Sbjct  17   WVVAAVCTVIVAISLAVERLLHYLGQVLKRKKQKPLFEALQKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLSDK----AVHAAPETNSHH-----------RRLLS--G  387
            Q  I+KICV ED++RH+LPC L +       H+A  T               RRLL+   
Sbjct  77   QGVISKICVKEDLLRHMLPCQLPNSEEGGGEHSATTTKHFQKFAGFQIAGITRRLLAEHA  136

Query  388  GDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                GYCA+KHKVPLLS E LHHLHIFIFVL
Sbjct  137  AAQAGYCAQKHKVPLLSAEALHHLHIFIFVL  167



>ref|XP_007134284.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
 gb|ESW06278.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
Length=507

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 21/142 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S A ER LH+ G +LKKKNQKPL+EAL KIKEELMLLGFISLLLTV+Q+ I KICVPE  
Sbjct  31   SFAAERFLHYGGTFLKKKNQKPLFEALLKIKEELMLLGFISLLLTVTQNGIIKICVPESW  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLS---------------------GGDSVGYCAK  414
             RH+LPCSL DK    + +  SH +   S                      G+ +G+CAK
Sbjct  91   TRHMLPCSLKDKEELESAKLTSHFQTFFSFTDIPATVRHLLAENENEDHQSGEKLGHCAK  150

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            K +VPLLS+E LHHLHIFIFVL
Sbjct  151  KGRVPLLSVEALHHLHIFIFVL  172



>ref|XP_004244787.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=504

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER++H+ GKYL KKNQKPLYEALQKIKEELMLLGFISLLLTV Q+RI KIC+P+ +
Sbjct  31   SLLVERIIHYGGKYLLKKNQKPLYEALQKIKEELMLLGFISLLLTVLQARILKICIPKHL  90

Query  298  MRHLLPCSLSD---KAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
              H LPC   D    +VH      S     RRLLSG  + GYC  K K PLLSL  LHHL
Sbjct  91   TNHWLPCKKDDDVNDSVHFQTNFFSLIPGGRRLLSGSANSGYCEAKDKAPLLSLTALHHL  150

Query  460  HIFIFVL  480
            H FIFVL
Sbjct  151  HTFIFVL  157



>ref|XP_010422570.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=530

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 95/138 (69%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K CV ED+
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGLISKFCVKEDV  88

Query  298  MRHLLPCSLSDKAVHAAPE----TNSHH-----------RRLLS--GGDSVGYCAKKHKV  426
            + H+LPCSL  +A   A      T   H           RRLL+     +VGYC++K KV
Sbjct  89   LMHMLPCSLDSRAEAEASGHKNVTAEEHFQSFLPIVGTTRRLLAEHAAAAVGYCSEKQKV  148

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLSLE LHHLHIFIFVL
Sbjct  149  PLLSLEALHHLHIFIFVL  166



>ref|XP_008232215.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232216.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232217.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=488

 Score =   148 bits (374),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 94/135 (70%), Gaps = 14/135 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH  GKYLK+K QKPLYEAL K+KEELMLLGFISLLLTV Q+RITKICV   I
Sbjct  29   SLAAERALHSGGKYLKRKKQKPLYEALLKVKEELMLLGFISLLLTVFQNRITKICVKPGI  88

Query  298  MRHLLPCSL-----SDKAVHAAPETNS-------HHRRLLSGGDSV--GYCAKKHKVPLL  435
            M   LPCSL     +++ ++ A  + S         RRLL+ G     GYC KKHKVPLL
Sbjct  89   MDKWLPCSLQHNDQTNEEMYDAHFSTSLFGGIAGQTRRLLAAGGEAQQGYCGKKHKVPLL  148

Query  436  SLEGLHHLHIFIFVL  480
            S+E  HHLHIFIFVL
Sbjct  149  SVEAFHHLHIFIFVL  163



>ref|XP_006287341.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
 gb|EOA20239.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
Length=590

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 96/138 (70%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K+CV ED+
Sbjct  89   SLAVERLLHYFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGLISKLCVKEDV  148

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHH----------RRLLS--GGDSVGYCAKKHKV  426
            + H+LPCSL     ++++ H       H           RRLL+       GYC +KHKV
Sbjct  149  LMHMLPCSLHSRAEAEESGHKNVTAKEHFQSFLPIVGTTRRLLAEHAAAQAGYCTQKHKV  208

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLS+E LHHLHIFIFVL
Sbjct  209  PLLSVEALHHLHIFIFVL  226



>ref|NP_192169.1| MLO-like protein 1 [Arabidopsis thaliana]
 ref|NP_001031578.1| MLO-like protein 1 [Arabidopsis thaliana]
 sp|O49621.1|MLO1_ARATH RecName: Full=MLO-like protein 1; Short=AtMlo1; AltName: Full=MLO 
protein homolog 1; Short=AtMlo-H1 [Arabidopsis thaliana]
 emb|CAB08605.1| AtMlo-h1 [Arabidopsis thaliana]
 gb|AAC78258.1| AtMlo-h1 [Arabidopsis thaliana]
 emb|CAB80753.1| AtMlo-h1-like protein [Arabidopsis thaliana]
 gb|AAL59957.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AAM45040.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AEE82202.1| MLO-like protein 1 [Arabidopsis thaliana]
 gb|AEE82203.1| MLO-like protein 1 [Arabidopsis thaliana]
Length=526

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 95/138 (69%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K CV E++
Sbjct  29   SLAVERLLHYFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGLISKFCVKENV  88

Query  298  MRHLLPCSLSDKAVHAAPE----TNSHH-----------RRLLS--GGDSVGYCAKKHKV  426
            + H+LPCSL  +    A E    T   H           RRLL+      VGYC++K KV
Sbjct  89   LMHMLPCSLDSRREAGASEHKNVTAKEHFQTFLPIVGTTRRLLAEHAAVQVGYCSEKGKV  148

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLSLE LHHLHIFIFVL
Sbjct  149  PLLSLEALHHLHIFIFVL  166



>ref|XP_003520359.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN07795.1| MLO-like protein 1 [Glycine soja]
Length=517

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 95/146 (65%), Gaps = 25/146 (17%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S A ER LH+ GK+LK+KNQKPLYEALQKIKEELMLLGFISLLLT++Q+ I +ICVP   
Sbjct  30   SFAAERFLHYGGKFLKRKNQKPLYEALQKIKEELMLLGFISLLLTITQNGIIRICVPVGW  89

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLL------------SGGDSVG  402
              H+LPCSL D       +T SH              RRLL            + G+ +G
Sbjct  90   THHMLPCSLKDNGKEELTKTTSHFQTFFSFSDISGTARRLLAESESENEDHQPATGEKLG  149

Query  403  YCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +CA+K KVPLLS+E LHHLH FIFVL
Sbjct  150  HCARKGKVPLLSVEALHHLHTFIFVL  175



>ref|XP_007217923.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
 gb|EMJ19122.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
Length=488

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 90/135 (67%), Gaps = 14/135 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH  GKYL++K QKPLYEAL K+KEELMLLGFISLLLTV Q+RITKICV  +I
Sbjct  29   SLAAERALHSGGKYLRRKKQKPLYEALLKVKEELMLLGFISLLLTVFQNRITKICVKPEI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------RRLLSGGDSV--GYCAKKHKVPLL  435
            M   LPCSL           ++H             RRLL+ G     GYC KKHKVPLL
Sbjct  89   MDKWLPCSLQHNDQTNEEMDDAHFSTSLSGGIAGQTRRLLAAGGEAQQGYCGKKHKVPLL  148

Query  436  SLEGLHHLHIFIFVL  480
            S+E  HHLHIFIFVL
Sbjct  149  SVEAFHHLHIFIFVL  163



>gb|KJB28899.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=497

 Score =   147 bits (370),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 79/129 (61%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LHF GKYLKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q RI KIC+ +D+
Sbjct  32   SLVAERILHFFGKYLKKKNQKPLFEALQKIKEELMLLGFISLLLTVFQDRIAKICISKDL  91

Query  298  MRHLLPCSLSDKAVHAAPET-------NSHHRRLLSG-GDSVGYCAKKHKVPLLSLEGLH  453
                LPC    +      +T       N + RRLL+   DS  YC  K KVPLLS   LH
Sbjct  92   AHQWLPCKEKKEVTIEHFQTLFSSFLPNGNGRRLLAEPADSTAYCTTKGKVPLLSTTALH  151

Query  454  HLHIFIFVL  480
            HLHIFIFVL
Sbjct  152  HLHIFIFVL  160



>ref|XP_006858689.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
 gb|ERN20156.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
Length=510

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 11/145 (8%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVC+V V ISL +ER LHF GK+LK+KNQKPL+EALQK+KEELMLLGFISLLLTV 
Sbjct  19   WVVAAVCSVFVFISLFLERFLHFLGKFLKRKNQKPLFEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCS-----LSDKAVH----AAPETNSHHRRLLSGGDS--VGY  405
            Q  I +IC+PE  +RH+LPC       S +  H     + +   + RRLL+   S  +G+
Sbjct  79   QGLIGRICIPESFVRHMLPCEKEGAPSSSETKHFQSFFSSDITGNKRRLLAEAASTELGH  138

Query  406  CAKKHKVPLLSLEGLHHLHIFIFVL  480
            CAK+ KVPLLSLE LHHLHIFIFVL
Sbjct  139  CAKQGKVPLLSLEALHHLHIFIFVL  163



>ref|XP_010456010.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=532

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 95/138 (69%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K CV ED+
Sbjct  29   SLAVERLLHYFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGLISKFCVKEDV  88

Query  298  MRHLLPCSLSDKAVHAAP----ETNSHH-----------RRLLS--GGDSVGYCAKKHKV  426
            + H+LPC+L  +A   A      T   H           RRLL+     + GYC++K KV
Sbjct  89   LMHMLPCTLDSRAEAEASGHKNATAKEHFQSFLPIVGTTRRLLAEHAAAAAGYCSEKQKV  148

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLSLE LHHLHIFIFVL
Sbjct  149  PLLSLEALHHLHIFIFVL  166



>ref|XP_003547751.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHM99994.1| MLO-like protein 1 [Glycine soja]
Length=515

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 91/144 (63%), Gaps = 23/144 (16%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S A ER LH+ GK+LK+KNQKPLYEAL+KIKEELMLLGFISLLLT++Q+ I +ICVP   
Sbjct  30   SFAAERFLHYGGKFLKRKNQKPLYEALEKIKEELMLLGFISLLLTITQNGIIRICVPVGW  89

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGY-----------------------C  408
              H+LPCSL DK    + +T SH +   S  D  G                        C
Sbjct  90   THHMLPCSLKDKEKEESTKTTSHFQTFFSFSDISGTARRLLAESESENEDHQPATGEKLC  149

Query  409  AKKHKVPLLSLEGLHHLHIFIFVL  480
            A+K KVPLLS+E LHHLH FIFVL
Sbjct  150  ARKGKVPLLSVEALHHLHTFIFVL  173



>ref|XP_010429895.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=533

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 94/138 (68%), Gaps = 17/138 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K CV ED+
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGLISKFCVKEDV  88

Query  298  MRHLLPCSLSDKAVHAAPE----TNSHH-----------RRLLS--GGDSVGYCAKKHKV  426
            + H+LPCSL  +A     E    T   H           RRLL+     + GYC++K KV
Sbjct  89   LMHMLPCSLDSRAEAEESEHKNVTAKEHFQSFLPIVGTTRRLLAEHAAAAAGYCSEKQKV  148

Query  427  PLLSLEGLHHLHIFIFVL  480
            PLLSLE LHHLHIFIFVL
Sbjct  149  PLLSLEALHHLHIFIFVL  166



>ref|XP_002874907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51166.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 104/151 (69%), Gaps = 17/151 (11%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLAVERLLH+ G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLAVERLLHYFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE-----TNSHHRRLL------------SG  387
            Q  I+K CV ED++ H+LPCSL  +    A E        H +  L              
Sbjct  76   QGLISKFCVKEDVLLHMLPCSLDSRREAEANEHKNVTAKEHFQTFLPIVGTTRRLLAEHA  135

Query  388  GDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                GYC++KHKVPLLS+E LHHLHIFIFVL
Sbjct  136  AAEAGYCSQKHKVPLLSVEALHHLHIFIFVL  166



>ref|XP_009794451.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 8/142 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAAVCTVIV+ISLA+ER LH+TGK+LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  19   WIVAAVCTVIVSISLALERFLHYTGKHLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNS-------HHRRLL-SGGDSVGYCAK  414
            Q RI K CV +D+++HLLPCSLS +A  + P  ++       HHR LL     +VGYC  
Sbjct  79   QGRIVKFCVHQDVVKHLLPCSLSLEANSSLPHESTPASPHSHHHRHLLVEEAAAVGYCHH  138

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            KHKVPLLSLE LHHLHIFIFVL
Sbjct  139  KHKVPLLSLEALHHLHIFIFVL  160



>ref|XP_009615189.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=504

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER++H+ GKYL KKNQKPLYEALQKIKEELMLLGFISLLLTV Q R+ KIC+P+ +
Sbjct  31   SLFVERIIHYAGKYLLKKNQKPLYEALQKIKEELMLLGFISLLLTVFQDRMVKICIPKHL  90

Query  298  MRHLLPCSLSDKA---VHAAPETNSHH------RRLLSGGDSVGYCAKKHKVPLLSLEGL  450
                LPC   + A   VH    + +        RRLL+   + GYC  K K PLLSL  L
Sbjct  91   ANSWLPCKKGEDANQTVHFQTSSGNFFSLIPGGRRLLADSANSGYCEAKDKAPLLSLTAL  150

Query  451  HHLHIFIFVL  480
            HHLH FIFVL
Sbjct  151  HHLHTFIFVL  160



>ref|XP_006396473.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
 dbj|BAJ33805.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37926.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
Length=516

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 92/135 (68%), Gaps = 14/135 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV Q  I+K CV ED+
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVFQGFISKFCVNEDV  88

Query  298  MRHLLPCSLSDK--AVHAAPETNSHH----------RRLLS--GGDSVGYCAKKHKVPLL  435
            + H+LPCS   K  A H       H           RRLL+     + GYC++K KVPLL
Sbjct  89   LMHMLPCSKDAKLEAEHKNVTATEHFQTFLPIVGTTRRLLAEHAAAAAGYCSQKGKVPLL  148

Query  436  SLEGLHHLHIFIFVL  480
            SLE LHHLHIFIFVL
Sbjct  149  SLEALHHLHIFIFVL  163



>ref|XP_007020280.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY17505.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=489

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER+LHF GKYLKKKNQKPL+EALQKIK ELMLLGFISLLLTV Q RI KIC+P+D+
Sbjct  27   SLAVERILHFIGKYLKKKNQKPLFEALQKIKAELMLLGFISLLLTVFQDRIAKICIPKDL  86

Query  298  MRHLLPCSLSDKAVHAAPET-------NSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLH  453
                LPC    +      +T       ++  R LL+    +  YC  K KVPLLS   LH
Sbjct  87   ANQWLPCQEKKEQTVTHIQTLFFSFLPHATGRHLLAEASGTASYCTAKGKVPLLSTTALH  146

Query  454  HLHIFIFVL  480
            HLHIFIFVL
Sbjct  147  HLHIFIFVL  155



>ref|XP_009615188.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=508

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER++H+ GKYL KKNQKPLYEALQKIKEELMLLGFISLLLTV Q R+ KIC+P+ +
Sbjct  31   SLFVERIIHYAGKYLLKKNQKPLYEALQKIKEELMLLGFISLLLTVFQDRMVKICIPKHL  90

Query  298  MRHLLPCSLSDKA---VHAAPETNSHH------RRLLSGGDSVGYCAKKHKVPLLSLEGL  450
                LPC   + A   VH    + +        RRLL+   + GYC  K K PLLSL  L
Sbjct  91   ANSWLPCKKGEDANQTVHFQTSSGNFFSLIPGGRRLLADSANSGYCEAKDKAPLLSLTAL  150

Query  451  HHLHIFIFVL  480
            HHLH FIFVL
Sbjct  151  HHLHTFIFVL  160



>ref|XP_010908325.1| PREDICTED: MLO-like protein 1 isoform X2 [Elaeis guineensis]
Length=405

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VERLLH+ GK LKKKNQKPL++ALQK+KEELM+LGFISLLLTV Q  I  IC+PE  
Sbjct  33   SLFVERLLHYFGKALKKKNQKPLFDALQKVKEELMVLGFISLLLTVFQGSIQNICIPEGW  92

Query  298  MRHLLPC--SLSDKAV--HAAPETNSHHRRLLSG-GDSVGYCAKKHKVPLLSLEGLHHLH  462
             RH+LPC   L + A   H         RRLLSG G    +C +K KVPLLSLE +HHLH
Sbjct  93   TRHMLPCKKELEEAATTEHFFAGVLGSGRRLLSGSGLGEEHCRRKGKVPLLSLEAIHHLH  152

Query  463  IFIFVL  480
            IFIFVL
Sbjct  153  IFIFVL  158



>ref|XP_009794450.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana sylvestris]
Length=494

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 8/142 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAAVCTVIV+ISLA+ER LH+TGK+LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  19   WIVAAVCTVIVSISLALERFLHYTGKHLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNS-------HHRRLL-SGGDSVGYCAK  414
            Q RI K CV +D+++HLLPCSLS +A  + P  ++       HHR LL     +VGYC  
Sbjct  79   QGRIVKFCVHQDVVKHLLPCSLSLEANSSLPHESTPASPHSHHHRHLLVEEAAAVGYCHH  138

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            KHKVPLLSLE LHHLHIFIFVL
Sbjct  139  KHKVPLLSLEALHHLHIFIFVL  160



>ref|XP_009413424.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 90/126 (71%), Gaps = 6/126 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH+ GK LK+KNQKPL++ALQKIKEELMLLGFISLLL   Q  I +ICV E +
Sbjct  31   SLVFERLLHYLGKTLKRKNQKPLFDALQKIKEELMLLGFISLLLVAFQGTIQRICVRESL  90

Query  298  MRHLLPCSLSDKAVHAAPET---NSHHRRLLSGG--DSVGYCAKKHKVPLLSLEGLHHLH  462
            M HL PC   D A  AA  +   +   RRLL+GG  DS  +C KK KVPLLSLE +H LH
Sbjct  91   MHHLRPCKKDDTATAAAHFSVGFSGGARRLLAGGGADST-HCQKKGKVPLLSLEAIHELH  149

Query  463  IFIFVL  480
            IFIFVL
Sbjct  150  IFIFVL  155



>ref|XP_006366803.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=507

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 110/158 (70%), Gaps = 24/158 (15%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV+ISLAVERL+H+ GK LK+K QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  17   WVVAAVCTVIVSISLAVERLIHYAGKRLKRKKQKHLYEALQKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSL------------SDKAVHAAPETNS---------HHRR  375
            QSRI +ICVP  ++ HLLPC+L            S    H  P  N+         HH+R
Sbjct  77   QSRIVEICVPPRVVTHLLPCALPLEHTSFSSPTPSPPPTHEEPHVNNQTVHYHAGPHHQR  136

Query  376  LLSGGDSV---GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             L   +++   GYC  K+KVPLLSLE LHHLH+FIFVL
Sbjct  137  HLLAEETMTAEGYCHHKNKVPLLSLEALHHLHVFIFVL  174



>gb|KDO49431.1| hypothetical protein CISIN_1g0104501mg [Citrus sinensis]
Length=298

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 20/154 (13%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL  ERLLH+ G+YLK K QK L+EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLGAERLLHYLGRYLKNKKQKSLFEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE----TNSHH------------RRLLSGG  390
            Q+ I+KICV +D++ ++LPC  +  A          T SH             +RLL+  
Sbjct  76   QNTISKICVHQDVLDNMLPCKRNKTAESEGQNSHVTTTSHFQTFFSSSISGTAKRLLAEE  135

Query  391  DSV----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +S     GYCA+K+KVPLLS E LHHLHIFIFVL
Sbjct  136  ESAASERGYCAQKNKVPLLSTEALHHLHIFIFVL  169



>ref|XP_010908317.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=498

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VERLLH+ GK LKKKNQKPL++ALQK+KEELM+LGFISLLLTV Q  I  IC+PE  
Sbjct  33   SLFVERLLHYFGKALKKKNQKPLFDALQKVKEELMVLGFISLLLTVFQGSIQNICIPEGW  92

Query  298  MRHLLPC--SLSDKAV--HAAPETNSHHRRLLSG-GDSVGYCAKKHKVPLLSLEGLHHLH  462
             RH+LPC   L + A   H         RRLLSG G    +C +K KVPLLSLE +HHLH
Sbjct  93   TRHMLPCKKELEEAATTEHFFAGVLGSGRRLLSGSGLGEEHCRRKGKVPLLSLEAIHHLH  152

Query  463  IFIFVL  480
            IFIFVL
Sbjct  153  IFIFVL  158



>ref|NP_001268003.1| MLO5 protein [Vitis vinifera]
 gb|ACF25909.1| MLO-like protein 1 [Vitis vinifera]
 emb|CBI25680.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 93/124 (75%), Gaps = 8/124 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LHF GKYLKKKNQ PL++ALQK+KEELMLLGFISLLLTV Q+ ITK CVP+ +
Sbjct  31   SLAVERFLHFLGKYLKKKNQNPLFQALQKVKEELMLLGFISLLLTVFQNLITKFCVPKHV  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHH---RRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + HLLPC L ++    A ++ SH    R LLS   S   C+ + KVP LSLE LHHLHIF
Sbjct  91   VSHLLPCKLPEEK--HATQSLSHWALGRHLLSSAPSS--CSNE-KVPFLSLEALHHLHIF  145

Query  469  IFVL  480
            IFVL
Sbjct  146  IFVL  149



>ref|XP_009757992.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=505

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER++H+ GKYL KKNQKPLYEALQKIKEELMLLGFISLLLTV Q R+ KIC+P+ +
Sbjct  31   SLVVERIIHYAGKYLLKKNQKPLYEALQKIKEELMLLGFISLLLTVFQERMLKICIPKHL  90

Query  298  MRHLLPCSLSDKA---VHAAPETNSHH------RRLLSGGDSVGYCAKKHKVPLLSLEGL  450
                LPC   + A   VH    +++        RRLL+   + GYC  K K PLLSL  L
Sbjct  91   SNTWLPCKKDEDANETVHFQTSSSNFFSLIPGGRRLLAESANSGYCKAKDKAPLLSLTAL  150

Query  451  HHLHIFIFVL  480
            HHLH FIFVL
Sbjct  151  HHLHTFIFVL  160



>ref|XP_009600158.1| PREDICTED: MLO-like protein 1 isoform X3 [Nicotiana tomentosiformis]
Length=456

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV+ISLA+ER LH+TGK+LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  19   WVVAAVCTVIVSISLALERFLHYTGKHLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKA--------VHAAPETNSHHRRLLSGGDSVGYCAK  414
            Q RI K CV +D+++HLLPCSLS +A          A+P ++ H   L+     VGYC  
Sbjct  79   QGRIVKFCVHQDVVKHLLPCSLSLEANSSSSHESTPASPHSHHHRHLLVEEAAVVGYCHH  138

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            KHKVPLLSLE LHHLHIFIFVL
Sbjct  139  KHKVPLLSLEALHHLHIFIFVL  160



>ref|XP_006437325.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 gb|ESR50565.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=344

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 20/154 (13%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL  ERLLH+ G+YLK K QK L+EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLGAERLLHYLGRYLKNKKQKSLFEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE----TNSHH------------RRLLSGG  390
            Q+ I+KICV +D++ ++LPC  +  A          T SH             +RLL+  
Sbjct  76   QNTISKICVHQDVLDNMLPCKRNKTAESEGQNSHVTTTSHFQTFFSSSISGTAKRLLAEE  135

Query  391  DSV----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +S     GYCA+K+KVPLLS E LHHLHIFIFVL
Sbjct  136  ESAASERGYCAQKNKVPLLSTEALHHLHIFIFVL  169



>ref|XP_009600156.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=493

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV+ISLA+ER LH+TGK+LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  19   WVVAAVCTVIVSISLALERFLHYTGKHLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKA--------VHAAPETNSHHRRLLSGGDSVGYCAK  414
            Q RI K CV +D+++HLLPCSLS +A          A+P ++ H   L+     VGYC  
Sbjct  79   QGRIVKFCVHQDVVKHLLPCSLSLEANSSSSHESTPASPHSHHHRHLLVEEAAVVGYCHH  138

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            KHKVPLLSLE LHHLHIFIFVL
Sbjct  139  KHKVPLLSLEALHHLHIFIFVL  160



>ref|XP_006351085.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=504

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 87/127 (69%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER++H+ GKYL KKNQKPLYEALQKIKEELMLLGFISLLLTV Q RI KIC+P+ +
Sbjct  31   SLLVERIIHYGGKYLLKKNQKPLYEALQKIKEELMLLGFISLLLTVLQERILKICIPKHL  90

Query  298  MRHLLPCSLS---DKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
                LPC      ++ VH      S     RRLL+   + GYC  K K PLLSL  LHHL
Sbjct  91   TNQWLPCKKDGDVNETVHFQTNFFSLVPGGRRLLAESANSGYCEAKDKAPLLSLTALHHL  150

Query  460  HIFIFVL  480
            H FIFVL
Sbjct  151  HTFIFVL  157



>ref|XP_010672534.1| PREDICTED: MLO-like protein 15 [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   140 bits (354),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 4/122 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER +H+TGKYLKK N+KPL++ALQKIKEELML+GFISLLLTV Q RI ++C+ +++
Sbjct  29   SLAAERFIHYTGKYLKKTNKKPLFQALQKIKEELMLVGFISLLLTVFQGRIGRLCISQNL  88

Query  298  MRHLLPC-SLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
                LPC  +SD  VH   +T+   R LL+      YC +K KVP+LS+  LHHLHIFIF
Sbjct  89   ANKWLPCKKISDPIVH---QTHVTWRHLLAEATDSTYCQQKGKVPMLSVTALHHLHIFIF  145

Query  475  VL  480
            VL
Sbjct  146  VL  147



>ref|XP_009600155.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=554

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV+ISLA+ER LH+TGK+LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  19   WVVAAVCTVIVSISLALERFLHYTGKHLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSDKA--------VHAAPETNSHHRRLLSGGDSVGYCAK  414
            Q RI K CV +D+++HLLPCSLS +A          A+P ++ H   L+     VGYC  
Sbjct  79   QGRIVKFCVHQDVVKHLLPCSLSLEANSSSSHESTPASPHSHHHRHLLVEEAAVVGYCHH  138

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            KHKVPLLSLE LHHLHIFIFVL
Sbjct  139  KHKVPLLSLEALHHLHIFIFVL  160



>gb|KJB82477.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82478.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82479.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82480.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82481.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
Length=504

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 14/148 (9%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAA+CTVIVAISLA+ERLLH  G  LK+K QKPL+EAL K+KEELMLLGFISLLLTV 
Sbjct  17   WIVAAICTVIVAISLAMERLLHVIGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAPETNSHHRRL----LSGGD--------S  396
            Q+ I+KICV  D++  +LPC   D  +    +  T SH ++     LSGG         S
Sbjct  77   QNAISKICVSSDVLTGMLPCKREDNKETGEGSNHTTSHFQKYFALTLSGGTRHLLAETPS  136

Query  397  VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             GYCAKK KVPLLS+E LH LHIFIFVL
Sbjct  137  TGYCAKKGKVPLLSVEALHQLHIFIFVL  164



>emb|CDY21899.1| BnaC09g00050D [Brassica napus]
Length=529

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 86/136 (63%), Gaps = 15/136 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV+Q  I+K CV ED+
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVTQGFISKFCVKEDV  88

Query  298  MRHLLPCS---LSDKAVHAAPETNSHHRRLL------------SGGDSVGYCAKKHKVPL  432
            + H+LPCS         H       H +  L                  GYC +K KVPL
Sbjct  89   LMHMLPCSKLEAESSKQHKNATVTEHFQSFLPIVGTTRRLLAEHAAAEAGYCGQKDKVPL  148

Query  433  LSLEGLHHLHIFIFVL  480
            LSLE LHHLHIFIFVL
Sbjct  149  LSLEALHHLHIFIFVL  164



>gb|KHG28286.1| MLO-like protein 1 [Gossypium arboreum]
Length=516

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 14/148 (9%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAA+CTVIVAISLA+ERLLH  G  LK+K QKPL+EAL K+KEELMLLGFISLLLTV 
Sbjct  17   WIVAAICTVIVAISLAMERLLHVVGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAPETNSHHRRL----LSGGD--------S  396
            Q+ I+KICV  D++  +LPC   D  +    +  T SH ++     LSGG         S
Sbjct  77   QNAISKICVSSDVLTSMLPCKREDNKETGEDSNHTTSHFQKYFALTLSGGTRHLLAETPS  136

Query  397  VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             GYCAKK KVPLLS+E LH LHIFIFVL
Sbjct  137  TGYCAKKGKVPLLSVEALHQLHIFIFVL  164



>gb|KDO49430.1| hypothetical protein CISIN_1g0104501mg [Citrus sinensis]
Length=396

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 20/154 (13%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL  ERLLH+ G+YLK K QK L+EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLGAERLLHYLGRYLKNKKQKSLFEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE----TNSHH------------RRLLSGG  390
            Q+ I+KICV +D++ ++LPC  +  A          T SH             +RLL+  
Sbjct  76   QNTISKICVHQDVLDNMLPCKRNKTAESEGQNSHVTTTSHFQTFFSSSISGTAKRLLAEE  135

Query  391  DSV----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +S     GYCA+K+KVPLLS E LHHLHIFIFVL
Sbjct  136  ESAASERGYCAQKNKVPLLSTEALHHLHIFIFVL  169



>gb|KHG28287.1| MLO-like protein 1 [Gossypium arboreum]
Length=503

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 92/135 (68%), Gaps = 14/135 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ERLLH  G  LK+K QKPL+EAL K+KEELMLLGFISLLLTV Q+ I+KICV  D+
Sbjct  17   SLAMERLLHVVGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVFQNAISKICVSSDV  76

Query  298  MRHLLPCSLSD--KAVHAAPETNSHHRRL----LSGGD--------SVGYCAKKHKVPLL  435
            +  +LPC   D  +    +  T SH ++     LSGG         S GYCAKK KVPLL
Sbjct  77   LTSMLPCKREDNKETGEDSNHTTSHFQKYFALTLSGGTRHLLAETPSTGYCAKKGKVPLL  136

Query  436  SLEGLHHLHIFIFVL  480
            S+E LH LHIFIFVL
Sbjct  137  SVEALHQLHIFIFVL  151



>gb|KHG28285.1| MLO-like protein 1 [Gossypium arboreum]
Length=537

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 14/148 (9%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAA+CTVIVAISLA+ERLLH  G  LK+K QKPL+EAL K+KEELMLLGFISLLLTV 
Sbjct  38   WIVAAICTVIVAISLAMERLLHVVGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVF  97

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAPETNSHHRRL----LSGGD--------S  396
            Q+ I+KICV  D++  +LPC   D  +    +  T SH ++     LSGG         S
Sbjct  98   QNAISKICVSSDVLTSMLPCKREDNKETGEDSNHTTSHFQKYFALTLSGGTRHLLAETPS  157

Query  397  VGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             GYCAKK KVPLLS+E LH LHIFIFVL
Sbjct  158  TGYCAKKGKVPLLSVEALHQLHIFIFVL  185



>ref|XP_010040798.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=517

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 89/132 (67%), Gaps = 13/132 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LH+ GKYLKK+NQKPL++ALQKIKEELMLLGFISLLL V Q RI  IC+ E++
Sbjct  29   SLAVERFLHYAGKYLKKRNQKPLFDALQKIKEELMLLGFISLLLAVFQERIDNICISEEL  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH---------RRLLS--GGDSVGYCAKKHKVPLLSLE  444
                LPC   ++A      T +H          RRLL+     S  YC+ K KVPLLSL 
Sbjct  89   ADKWLPC--KERAADKHSSTTAHFLTNFFPPGGRRLLTEDSAASSDYCSGKGKVPLLSLT  146

Query  445  GLHHLHIFIFVL  480
             LHHLHIFIFVL
Sbjct  147  ALHHLHIFIFVL  158



>ref|XP_010251439.1| PREDICTED: MLO-like protein 1 isoform X2 [Nelumbo nucifera]
Length=477

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = +1

Query  151  GKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSLSD  330
            G YLKKKNQKPL+EAL K+KEELMLLGFISLLLTV Q RI KIC+ +D+ RH+LPC L +
Sbjct  33   GWYLKKKNQKPLFEALLKVKEELMLLGFISLLLTVLQERIGKICISKDLARHMLPCKLHE  92

Query  331  KAVH------AAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             +        + P  +   RRLL+ G   GYC KK KVPLLS+  LHHLHIFIFVL
Sbjct  93   MSSTEHYQSISTPFISGIGRRLLTSGAGSGYCLKKEKVPLLSITALHHLHIFIFVL  148



>ref|XP_009111270.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=529

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 86/136 (63%), Gaps = 15/136 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPLYEALQK+KEELMLLGFISLLLTV+Q  I+K CV ED+
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLYEALQKVKEELMLLGFISLLLTVTQGFISKFCVKEDV  88

Query  298  MRHLLPCS---LSDKAVHAAPETNSHHRRLL------------SGGDSVGYCAKKHKVPL  432
            + H+LPCS         H       H +  L                  GYC +K K+PL
Sbjct  89   LMHMLPCSKHEAESSKQHKNATVTEHFQSFLPIVGTTRRLLAEHAAAEAGYCGQKDKIPL  148

Query  433  LSLEGLHHLHIFIFVL  480
            LSLE LHHLHIFIFVL
Sbjct  149  LSLEALHHLHIFIFVL  164



>ref|XP_009355375.1| PREDICTED: MLO-like protein 13 [Pyrus x bretschneideri]
Length=497

 Score =   139 bits (349),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK + Q  L+EALQK+KEELMLLGFISLLLTVSQ  I +IC+P ++
Sbjct  29   SLCAERALHKLGKYLKHEKQDALFEALQKLKEELMLLGFISLLLTVSQRSIIRICIPSNL  88

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
              H+LPC       ++ A ++  ++ ++ RRLLS   +  +C +K KVPLLSLE LHHLH
Sbjct  89   ANHMLPCKRETSEGNNNAHYSLDQSINNRRRLLSADTNSNHCLQKGKVPLLSLEALHHLH  148

Query  463  IFIFVL  480
            IFIFVL
Sbjct  149  IFIFVL  154



>gb|EYU22368.1| hypothetical protein MIMGU_mgv1a0228201mg, partial [Erythranthe 
guttata]
Length=162

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 99/146 (68%), Gaps = 17/146 (12%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VA VCT+IVAISL VER LH+ GKY  KKNQ  LY+ALQKIKEELMLLGFISLLLTV 
Sbjct  17   WIVALVCTIIVAISLFVERFLHYAGKYFIKKNQASLYQALQKIKEELMLLGFISLLLTVL  76

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSH---HRRLLSG---------GDSVG  402
            Q  I+KIC+P+ +M H LPC+  DKAV    ++ SH       L G          + VG
Sbjct  77   QDSISKICIPKGVMNHWLPCN-PDKAV----KSESHLADSSFFLPGARRLLAAAASEGVG  131

Query  403  YCAKKHKVPLLSLEGLHHLHIFIFVL  480
            YC  K K PLLSL+ LH LHIFI VL
Sbjct  132  YCEAKGKAPLLSLKALHDLHIFILVL  157



>gb|KDO49428.1| hypothetical protein CISIN_1g0104501mg, partial [Citrus sinensis]
Length=437

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 20/154 (13%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL  ERLLH+ G+YLK K QK L+EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLGAERLLHYLGRYLKNKKQKSLFEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE----TNSHH------------RRLLSGG  390
            Q+ I+KICV +D++ ++LPC  +  A          T SH             +RLL+  
Sbjct  76   QNTISKICVHQDVLDNMLPCKRNKTAESEGQNSHVTTTSHFQTFFSSSISGTAKRLLAEE  135

Query  391  DSV----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +S     GYCA+K+KVPLLS E LHHLHIFIFVL
Sbjct  136  ESAASERGYCAQKNKVPLLSTEALHHLHIFIFVL  169



>ref|XP_008798739.1| PREDICTED: MLO-like protein 13 [Phoenix dactylifera]
Length=529

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 12/131 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ GK+LK K Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ IC+PE +
Sbjct  43   SLAVERLLHYLGKFLKHKRQDALFEALQKVKEELMLLGFISLLLTVFQGSISNICIPESV  102

Query  298  MRHLLPCSLSDKAVHAAPET----NSHH------RRLLSGGDSVGYCAKKHKVPLLSLEG  447
              H+LPC    + + +A E     N +H      RRLL+ G S  +C  K KVPLLSLE 
Sbjct  103  STHMLPC--KKEGLTSAQENYHGKNFYHGRTWNKRRLLAEGASSDHCTSKGKVPLLSLEA  160

Query  448  LHHLHIFIFVL  480
            LH LHIFIFVL
Sbjct  161  LHQLHIFIFVL  171



>ref|XP_008802190.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=240

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VA VC+VIV ISL  ER+LHF GK LK+K QKPL+EALQK+KEELMLLGFISLLLTV 
Sbjct  18   WIVAVVCSVIVFISLFFERILHFLGKLLKRKKQKPLFEALQKVKEELMLLGFISLLLTVF  77

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHA-------APETNSHHRRLLSGGDSVGYCAKK  417
            Q  I + C+ E +  H+LPC   + A  A       +    S  R L  GG+   +C K+
Sbjct  78   QGAIQRTCIRESLTHHMLPCKRKEAATTAHYAVRFFSGVLGSGRRLLAGGGEDSTHCQKE  137

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE +H LHIFIFVL
Sbjct  138  GKVPLLSLEAIHQLHIFIFVL  158



>ref|XP_006437326.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 ref|XP_006484761.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
 gb|ESR50566.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=510

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 20/154 (13%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISL  ERLLH+ G+YLK K QK L+EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLGAERLLHYLGRYLKNKKQKSLFEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPE----TNSHH------------RRLLSGG  390
            Q+ I+KICV +D++ ++LPC  +  A          T SH             +RLL+  
Sbjct  76   QNTISKICVHQDVLDNMLPCKRNKTAESEGQNSHVTTTSHFQTFFSSSISGTAKRLLAEE  135

Query  391  DSV----GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            +S     GYCA+K+KVPLLS E LHHLHIFIFVL
Sbjct  136  ESAASERGYCAQKNKVPLLSTEALHHLHIFIFVL  169



>emb|CDP19084.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 86/137 (63%), Gaps = 16/137 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LH+ GKYL KKNQKPLY+AL KIKEELMLLGFISLLLTVSQSRI +IC+ + +
Sbjct  31   SLFAERVLHYAGKYLLKKNQKPLYQALLKIKEELMLLGFISLLLTVSQSRINEICIAKHL  90

Query  298  MRHLLPCSLSDKAVHAA---------------PETNSHHRRLLSGGDSV-GYCAKKHKVP  429
                LPC   D    +                P     HRRLL+   S  GYC K+ K P
Sbjct  91   TDDWLPCKKKDDTSSSTTSHLQTTSAFFSSLLPGPGGLHRRLLAEASSTQGYCEKRGKAP  150

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSL  LHHLHIFIF L
Sbjct  151  LLSLTALHHLHIFIFAL  167



>ref|XP_008788294.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=490

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 90/134 (67%), Gaps = 17/134 (13%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LKKKNQKPL++ALQK+KEELMLLGFISLLLTV Q  I  IC+PE  
Sbjct  33   SLFVERFLHYLGKDLKKKNQKPLFDALQKVKEELMLLGFISLLLTVFQGAIQNICIPEGW  92

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------RRLLSG-GDSVGYCAKKHKVPLLS  438
             RH+LPC    K +  A ET  H             RRLLSG G    +C +K KVPLLS
Sbjct  93   TRHMLPCK---KELEEA-ETTEHFSSAFFAGVLGSGRRLLSGSGLGEEHCQRKGKVPLLS  148

Query  439  LEGLHHLHIFIFVL  480
            LE +H LHIFIFVL
Sbjct  149  LEAIHQLHIFIFVL  162



>ref|XP_003636499.1| MLO-like protein [Medicago truncatula]
 gb|KEH18068.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   137 bits (345),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 86/156 (55%), Positives = 102/156 (65%), Gaps = 22/156 (14%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVA VCTVIVA+S AVER LH+ GK LKKKNQKPL+EALQKIKEELM+LGFISL LTV+
Sbjct  20   WVVALVCTVIVAVSFAVERSLHYLGKVLKKKNQKPLFEALQKIKEELMILGFISLFLTVT  79

Query  259  QSRITKICVPEDIMRHLLPCSLS--DKAVHAAPETNSHHRRLLSGGD-------------  393
            Q+ + KICVP +   H+LPCS++  D+       + SH +   S  D             
Sbjct  80   QNGMIKICVPVEWTIHMLPCSINGDDEVKETKLPSKSHFQTFFSSKDVFGTAKRLLGDDH  139

Query  394  -------SVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                    +GYC  K KVPLLS+E LH LHIFIFVL
Sbjct  140  DHSSKDEEIGYCTAKGKVPLLSVEALHKLHIFIFVL  175



>gb|EYU36622.1| hypothetical protein MIMGU_mgv1a005184mg [Erythranthe guttata]
Length=494

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 89/133 (67%), Gaps = 17/133 (13%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GKY  KKNQ  LY+ALQKIKEELMLLGFISLLLTV Q  I+KIC+P+++
Sbjct  30   SLFVERFLHYAGKYFIKKNQASLYQALQKIKEELMLLGFISLLLTVLQDSISKICIPKNV  89

Query  298  MRHLLPCSLSDKAVHAAPETNSH---HRRLLSG---------GDSVGYCAKKHKVPLLSL  441
            M H LPC+  DKAV    ++ SH       L G          + VGYC  K K PLLSL
Sbjct  90   MNHWLPCN-PDKAV----KSESHLADSSFFLPGARRLLAAAASEGVGYCEAKGKAPLLSL  144

Query  442  EGLHHLHIFIFVL  480
            + LH LHIFIFVL
Sbjct  145  KALHDLHIFIFVL  157



>ref|XP_007029886.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY10388.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=510

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 19/153 (12%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WV+AAVCTVIVAISLA+ERLLH+ G  LKKK QKPL+EAL K+KEELMLLGFISLLLTV 
Sbjct  16   WVLAAVCTVIVAISLAMERLLHYLGNILKKKQQKPLFEALLKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLS---DKAVHAAPETNSHH-------------RRLL---  381
            QS I+KIC+  + +  +LPC +    + A H+     + H             RRLL   
Sbjct  76   QSAISKICISREAVTSMLPCKIEGNKETAEHSNSTATTSHFQKYFAFTLSGGTRRLLAET  135

Query  382  SGGDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            S    +GYC +K+KVPLLS+E LHHLHIFIFVL
Sbjct  136  SSASQMGYCGEKNKVPLLSVEALHHLHIFIFVL  168



>ref|XP_006478537.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=487

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 89/137 (65%), Gaps = 19/137 (14%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LH+ GK LKK NQKPL+EALQKIKEELMLLGFISLLLTV Q  I KIC+ E++
Sbjct  27   SLAVERFLHYIGKVLKKNNQKPLFEALQKIKEELMLLGFISLLLTVFQGMIAKICISEEL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH---------------RRLLS-GGDSVGYCAKKHKVP  429
                LPC   DK  H A   ++ H               RRLL+    S  YCA K KVP
Sbjct  87   ASKWLPC---DKKEHKAATKSTAHFESFFSSFTSHHGAGRRLLAESSASSDYCAGKGKVP  143

Query  430  LLSLEGLHHLHIFIFVL  480
            LLS+  LHHLHIFIFVL
Sbjct  144  LLSITALHHLHIFIFVL  160



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH  GK L+ + Q  LYEALQK+KEELMLLGFISLLLTVSQ  I++IC+P  +
Sbjct  648  SLCVERGLHKLGKCLQHERQDALYEALQKLKEELMLLGFISLLLTVSQRSISRICIPAHV  707

Query  298  MRHLLPCSLSDKAVHAAP------ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
              H+LPC   + A H  P      +  ++ RRLLS   S  +C  K KVPLLSLEGLHHL
Sbjct  708  ATHMLPCK-RETAEHNTPAHYFLNQATNNGRRLLSEATS-DHCQLKGKVPLLSLEGLHHL  765

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  766  HIFIFVL  772



>ref|XP_010930330.1| PREDICTED: MLO-like protein 1 [Elaeis guineensis]
Length=496

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VERLLH  GKYLKKKNQKPL+ ALQK+K ELML+GFISLLLTV Q    +IC+P+  
Sbjct  31   SLVVERLLHLLGKYLKKKNQKPLFNALQKVKGELMLVGFISLLLTVFQDETQRICIPKTW  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIFV  477
              H+LPC     +  A        R L +GG S  YC K  KVPLLS+  LH LHIFIFV
Sbjct  91   NHHMLPCDYDSSSAAAG----GRRRILAAGGSSTDYCTKD-KVPLLSITALHELHIFIFV  145

Query  478  L  480
            L
Sbjct  146  L  146



>ref|XP_008812869.1| PREDICTED: MLO-like protein 1 isoform X2 [Phoenix dactylifera]
Length=420

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 85/130 (65%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LKKKNQKPL+EAL KIKEELMLLGFISLLLTVSQ  I KIC+P+  
Sbjct  33   SLVAERFLHYLGKALKKKNQKPLFEALLKIKEELMLLGFISLLLTVSQGAIQKICIPKGW  92

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------RRLLSG-GDSVGYCAKKHKVPLLSLEGL  450
              H+LPC    +        +S          RRLLSG G    +C +K KVPLLSLE  
Sbjct  93   TNHMLPCKEELEEAATTEHFSSAFFASVLSGGRRLLSGSGSGEEFCQRKGKVPLLSLEAT  152

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  153  HQLHIFIFVL  162



>ref|XP_008812868.1| PREDICTED: MLO-like protein 1 isoform X1 [Phoenix dactylifera]
Length=502

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 85/130 (65%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LKKKNQKPL+EAL KIKEELMLLGFISLLLTVSQ  I KIC+P+  
Sbjct  33   SLVAERFLHYLGKALKKKNQKPLFEALLKIKEELMLLGFISLLLTVSQGAIQKICIPKGW  92

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------RRLLSG-GDSVGYCAKKHKVPLLSLEGL  450
              H+LPC    +        +S          RRLLSG G    +C +K KVPLLSLE  
Sbjct  93   TNHMLPCKEELEEAATTEHFSSAFFASVLSGGRRLLSGSGSGEEFCQRKGKVPLLSLEAT  152

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  153  HQLHIFIFVL  162



>emb|CDX97279.1| BnaA02g20700D [Brassica napus]
Length=469

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 89/137 (65%), Gaps = 16/137 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPL+EALQK+KEELMLLGFISL LTV+Q  I+KICV E++
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLFEALQKVKEELMLLGFISLFLTVTQGLISKICVREEV  88

Query  298  MRHLLPCSLSD----KAVHAAPETNSHHRRLL------------SGGDSVGYCAKKHKVP  429
            + H+LPCS  +    K  +    T  H + L+                  GYC+ K K P
Sbjct  89   LMHMLPCSKQEAELSKHKNVTTTTTEHFQSLIPIVGTTRRLLAEHAAAEAGYCSLKDKTP  148

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSLE LHHLHIFIFVL
Sbjct  149  LLSLEALHHLHIFIFVL  165



>ref|XP_004959126.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=479

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LKK ++KPLY+AL KIKEELMLLGFISLLLTV Q    KICV E I
Sbjct  35   SLVFERLLHGLGKRLKKGSKKPLYDALLKIKEELMLLGFISLLLTVFQGTAQKICVRESI  94

Query  298  MRHLLPCSLSDK------AVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
            M H+LPC L         AV A     +  RRLL+GG +  YC +K KVP+LS+E +H L
Sbjct  95   MHHMLPCPLPSAGAKYGGAVFAGVLGGA--RRLLAGGAADDYCQRKGKVPILSIEAMHQL  152

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  153  HIFIFVL  159



>ref|XP_009144550.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=516

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 90/137 (66%), Gaps = 16/137 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPL+EALQK+KEELMLLGFISL LTV+Q  I+KICV E++
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLFEALQKVKEELMLLGFISLFLTVTQGLISKICVREEV  88

Query  298  MRHLLPCSLSD----KAVHAAPETNSHHRRLLSGGDSV------------GYCAKKHKVP  429
            + H+LPCS  +    K  +    T  H + L+    +             GYC+ K K P
Sbjct  89   LMHMLPCSKQEAELSKHKNVTTTTTEHFQSLIPIVGTTRRLLAEHAAAEAGYCSLKDKTP  148

Query  430  LLSLEGLHHLHIFIFVL  480
            LLSLE LHHLHIFIFVL
Sbjct  149  LLSLEALHHLHIFIFVL  165



>ref|XP_008378938.1| PREDICTED: MLO-like protein 13 [Malus domestica]
Length=495

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK + Q  L+EALQK+KEELMLLGFISLLLTVSQ  I +IC+P ++
Sbjct  29   SLCAERALHKLGKYLKHEKQDALFEALQKLKEELMLLGFISLLLTVSQRSIIRICIPSNL  88

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
              H+LPC       ++ A ++  ++ ++ RRLLS   +   C +K KVPLLSLE LHHLH
Sbjct  89   ANHMLPCKRETSEENNNAHYSLDQSINNRRRLLSTDTNSDXCLQKGKVPLLSLEALHHLH  148

Query  463  IFIFVL  480
            IFIFVL
Sbjct  149  IFIFVL  154



>emb|CDX91294.1| BnaC02g27050D [Brassica napus]
Length=506

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH  G  LKKK QKPL+EALQK+KEELMLLGFISL LTV+Q  I+KICV E++
Sbjct  29   SLAVERLLHHFGTVLKKKKQKPLFEALQKVKEELMLLGFISLFLTVTQGLISKICVREEV  88

Query  298  MRHLLPCS-----LSDKAVHAAPETNSHHR-RLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
            + H+LPCS     LS       P   +  R          GYC+ K K PLLSLE LHHL
Sbjct  89   LMHMLPCSKQEAELSKHKNSLIPIVGTTRRLLAEHAAAEAGYCSLKDKTPLLSLEALHHL  148

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  149  HIFIFVL  155



>ref|XP_009137855.1| PREDICTED: MLO-like protein 13 [Brassica rapa]
Length=495

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK+K Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVP  +
Sbjct  27   SLLAERGLHHLGKYLKRKKQDALFEALQKLKEELMLLGFISLMLTVSQTAIRHICVPPAL  86

Query  298  MRHLLPCSLSDKAVHAAPETN----SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
            + ++ PC    +  H APET+     + R LLS G S  +C  K KVPL+S+E LHHLHI
Sbjct  87   VSNMFPCKKPLEEEHHAPETSHSLVFNTRHLLSTGASPDHCTNKGKVPLISVEALHHLHI  146

Query  466  FIFVL  480
            FIFVL
Sbjct  147  FIFVL  151



>ref|XP_010065098.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=516

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 87/130 (67%), Gaps = 11/130 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LH+ GKYLKK+NQKPL++ALQKIKEELMLLGFISLLLTV Q RI KIC+ E++
Sbjct  29   SLAVERFLHYAGKYLKKRNQKPLFDALQKIKEELMLLGFISLLLTVFQERIGKICISEEL  88

Query  298  MRHLLPCSLSDKAVHAAPE----TN---SHHRRLLS--GGDSVGYCAKKHKVPLLSLEGL  450
                LPC       H+       TN      RRLL+     S  YC    KVPLLSL  L
Sbjct  89   ADKWLPCKKEAADKHSGATAHFLTNFFPPGGRRLLAEDSAASSDYCVG--KVPLLSLTAL  146

Query  451  HHLHIFIFVL  480
            HHLHIFIFVL
Sbjct  147  HHLHIFIFVL  156



>ref|XP_006441977.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
 gb|ESR55217.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
Length=508

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 88/132 (67%), Gaps = 13/132 (10%)
 Frame = +1

Query  121  LAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIM  300
            L VERLLH  GK LKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q  I+KIC+PE + 
Sbjct  28   LTVERLLHHLGKILKKKNQKPLFEALQKIKEELMLLGFISLLLTVCQGLISKICMPEHLS  87

Query  301  RHLLPCS--LSDKAVHAAP-------ETNSHH---RRLLSGGDSVGYCAKKHKVPLLSLE  444
            R  LPC     DK    A          ++HH   RRLL+   S G C K  KVPLLS  
Sbjct  88   RKWLPCDPEKDDKDTKTAAHFQAFFSAFSAHHGTGRRLLADAASEGNCPKG-KVPLLSTT  146

Query  445  GLHHLHIFIFVL  480
             LHHLHIFIFVL
Sbjct  147  ALHHLHIFIFVL  158



>ref|XP_008467033.1| PREDICTED: MLO-like protein 1 [Cucumis melo]
Length=185

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 97/140 (69%), Gaps = 22/140 (16%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIVAISLA+ERLLHF G+YLK KNQKPL EALQK+KEELMLLGFISLLLTV 
Sbjct  16   WVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFISLLLTVF  75

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAP--ETNSH----------------HRRL  378
            Q  I+K+CVPE +  HLLPC L D  KA H +P  ET S                  RRL
Sbjct  76   QGTISKLCVPESLTEHLLPCDLKDKPKAEHGSPSGETGSSTTKHFQTFFVSSISGTARRL  135

Query  379  LSGGDS--VGYCAKKHKVPL  432
            L+ G +   GYCAKK K+ L
Sbjct  136  LAEGSASQAGYCAKKVKINL  155



>ref|XP_010930335.1| PREDICTED: MLO-like protein 1 isoform X4 [Elaeis guineensis]
Length=342

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VA VC+VIV ISL  ER+LH+ GK LK+K QKPL+EALQK+KEELMLLGFISLLLTV 
Sbjct  19   WIVAVVCSVIVFISLFFERILHYLGKLLKRKKQKPLFEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAPETNS----HHRRLLSGG-DSVGYCAKK  417
            Q  I +IC+ E +  H+LPC   +  K  H A E  +      RRLL+GG +   +C K+
Sbjct  79   QGAIQRICIKESLTHHMLPCKRKEAAKTAHYAAEFFAGVLGSARRLLAGGAEESTHCQKE  138

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE +H LHIFIF L
Sbjct  139  GKVPLLSLEAIHQLHIFIFAL  159



>ref|XP_010930332.1| PREDICTED: MLO-like protein 1 isoform X2 [Elaeis guineensis]
Length=438

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LH+ GK LK+K QKPL+EALQK+KEELMLLGFISLLLTV Q  I +IC+ E +
Sbjct  32   SLFFERILHYLGKLLKRKKQKPLFEALQKVKEELMLLGFISLLLTVFQGAIQRICIKESL  91

Query  298  MRHLLPCSLSD--KAVHAAPETNS----HHRRLLSGG-DSVGYCAKKHKVPLLSLEGLHH  456
              H+LPC   +  K  H A E  +      RRLL+GG +   +C K+ KVPLLSLE +H 
Sbjct  92   THHMLPCKRKEAAKTAHYAAEFFAGVLGSARRLLAGGAEESTHCQKEGKVPLLSLEAIHQ  151

Query  457  LHIFIFVL  480
            LHIFIF L
Sbjct  152  LHIFIFAL  159



>ref|XP_010930336.1| PREDICTED: MLO-like protein 1 isoform X5 [Elaeis guineensis]
Length=341

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 7/141 (5%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VA VC+VIV ISL  ER+LH+ GK LK+K QKPL+EALQK+KEELMLLGFISLLLTV 
Sbjct  19   WIVAVVCSVIVFISLFFERILHYLGKLLKRKKQKPLFEALQKVKEELMLLGFISLLLTVF  78

Query  259  QSRITKICVPEDIMRHLLPCSLSD--KAVHAAPETNS----HHRRLLSGG-DSVGYCAKK  417
            Q  I +IC+ E +  H+LPC   +  K  H A E  +      RRLL+GG +   +C K+
Sbjct  79   QGAIQRICIKESLTHHMLPCKRKEAAKTAHYAAEFFAGVLGSARRLLAGGAEESTHCQKE  138

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE +H LHIFIF L
Sbjct  139  GKVPLLSLEAIHQLHIFIFAL  159



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+LK   Q  L+EALQK+KEELMLLGFISLLLTVSQ  ++++C+P+D+
Sbjct  619  SLIAERGLHRLGKFLKHNKQDALFEALQKLKEELMLLGFISLLLTVSQGLVSRMCIPDDL  678

Query  298  MRHLLPCSL-SDKAVHA--APETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++LPC   S+K  H   +P+  ++ RRL S   S G C+ + +VPLLSLE LH LHIF
Sbjct  679  VSNMLPCKRDSEKKGHEEYSPQLINNRRRLFSTESSSGQCSHEGQVPLLSLEALHQLHIF  738

Query  469  IFVL  480
            IFVL
Sbjct  739  IFVL  742



>gb|KEH18066.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 88/145 (61%), Gaps = 25/145 (17%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S A E  LH  G +LKKKNQKPLY+ALQKIKEELMLLGFISL LT++Q+ ITKICVP++ 
Sbjct  31   SFAAECSLHCLGNFLKKKNQKPLYQALQKIKEELMLLGFISLFLTITQNGITKICVPDEW  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSG------------------------GDSVGY  405
              H+LPCSL +       + NSH +   S                          + VGY
Sbjct  91   TYHMLPCSLEEIEEEEM-KKNSHFQTFFSSDLVSGTARRLLGGGGGGDDPFGFTDEKVGY  149

Query  406  CAKKHKVPLLSLEGLHHLHIFIFVL  480
            C  K KVPLLS+E LH LHIFIFVL
Sbjct  150  CTAKGKVPLLSVEALHKLHIFIFVL  174



>ref|XP_010907544.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 1 [Elaeis guineensis]
Length=497

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 86/130 (66%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LKKKNQKPL+EALQK+KEELMLLGFISLLLTV Q  I KIC+PE  
Sbjct  30   SLFVERFLHYLGKALKKKNQKPLFEALQKVKEELMLLGFISLLLTVFQGAIQKICIPEGW  89

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------RRLLS-GGDSVGYCAKKHKVPLLSLEGL  450
             + +LPC   +         +S          RRLLS  G    +C +K KVPLLSLE +
Sbjct  90   TKRMLPCKEEELEAATTEHVSSAFFAGVLSGGRRLLSESGFGEEHCKRKGKVPLLSLEAI  149

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  150  HQLHIFIFVL  159



>ref|XP_010930331.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=508

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LH+ GK LK+K QKPL+EALQK+KEELMLLGFISLLLTV Q  I +IC+ E +
Sbjct  32   SLFFERILHYLGKLLKRKKQKPLFEALQKVKEELMLLGFISLLLTVFQGAIQRICIKESL  91

Query  298  MRHLLPCSLSD--KAVHAAPETNS----HHRRLLSGG-DSVGYCAKKHKVPLLSLEGLHH  456
              H+LPC   +  K  H A E  +      RRLL+GG +   +C K+ KVPLLSLE +H 
Sbjct  92   THHMLPCKRKEAAKTAHYAAEFFAGVLGSARRLLAGGAEESTHCQKEGKVPLLSLEAIHQ  151

Query  457  LHIFIFVL  480
            LHIFIF L
Sbjct  152  LHIFIFAL  159



>emb|CDY34270.1| BnaA01g13730D [Brassica napus]
Length=493

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK+K Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVP  +
Sbjct  27   SLLAERGLHHLGKYLKRKKQDALFEALQKLKEELMLLGFISLMLTVSQTAIRHICVPPAL  86

Query  298  MRHLLPCSLSDKAVHAAPETN----SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
            + ++ PC    +  H APE++     + R LLS G S  +C  K KVPL+S+E LHHLHI
Sbjct  87   VSNMFPCKKPLEEEHHAPESSHSLIFNTRHLLSTGASPDHCTNKGKVPLISVEALHHLHI  146

Query  466  FIFVL  480
            FIFVL
Sbjct  147  FIFVL  151



>gb|EAY98072.1| hypothetical protein OsI_19990 [Oryza sativa Indica Group]
Length=488

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 84/127 (66%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LK+KNQKPLYEAL K+KEELMLLGFISLLLTV Q  I + C+P   
Sbjct  27   SLVAERCLHYLGKMLKRKNQKPLYEALLKVKEELMLLGFISLLLTVFQGLIQRTCIPPRW  86

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLHHL  459
              H+LPC       + + V AA       RRLLS GG     C KK KVPLLSLE +H L
Sbjct  87   TVHMLPCQREAVGPAKEHVAAAQIVGRIGRRLLSEGGAGAELCQKKGKVPLLSLEAIHQL  146

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  147  HIFIFVL  153



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK + Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ IC+P  +
Sbjct  634  SLCAERALHKLGKYLKHEKQDALFEALQKLKEELMLLGFISLLLTVFQGSISHICIPSYL  693

Query  298  MRHLLPC--SLSDKAVHAAPETN---SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
              H+LPC    S+   H     N   ++ R+LLS   +  +C KK KVPLLSLE LHHLH
Sbjct  694  ASHMLPCKRETSEGNNHEHYSLNPSLNNRRQLLSAETNSDHCLKKGKVPLLSLEALHHLH  753

Query  463  IFIFVL  480
            IFIFVL
Sbjct  754  IFIFVL  759



>ref|XP_007203635.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
 gb|EMJ04834.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
Length=535

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 88/142 (62%), Gaps = 23/142 (16%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ER+LH+TGKYLKK+NQKPL+EALQKIKEELMLLGFISLLLTV Q RI KIC+ E  
Sbjct  28   SLALERILHYTGKYLKKQNQKPLFEALQKIKEELMLLGFISLLLTVCQDRIAKICITEKQ  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------------------RRLLS-GGDSVGYCAK  414
                LPC    +       T +H                     RRLL+   DS G+   
Sbjct  88   ASQWLPCKKEKQ--DTTTSTTAHFQTLFTTSFLPWTTSTTTTTARRLLADDSDSAGHHCP  145

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            + KVPLLS   LHHLHIFIFVL
Sbjct  146  EGKVPLLSTTALHHLHIFIFVL  167



>gb|EEE63750.1| hypothetical protein OsJ_18569 [Oryza sativa Japonica Group]
Length=499

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 84/127 (66%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LK+KNQKPLYEAL K+KEELMLLGFISLLLTV Q  I + C+P   
Sbjct  27   SLVAERCLHYLGKMLKRKNQKPLYEALLKVKEELMLLGFISLLLTVFQGLIQRTCIPPRW  86

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLHHL  459
              H+LPC       + + V AA       RRLLS GG     C KK KVPLLSLE +H L
Sbjct  87   TVHMLPCQREAVGPAKEHVAAAQIVGRIGRRLLSEGGAGAELCQKKGKVPLLSLEAIHQL  146

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  147  HIFIFVL  153



>gb|KHG23854.1| MLO-like protein 1 [Gossypium arboreum]
Length=471

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 78/116 (67%), Gaps = 8/116 (7%)
 Frame = +1

Query  157  YLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSLSDKA  336
            YLKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q RI KIC+ ED+    LPC    +A
Sbjct  19   YLKKKNQKPLFEALQKIKEELMLLGFISLLLTVVQDRIAKICISEDLANQWLPCKEKKEA  78

Query  337  VHAAPET-------NSHHRRLLSG-GDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                 +T       N + RRLL+   D   YC  K KVPLLS   LHHLHIFIFVL
Sbjct  79   TTEHFQTLFSSFLPNGNGRRLLAEPADFTAYCTTKGKVPLLSTTALHHLHIFIFVL  134



>ref|XP_003564808.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=500

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 87/130 (67%), Gaps = 10/130 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK LKKK+QK L+EAL K+KEELMLLGFISLLLTVSQ  I + C+P   
Sbjct  38   SLAAERCLHYLGKTLKKKSQKALFEALLKVKEELMLLGFISLLLTVSQGVIQRTCIPPSW  97

Query  298  MRHLLPCSLSDKAVHAAP-ETNS--------HHRRLLSGGDSVGYCAKKHKVPLLSLEGL  450
              +LLPC  ++    A P E  S          RRLL+ G S G+C  K KVPLLSLE L
Sbjct  98   TNYLLPCKKTENLTRADPSEAQSVAAGVFSLGGRRLLNEGGS-GHCHSKGKVPLLSLEAL  156

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  157  HQLHIFIFVL  166



>ref|XP_010517996.1| PREDICTED: MLO-like protein 15 isoform X1 [Camelina sativa]
Length=503

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERLLH  GK  +KK+QK L+ ALQKIKEELMLLGFISLLL+VSQS+I KIC+ +D+
Sbjct  27   SFAVERLLHRAGKQFRKKDQKQLFGALQKIKEELMLLGFISLLLSVSQSKIAKICISKDL  86

Query  298  MRHLLPCS--LSDKAVHAAP--ETNSHHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHLH  462
                LPC     DK++  +   + +   R LL+G  + G YC++K KVPL+SL  LH LH
Sbjct  87   SEKFLPCEKPKDDKSLKDSSHFQFSFTGRHLLAGDSAAGDYCSQKGKVPLMSLSALHELH  146

Query  463  IFIFVL  480
            IFIFVL
Sbjct  147  IFIFVL  152



>ref|XP_010508339.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=503

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERLLH  GK  +KK+QK L+ ALQKIKEELMLLGFISLLL+VSQS+I KIC+ +D+
Sbjct  27   SFAVERLLHRAGKQFRKKDQKQLFGALQKIKEELMLLGFISLLLSVSQSKIAKICISKDL  86

Query  298  MRHLLPCS--LSDKAVHAAP--ETNSHHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHLH  462
                LPC     DK++  +   + +   R LL+G  + G YC++K KVPL+SL  LH LH
Sbjct  87   SEKFLPCEKPKDDKSLKDSSHFQFSFTGRHLLAGDSAAGDYCSQKGKVPLMSLSALHELH  146

Query  463  IFIFVL  480
            IFIFVL
Sbjct  147  IFIFVL  152



>ref|XP_010506316.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=499

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERLLH  GK  +KK+QK L+ ALQKIKEELMLLGFISLLL+VSQS+I KIC+ +D+
Sbjct  27   SFAVERLLHRAGKQFRKKDQKQLFGALQKIKEELMLLGFISLLLSVSQSKIAKICISKDL  86

Query  298  MRHLLPCS--LSDKAVHAAP--ETNSHHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHLH  462
                LPC     DK++  +   + +   R LL+G  + G YC++K KVPL+SL  LH LH
Sbjct  87   SEKFLPCEKPKDDKSLKDSSHFQFSFTGRHLLAGDSAAGDYCSQKGKVPLMSLSALHELH  146

Query  463  IFIFVL  480
            IFIFVL
Sbjct  147  IFIFVL  152



>emb|CAN68336.1| hypothetical protein VITISV_025977 [Vitis vinifera]
Length=253

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 8/141 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAAVC++IV +S A ER LH  GK L  K+Q  L+EALQK+KEELMLLGFISLLLTV+
Sbjct  15   WIVAAVCSIIVLVSFAAERGLHRLGKLLLHKSQDALFEALQKLKEELMLLGFISLLLTVT  74

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAA------PET-NSHHRRLLSGGDSVGYCAKK  417
            Q  ITKIC+P+D   H+LPC +    V  +      P+T NS  +RLL    +  +CA+ 
Sbjct  75   QGPITKICIPDDAASHMLPCKMPTSHVSESYHRRYPPQTVNSIGKRLLLESSTGQHCAQG  134

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE LHHLHIFIFVL
Sbjct  135  -KVPLLSLEALHHLHIFIFVL  154



>ref|XP_010439065.1| PREDICTED: MLO-like protein 13 [Camelina sativa]
Length=491

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVPE +
Sbjct  28   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAIRHICVPEAL  87

Query  298  MRHLLPCSLSDKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++ PC    K  HA   +++   + RRLLS G+S   CA K KVPL+S+E LH LHIF
Sbjct  88   VSNMFPCKKPLKEHHAPQSSHTVIINARRLLSTGESSNNCAAKGKVPLVSVEALHQLHIF  147

Query  469  IFVL  480
            IFVL
Sbjct  148  IFVL  151



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 81/141 (57%), Positives = 99/141 (70%), Gaps = 8/141 (6%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+VAAVC++IV +S A ER LH  GK L  K+Q  L+EALQK+KEELMLLGFISLLLTV+
Sbjct  635  WIVAAVCSIIVLVSFAAERGLHRLGKLLLHKSQDALFEALQKLKEELMLLGFISLLLTVT  694

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAA------PET-NSHHRRLLSGGDSVGYCAKK  417
            Q  ITKIC+P+D   H+LPC +    V  +      P+T N   +RLL    +  +CA+ 
Sbjct  695  QGPITKICIPDDAASHMLPCKMPTSHVSESYHRRYPPQTVNGIGKRLLLESSTGQHCAQG  754

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLSLE LHHLHIFIFVL
Sbjct  755  -KVPLLSLEALHHLHIFIFVL  774



>gb|AFW62649.1| hypothetical protein ZEAMMB73_842608 [Zea mays]
Length=294

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 84/126 (67%), Gaps = 11/126 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L K  +KPLYEAL K+KEELMLLGFISLLLTV Q    KICV E +
Sbjct  31   SLLFERLLHRLGKRLAKGRRKPLYEALLKVKEELMLLGFISLLLTVFQGATQKICVRESL  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHH---RRLLSGGDSVG--YCAKKHKVPLLSLEGLHHLH  462
            M HLLPC           +T++H    RRLL+GG  V   YC  K KVP+LS++ +H LH
Sbjct  91   MNHLLPCP------RTTAKTSAHFVGTRRLLAGGGGVSSDYCLSKGKVPILSVDAIHQLH  144

Query  463  IFIFVL  480
            IFIFVL
Sbjct  145  IFIFVL  150



>ref|XP_006645146.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=507

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 85/132 (64%), Gaps = 11/132 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK LK+KNQK L+EAL K+KEELMLLGFISLLLTV Q  + K CVP   
Sbjct  29   SLAAERCLHYLGKTLKRKNQKALFEALLKVKEELMLLGFISLLLTVFQGILQKTCVPPKW  88

Query  298  MRHLLPC-SLSDKAVHAAPET---------NSHHRRLLS-GGDSVGYCAKKHKVPLLSLE  444
              +LLPC  + DKA    P               RRLL+ GG   G+C  K +VPLLSLE
Sbjct  89   TSYLLPCRKMEDKAEQLGPSQAHFVAAGVLGRFGRRLLADGGAGAGHCQNKGEVPLLSLE  148

Query  445  GLHHLHIFIFVL  480
             LH LHIFIF+L
Sbjct  149  ALHQLHIFIFIL  160



>ref|NP_001045040.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAB92639.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAD82145.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAF06954.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAH00453.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71925.1| hypothetical protein OsI_04724 [Oryza sativa Indica Group]
 gb|EEE55778.1| hypothetical protein OsJ_04347 [Oryza sativa Japonica Group]
Length=502

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 88/133 (66%), Gaps = 13/133 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK LK+KNQK L+EAL K+KEELMLLGFISLLLTVSQ  + K CVP   
Sbjct  29   SLAAERCLHYLGKTLKRKNQKALFEALLKVKEELMLLGFISLLLTVSQGILQKTCVPPKW  88

Query  298  MRHLLPC-SLSDKAVHAAPETNSHH----------RRLLS-GGDSVGYCAKKHKVPLLSL  441
              +LLPC  + D++    P + +H           RRLL+ GG    +C  K KVPLLSL
Sbjct  89   TNYLLPCRKMEDQSKQRGP-SEAHFVAAGVLGHLGRRLLADGGTGADHCQNKGKVPLLSL  147

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  148  EALHQLHIFIFVL  160



>ref|XP_007026460.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY06962.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=491

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 86/134 (64%), Gaps = 17/134 (13%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER+LH+TGKYLKKK+QKPL+EAL+KIKEELMLLGFISLLLTV Q  I KIC+ E  
Sbjct  27   SLAAERILHYTGKYLKKKHQKPLFEALEKIKEELMLLGFISLLLTVFQDCIGKICIAEHS  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLL------------SGGDSVG-YCAKKHKVPLLS  438
                LPC   D       ++ SH + L             S  D  G YCA K KVPLLS
Sbjct  87   DSKWLPCKKYD----TESKSTSHFQALFLSTRHLLAEASDSDSDPSGAYCAAKGKVPLLS  142

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  143  TTPLHHLHIFIFVL  156



>dbj|BAJ24152.1| seven trans-membrane protein [Triticum aestivum]
Length=262

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L K  +KPLYEAL K+KEELMLLGFISLLLTV Q    KICV E +
Sbjct  34   SLFFERLLHRLGKRLTKGRRKPLYEALLKVKEELMLLGFISLLLTVFQGATQKICVRESL  93

Query  298  MRHLLPCSLSDKAV------HAAPET------NSHHRRLLSGGDSVGYCAKKHKVPLLSL  441
            M+HLLPC  +          +AA  T       S  R L  GG S  YC  K KVP+LS+
Sbjct  94   MQHLLPCPRNGAGAAKSVQHYAAGATVFTGVVGSTRRLLAGGGASSDYCLNKGKVPILSI  153

Query  442  EGLHHLHIFIFVL  480
            + +H LHIFIFVL
Sbjct  154  QAIHQLHIFIFVL  166



>gb|EMS45065.1| MLO-like protein 1 [Triticum urartu]
Length=470

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 86/134 (64%), Gaps = 14/134 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK  K+KNQKPLYEA+ K+KEELMLLGFISLLLTV Q +I  IC+    
Sbjct  31   SLLAERCLHYLGKTFKRKNQKPLYEAILKVKEELMLLGFISLLLTVCQGKIQNICIRPSW  90

Query  298  MRHLLPCSLSD--KAVHAAPETNSH----------HRRLLSGGDS-VGYCAKKHKVPLLS  438
              H+LPC   D  +A  AAP T  H           RRLLSGG + V  C  K K PL+S
Sbjct  91   TLHMLPCQGEDEVRAGEAAP-TKEHLVTSQIIGRIGRRLLSGGAAEVDVCRSKGKAPLMS  149

Query  439  LEGLHHLHIFIFVL  480
            LE +H LHIFIFVL
Sbjct  150  LEAIHQLHIFIFVL  163



>ref|XP_006441984.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
 gb|ESR55224.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
Length=421

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 86/136 (63%), Gaps = 19/136 (14%)
 Frame = +1

Query  121  LAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIM  300
            LAVER LH+ GK LKK NQ PL+EALQKIKEELMLLGFISLLLTV Q  I KIC+ E++ 
Sbjct  28   LAVERFLHYIGKVLKKNNQNPLFEALQKIKEELMLLGFISLLLTVFQGMIAKICISEELA  87

Query  301  RHLLPCSLSDKAVHAAPETNSHH---------------RRLLS-GGDSVGYCAKKHKVPL  432
               LPC   DK  H A   ++ H               RRLL+    S  YCA K KV L
Sbjct  88   SKWLPC---DKKEHKAATKSTAHFESFFSSFTSHHGAGRRLLAESSASNDYCAGKGKVSL  144

Query  433  LSLEGLHHLHIFIFVL  480
            LS+  LHHLHIFIFVL
Sbjct  145  LSITALHHLHIFIFVL  160



>gb|EMT10343.1| MLO-like protein 1 [Aegilops tauschii]
Length=526

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 86/134 (64%), Gaps = 14/134 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK  K+KNQKPLYEA+ K+KEELMLLGFISLLLTV Q +I  IC+    
Sbjct  31   SLLAERCLHYLGKTFKRKNQKPLYEAILKVKEELMLLGFISLLLTVCQGKIQNICIRPSW  90

Query  298  MRHLLPCSLSD--KAVHAAPETNSH----------HRRLLSGGDS-VGYCAKKHKVPLLS  438
              H+LPC   D  +A  AAP T  H           RRLLSGG + V  C  K K PL+S
Sbjct  91   TLHMLPCQGEDEVRAGEAAP-TKEHLVTAQIIGRIGRRLLSGGAAEVDVCRSKGKAPLMS  149

Query  439  LEGLHHLHIFIFVL  480
            LE +H LHIFIFVL
Sbjct  150  LEAIHQLHIFIFVL  163



>ref|XP_006655330.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=509

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LK+KNQ+PLYEAL K+KEELMLLGFISLLLTV Q  I K C+P   
Sbjct  33   SLVAERCLHYLGKKLKRKNQRPLYEALLKVKEELMLLGFISLLLTVFQGLIQKTCIPPRW  92

Query  298  MRHLLPC------SLSDKAVHAAPETNSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLHH  456
              H+LPC        + + V AA       RRLLS GG     C KK KVPLLS+E +H 
Sbjct  93   TIHMLPCHKAGEVGATKEHVAAAQIIGRIGRRLLSEGGAGAELCHKKGKVPLLSIEAIHQ  152

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  153  LHIFIFVL  160



>gb|KJB28898.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=462

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 79/117 (68%), Gaps = 8/117 (7%)
 Frame = +1

Query  154  KYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSLSDK  333
            +YLKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q RI KIC+ +D+    LPC    +
Sbjct  9    QYLKKKNQKPLFEALQKIKEELMLLGFISLLLTVFQDRIAKICISKDLAHQWLPCKEKKE  68

Query  334  AVHAAPET-------NSHHRRLLSG-GDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
                  +T       N + RRLL+   DS  YC  K KVPLLS   LHHLHIFIFVL
Sbjct  69   VTIEHFQTLFSSFLPNGNGRRLLAEPADSTAYCTTKGKVPLLSTTALHHLHIFIFVL  125



>emb|CDY03468.1| BnaC01g16140D [Brassica napus]
Length=477

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKE-ELMLLGFISLLLTVSQSRITKICVPED  294
            SL  ER LH  GKYLK++ Q  L+EALQK+KE ELMLLGFISLLLTVSQ+ I  ICVP  
Sbjct  27   SLLAERGLHHLGKYLKRRKQDALFEALQKLKEAELMLLGFISLLLTVSQTAIRHICVPPA  86

Query  295  IMRHLLPCSLSDKAVHAAPETN----SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
            ++ ++ PC    +  H APET+     + R LLS G S  +C  K KVPL+S+E LHHLH
Sbjct  87   LVSNMFPCKKPLEEEHHAPETSHSLVFNTRHLLSTGASPDHCTTKGKVPLISVEALHHLH  146

Query  463  IFIFVL  480
            IFIFVL
Sbjct  147  IFIFVL  152



>ref|XP_006478504.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=510

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 89/134 (66%), Gaps = 15/134 (11%)
 Frame = +1

Query  121  LAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIM  300
            L VERLLH  GK LKKKNQKPL+EALQKIKEELMLLGFISLLLTV Q  I+KIC+PE + 
Sbjct  28   LTVERLLHHLGKILKKKNQKPLFEALQKIKEELMLLGFISLLLTVCQGLISKICMPEHLS  87

Query  301  RHLLPCS--LSDKAVHAAP-------ETNSHH---RRLL--SGGDSVGYCAKKHKVPLLS  438
            R  LPC     DK    A          ++HH   RRLL  +  ++ G C K  KVPLLS
Sbjct  88   RKWLPCDPEKDDKDTKTAAHFQAFFSAFSAHHGTGRRLLADAASEAEGNCPKG-KVPLLS  146

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  147  TTALHHLHIFIFVL  160



>ref|XP_006358492.1| PREDICTED: MLO-like protein 13-like [Solanum tuberosum]
Length=474

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 10/125 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH  GK+  +KNQ  L++ALQK+KEELMLLGFISLLLTVSQ  I+KICVPE+I
Sbjct  27   SLAAERGLHRLGKFFLQKNQDALFKALQKLKEELMLLGFISLLLTVSQGAISKICVPENI  86

Query  298  MRHLLPCSLSDKAVHAAPETNSH---HRRLLSGGDSVGYCAK-KHKVPLLSLEGLHHLHI  465
             + +LPC L + A      T++H    R LL+G     +C + + KVPLLSLE LH LHI
Sbjct  87   SKVMLPCKLKESA------TSNHLITGRHLLAGSSGAEHCNRHEGKVPLLSLEALHQLHI  140

Query  466  FIFVL  480
            FIFVL
Sbjct  141  FIFVL  145



>ref|XP_004287195.1| PREDICTED: MLO-like protein 15 [Fragaria vesca subsp. vesca]
Length=536

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 92/147 (63%), Gaps = 27/147 (18%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+TGKYLK+KNQKPL+EALQKIKEELMLLGFISLLLTV Q  I KIC+ + +
Sbjct  26   SLAVERLLHYTGKYLKRKNQKPLFEALQKIKEELMLLGFISLLLTVFQGPIEKICISKKL  85

Query  298  MRHLLPCS---LSDKAVHAAPETNSHH-----------------RRLL------SGGDSV  399
              H LPC+       +  A  +T+S                   RRLL      S   S 
Sbjct  86   ASHWLPCNEEESESTSTTAHFQTSSFFTSNYYSRHLLLFPAGTARRLLADDSETSKSGST  145

Query  400  GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            G C++  KVPLLS   LHHLHIFIFVL
Sbjct  146  GTCSEG-KVPLLSTTALHHLHIFIFVL  171



>ref|NP_001105171.1| barley mlo defense gene homolog8 [Zea mays]
 gb|AAK38344.1| seven transmembrane protein Mlo8 [Zea mays]
 gb|ACF88127.1| unknown [Zea mays]
 gb|ACG43194.1| MLO-like protein 1 [Zea mays]
 gb|ACL54646.1| unknown [Zea mays]
 gb|AFW78033.1| MLO-like protein 1Seven transmembrane protein Mlo8 [Zea mays]
Length=492

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 86/131 (66%), Gaps = 12/131 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LK+KNQKPL+EAL K+KEELMLLGFISLLLTV Q  I + C+PE  
Sbjct  29   SLVAERCLHYLGKTLKRKNQKPLFEALLKVKEELMLLGFISLLLTVFQGMIRRTCIPERW  88

Query  298  MRHLLPCSLSD-KAVHAAPETNSHH--------RRLLSGGDS-VGYCAKKHKVPLLSLEG  447
              H+LPC   D KA  AA  T  H         RRLL  G +    C KK KVPLLSLE 
Sbjct  89   TFHMLPCEKPDEKAGEAA--TMEHFVGTLGRIGRRLLQEGTAGAEQCQKKGKVPLLSLEA  146

Query  448  LHHLHIFIFVL  480
            +H LHIFIFVL
Sbjct  147  IHQLHIFIFVL  157



>ref|XP_008243092.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=532

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 85/141 (60%), Gaps = 23/141 (16%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ER+LH+TGKYLKK+NQKPL+EALQKIKEELMLLGFISLLLTV Q RI KIC+ E  
Sbjct  28   SLALERILHYTGKYLKKQNQKPLFEALQKIKEELMLLGFISLLLTVCQDRIAKICITEKQ  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------------------RRLLSGGDSVGYCAKK  417
                LPC    +       T +H                     RRLL+       C + 
Sbjct  88   ASQWLPCKKEKQ--ETTNSTTAHFQTLFTTSFLPWTTSTATTTARRLLADDSDSAGCPEG  145

Query  418  HKVPLLSLEGLHHLHIFIFVL  480
             KVPLLS   LHHLHIFIFVL
Sbjct  146  -KVPLLSTTALHHLHIFIFVL  165



>ref|XP_008678707.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=479

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 84/126 (67%), Gaps = 11/126 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L K  +KPLYEAL K+KEELMLLGFISLLLTV Q    KICV E +
Sbjct  31   SLLFERLLHRLGKRLAKGRRKPLYEALLKVKEELMLLGFISLLLTVFQGATQKICVRESL  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHH---RRLLSGGDSVG--YCAKKHKVPLLSLEGLHHLH  462
            M HLLPC           +T++H    RRLL+GG  V   YC  K KVP+LS++ +H LH
Sbjct  91   MNHLLPCP------RTTAKTSAHFVGTRRLLAGGGGVSSDYCLSKGKVPILSVDAIHQLH  144

Query  463  IFIFVL  480
            IFIFVL
Sbjct  145  IFIFVL  150



>dbj|BAH00347.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 91/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+V+AVC VIV ISL  ERLLH  GK LKK  +KPLYE L K+KEELMLLGFISLLL V 
Sbjct  26   WIVSAVCFVIVIISLLFERLLHRLGKRLKKSRKKPLYEGLLKVKEELMLLGFISLLLNVF  85

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPET----NSHHRRLLSGGDS-VGYCAKKHK  423
            Q    KICV   +M HL PC L       A  T     +  RRLL+GG +   YC KK  
Sbjct  86   QGLTQKICVKASVMDHLQPCKLDFSGAKTAKTTAHLAAAGVRRLLAGGGAKSDYCEKKGL  145

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VP+LS+E +H LHIFIFVL
Sbjct  146  VPILSVEAIHQLHIFIFVL  164



>ref|XP_008383732.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=540

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL +ER LH+TGKYLKK NQKPL++ALQKIKEELMLLGFISLLLTV Q RI KIC+ E  
Sbjct  27   SLFLERTLHYTGKYLKKHNQKPLFQALQKIKEELMLLGFISLLLTVFQGRIAKICITEKQ  86

Query  298  MRHLLPC--SLSDKAVHAAPET-----NSHHRRLL---SGGDSVGYCAKKHKVPLLSLEG  447
                LPC    +  +  A  +T     +S  RRLL   S   + G C++  KVPLLS   
Sbjct  87   AGQWLPCKKETTSTSTSAHFQTVFFPWSSAARRLLAEDSASTTSGSCSEG-KVPLLSTTA  145

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  146  LHHLHIFIFVL  156



>gb|ABY77906.1| mildew resistance locus o 15 [Vitis vinifera]
 emb|CBI24772.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LH+ GKYLKKK+QKPLYEAL KIKEELMLLGFISLLLTV Q  I KIC+P+  
Sbjct  28   SLGAERILHYAGKYLKKKDQKPLYEALLKIKEELMLLGFISLLLTVFQDTIAKICIPKRY  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-----------RRLLSG-GDSVGYCAKKHKVPLLSL  441
                LPC    +   ++ E+ SH            RRLL+    S  YCAK+ K PLLS 
Sbjct  88   SDDWLPCKKKKEDSSSSEESTSHFQTFYHFTSGGARRLLAEHSASPSYCAKRGKDPLLST  147

Query  442  EGLHHLHIFIFVL  480
              LHHLHIFIFVL
Sbjct  148  TALHHLHIFIFVL  160



>gb|KJB44399.1| hypothetical protein B456_007G250700 [Gossypium raimondii]
Length=463

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 91/142 (64%), Gaps = 21/142 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ERLLH+ G  L+ K QKPLYEAL K+KEELMLLGFISLLLTV QS I+KIC+ + +
Sbjct  30   SLAIERLLHYLGHVLQHKQQKPLYEALLKVKEELMLLGFISLLLTVFQSAISKICMSKKL  89

Query  298  MRHLLPCSL-----SDKAVHAAPETNSHHRRL----LSGGDS------------VGYCAK  414
            ++ +LPC +      +     +  T SH +      +SGG              +GYC  
Sbjct  90   VKDMLPCKIEEEEEEEGDDDDSNATTSHFQTYFDSTMSGGTRHLLAKASSNSSVIGYCGA  149

Query  415  KHKVPLLSLEGLHHLHIFIFVL  480
            K KVPLLS+E LHH+HIFIFVL
Sbjct  150  KDKVPLLSVEALHHMHIFIFVL  171



>ref|XP_011004548.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004549.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004550.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 87/134 (65%), Gaps = 20/134 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LK+K+QKPL+EALQKIKEELMLLGFISLLLTV Q RI  IC+ +D+
Sbjct  27   SLIVERTLHYLGKLLKRKHQKPLFEALQKIKEELMLLGFISLLLTVFQGRINTICISKDL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSVGYCAKKHKVPLLS  438
             + +LPC    K      ET + H             RRLL+   S   C++  KVPLLS
Sbjct  87   SKKMLPCKDETK------ETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEG-KVPLLS  139

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  140  TTALHHLHIFIFVL  153



>ref|XP_010088714.1| MLO-like protein 13 [Morus notabilis]
 gb|EXB36895.1| MLO-like protein 13 [Morus notabilis]
Length=427

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 83/122 (68%), Gaps = 9/122 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+L  + Q  LYEAL+K+KEELMLLGFISLLLTV Q  I+KIC+P  I
Sbjct  29   SLCAERSLHKLGKFLHGRKQDALYEALEKLKEELMLLGFISLLLTVFQKLISKICIPSHI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-RRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
               +LPC  ++ A       N HH RRLLS G   G+C K  KVP LSLE LHHLHIFIF
Sbjct  89   SYDMLPCKKANSA-------NVHHGRRLLSAGAGAGHC-KPGKVPFLSLEALHHLHIFIF  140

Query  475  VL  480
            VL
Sbjct  141  VL  142



>ref|XP_009399143.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=516

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VERLLH  GK LK+KNQKPL+EALQK+KEELMLLGFISLLLTV Q  I +IC+P+  
Sbjct  38   SLVVERLLHRLGKVLKRKNQKPLFEALQKVKEELMLLGFISLLLTVFQGAIQRICIPKGW  97

Query  298  MRHLLPCSLSD-KAVHAAPETNSHH----------RRLLS-GGDSVGYCAKKHKVPLLSL  441
              H+LPC   +    H A                 RRLLS  G    +C  K KVPLLSL
Sbjct  98   TLHMLPCKKEEPDDAHGAAAEAHFQAAFSAGLFGGRRLLSESGSGAAHCLIKGKVPLLSL  157

Query  442  EGLHHLHIFIFVL  480
            E +H LHIFIFVL
Sbjct  158  EAIHQLHIFIFVL  170



>ref|XP_006857534.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
 gb|ERN19001.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
Length=528

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL +ER LH  GK LK+KNQ+ L+EALQK+KEELMLLGFISLLLTV Q  I+KIC+P  +
Sbjct  39   SLCMERFLHHLGKVLKRKNQEALFEALQKLKEELMLLGFISLLLTVFQGLISKICIPATL  98

Query  298  MRHLLPCS--LSDKAVHAAPETNSH-------HRRLLSGGDSVGYCAKKHKVPLLSLEGL  450
              H+LPC      + VH   + N+         R LLS   +   C K+ KV LLS+E L
Sbjct  99   FNHMLPCKRRTGQEGVHHYQQKNNSLSEGLMARRHLLSEAANSEQCTKQGKVVLLSIEAL  158

Query  451  HHLHIFIFVL  480
            HHLHIFIFVL
Sbjct  159  HHLHIFIFVL  168



>ref|XP_006648751.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=496

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LK   +KPLYE L K+KEELMLLGFISLLLTV Q    KICV E +
Sbjct  38   SLLFERLLHRLGKRLKNSRKKPLYEGLLKVKEELMLLGFISLLLTVFQGATQKICVKEGV  97

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------RRLLSGGDSVGYCAKKHKVPLLSLEGLH  453
            MRHL PC L       +P   + H        RRLL+G     YC KK  VP+LS++ +H
Sbjct  98   MRHLQPCKLD---FGTSPAKATAHFAGVLGGARRLLAGAAKSDYCEKKGLVPILSVQAIH  154

Query  454  HLHIFIFVL  480
             LHIFIFVL
Sbjct  155  QLHIFIFVL  163



>dbj|BAJ24148.1| seven trans-membrane protein [Triticum aestivum]
Length=499

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 14/134 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK  K+KNQKPLYEA+ K+KEELMLLGFISLLLTV Q +I  IC+    
Sbjct  31   SLLAERCLHYLGKTFKRKNQKPLYEAILKVKEELMLLGFISLLLTVCQGKIQNICIRPSW  90

Query  298  MRHLLPCSLSD--KAVHAAPETNSH----------HRRLLSGGDS-VGYCAKKHKVPLLS  438
              H+LPC   D  +A  A+P T  H           RRLLSGG +    C  K K PL+S
Sbjct  91   TLHMLPCQGGDEVRAGEASP-TKEHLVTAQIIGRIGRRLLSGGAAEADVCRSKGKAPLMS  149

Query  439  LEGLHHLHIFIFVL  480
            LE +H LHIFIFVL
Sbjct  150  LEAIHQLHIFIFVL  163



>ref|XP_009366270.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=546

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 87/131 (66%), Gaps = 11/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL +ER LH+TGKYLKK NQKPL++ALQKIKEELMLLGFISLLLTV Q RI KIC+ E  
Sbjct  27   SLFLERTLHYTGKYLKKHNQKPLFQALQKIKEELMLLGFISLLLTVFQGRIAKICITEKQ  86

Query  298  MRHLLPC--SLSDKAVHAAPET-----NSHHRRLL---SGGDSVGYCAKKHKVPLLSLEG  447
                LPC    +  +  A  +T     +S  RR L   S   + G C++  KVPLLS   
Sbjct  87   AGQWLPCKKETTSTSTSAHFQTVFFPWSSAARRFLAEDSASTTSGSCSEG-KVPLLSTTA  145

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  146  LHHLHIFIFVL  156



>ref|XP_006372312.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
 gb|ERP50109.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
Length=499

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 20/134 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LK+K+QKPL+EALQKIKEELMLLGFISLLLTV Q RI  IC+ +D+
Sbjct  27   SLIVERTLHYLGKLLKRKHQKPLFEALQKIKEELMLLGFISLLLTVFQGRINTICISKDL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSVGYCAKKHKVPLLS  438
             + +LPC    K      ET + H             RRLL+   S   C++  KVP+LS
Sbjct  87   SKKMLPCKDESK------ETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEG-KVPMLS  139

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  140  TTALHHLHIFIFVL  153



>ref|XP_006372313.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
 gb|ERP50110.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
Length=499

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 20/134 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LK+K+QKPL+EALQKIKEELMLLGFISLLLTV Q RI  IC+ +D+
Sbjct  27   SLIVERTLHYLGKLLKRKHQKPLFEALQKIKEELMLLGFISLLLTVFQGRINTICISKDL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSVGYCAKKHKVPLLS  438
             + +LPC    K      ET + H             RRLL+   S   C++  KVP+LS
Sbjct  87   SKKMLPCKDESK------ETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEG-KVPMLS  139

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  140  TTALHHLHIFIFVL  153



>ref|XP_010682204.1| PREDICTED: MLO-like protein 13 [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 87/129 (67%), Gaps = 15/129 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK LKK NQ+ LYEALQKIKEELMLLGFISLLLTV Q  I++ICVP  +
Sbjct  28   SLAAERGLHYLGKCLKK-NQESLYEALQKIKEELMLLGFISLLLTVFQGFISEICVPTHV  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH--------RRLLSGGDSVGYCAKKHKVPLLSLEGLH  453
               +LPC    K    APE N+H+        RRLL+ G     C +K K   LSLEGLH
Sbjct  87   TSFMLPC----KKETDAPEGNTHNKYAFQPSQRRLLAEG--AHRCVQKGKAQFLSLEGLH  140

Query  454  HLHIFIFVL  480
            HLHIFIFVL
Sbjct  141  HLHIFIFVL  149



>ref|XP_002309708.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
 gb|EEE90158.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
Length=481

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 82/127 (65%), Gaps = 7/127 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH  GK LK+K+QKPL+EALQKIKEELMLLGFISLLLTV Q RI  IC+ ED+
Sbjct  27   SLIVERFLHLLGKLLKRKHQKPLFEALQKIKEELMLLGFISLLLTVFQGRINTICISEDL  86

Query  298  MRHLLPCSLSDKAVHAAPET------NSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
             + +LPC    K   A  +           RRLL+       C +  KVP+LS   LHHL
Sbjct  87   SKKMLPCKKETKGTTAHFQAFFSFFPGGTSRRLLAEDSPANSCPEG-KVPMLSTTALHHL  145

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  146  HIFIFVL  152



>ref|NP_001267997.1| mildew resistance locus o 15 [Vitis vinifera]
 gb|ACF25912.1| MLO-like protein 7 [Vitis vinifera]
Length=506

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 87/133 (65%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER+LH+ GKYLKKK+QKPL+EAL KIKEELMLLGFISLLLTV Q  I KIC+P+  
Sbjct  28   SLGAERILHYAGKYLKKKDQKPLFEALLKIKEELMLLGFISLLLTVFQDTIAKICIPKRY  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-----------RRLLSG-GDSVGYCAKKHKVPLLSL  441
                LPC    +   ++ E+ SH            RRLL+    S  YCAK+ K PLLS 
Sbjct  88   SDDWLPCKKKKEDSSSSEESTSHFQTFYHFTSGGARRLLAEHSASPSYCAKRGKDPLLST  147

Query  442  EGLHHLHIFIFVL  480
              LHHLHIFIFVL
Sbjct  148  TALHHLHIFIFVL  160



>gb|AFW81913.1| hypothetical protein ZEAMMB73_691352 [Zea mays]
Length=439

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK  KKKNQKPL+EAL K+KEELMLLGFISLLLTV Q  I K C+PED 
Sbjct  29   SLLAERGLHYLGKTFKKKNQKPLFEALLKVKEELMLLGFISLLLTVFQGMIQKTCIPEDW  88

Query  298  MRHLLPCSLSDKAVHAAPET--------NSHHRRLLSGG-DSVGYCAKKHKVPLLSLEGL  450
               +LPC   D+A   A  +            RRLL+   D   +C  K KVPLLSLE  
Sbjct  89   TFDMLPCKKPDEAAAIAKASFVDVGTTLGRIGRRLLAEEVDGAEHCHSKGKVPLLSLEAT  148

Query  451  HHLHIFIFVL  480
            H LHIFIFV+
Sbjct  149  HQLHIFIFVM  158



>gb|KCW44764.1| hypothetical protein EUGRSUZ_L01672 [Eucalyptus grandis]
Length=315

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GKYLKK+NQKPL++ALQKIKEELMLLGFISLLL V Q  I KIC+ E++
Sbjct  20   SLAAERFLHYAGKYLKKRNQKPLFDALQKIKEELMLLGFISLLLAVFQDSIGKICISEEL  79

Query  298  MRHLLPCSLSDK-AVHAAPETNSHH---------RRLLSGGDSVGYCAKKHKVPLLSLEG  447
                LPC  + K A      T +H          RR L+   +        KVPLLS   
Sbjct  80   ADKWLPCEKNAKIATDKHSSTTAHFLTNFFPPGGRRHLTEDSAASSDYGSGKVPLLSQTA  139

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  140  LHHLHIFIFVL  150



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   129 bits (324),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +1

Query  154  KYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSL---  324
            KYLK + Q  L+EALQK+KEELMLLGFISLLLTVSQ  I +IC+P ++  H+LPC     
Sbjct  621  KYLKHEEQDALFEALQKLKEELMLLGFISLLLTVSQRSIIRICIPSNLANHMLPCKRETS  680

Query  325  --SDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
              ++ A ++  ++ ++ RRLLS   +  +C +K K PLLSLE LHHLHIFIFVL
Sbjct  681  EGNNNAHYSLDQSINNRRRLLSADTNSDHCLQKGKAPLLSLEALHHLHIFIFVL  734



>ref|XP_010913232.1| PREDICTED: MLO-like protein 13 isoform X5 [Elaeis guineensis]
 ref|XP_010913233.1| PREDICTED: MLO-like protein 13 isoform X5 [Elaeis guineensis]
Length=391

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ G +LK   Q  L+EALQK+KEELMLLGFISLLLTV Q+ I +IC+P  +
Sbjct  32   SLLAERFLHYLGNFLKHNQQDALFEALQKLKEELMLLGFISLLLTVLQNTIRQICIPTSV  91

Query  298  MRHLLPCSLSDKAVHAAPE------------TNSHHRRLLSGGDSVGYCAKKHKVPLLSL  441
              H+LPC    K    APE               H +RLLS      +C KK KVPLLSL
Sbjct  92   SMHMLPC----KKEGFAPEHELHRGKVLSHGLRKHSQRLLSESSDSEFCKKKGKVPLLSL  147

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  148  EALHQLHIFIFVL  160



>ref|XP_010433797.1| PREDICTED: MLO-like protein 13 [Camelina sativa]
Length=489

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVPE +
Sbjct  28   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAIRHICVPEAL  87

Query  298  MRHLLPCSLSDKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++ PC    K  HA   +++   + R LLS G+    CA K KVPL+S+E LH LHIF
Sbjct  88   VSNMFPCKKPLKEHHAPQSSHTAIINARHLLSTGEGSNQCAAKGKVPLVSVEALHQLHIF  147

Query  469  IFVL  480
            IFVL
Sbjct  148  IFVL  151



>ref|XP_006597646.1| PREDICTED: MLO-like protein 13-like [Glycine max]
Length=492

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 84/131 (64%), Gaps = 14/131 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH  GKYLK K Q  LYEAL K++EELMLLGFISLLLTV Q  I+ IC+  ++
Sbjct  28   SLCVERALHKLGKYLKSKGQTALYEALTKLEEELMLLGFISLLLTVFQGLISDICISPNL  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH----------RRLLSGGDSVGYCAKKHKVPLLSLEG  447
               +LPC    K  H +PE + H+          RRL S      +C +K KVPLLSLE 
Sbjct  88   ATQMLPC----KRPHRSPEGSEHYQIYYDAIINRRRLFSTDTGSDHCRQKGKVPLLSLES  143

Query  448  LHHLHIFIFVL  480
            +HHLHIFIFVL
Sbjct  144  VHHLHIFIFVL  154



>ref|XP_008656279.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=491

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK  KKKNQKPL+EAL K+KEELMLLGFISLLLTV Q  I K C+PED 
Sbjct  29   SLLAERGLHYLGKTFKKKNQKPLFEALLKVKEELMLLGFISLLLTVFQGMIQKTCIPEDW  88

Query  298  MRHLLPCSLSDKAVHAAPET--------NSHHRRLLSGG-DSVGYCAKKHKVPLLSLEGL  450
               +LPC   D+A   A  +            RRLL+   D   +C  K KVPLLSLE  
Sbjct  89   TFDMLPCKKPDEAAAIAKASFVDVGTTLGRIGRRLLAEEVDGAEHCHSKGKVPLLSLEAT  148

Query  451  HHLHIFIFVL  480
            H LHIFIFV+
Sbjct  149  HQLHIFIFVM  158



>ref|XP_010913231.1| PREDICTED: MLO-like protein 13 isoform X4 [Elaeis guineensis]
Length=431

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ G +LK   Q  L+EALQK+KEELMLLGFISLLLTV Q+ I +IC+P  +
Sbjct  32   SLLAERFLHYLGNFLKHNQQDALFEALQKLKEELMLLGFISLLLTVLQNTIRQICIPTSV  91

Query  298  MRHLLPCSLSDKAVHAAPE------------TNSHHRRLLSGGDSVGYCAKKHKVPLLSL  441
              H+LPC    K    APE               H +RLLS      +C KK KVPLLSL
Sbjct  92   SMHMLPC----KKEGFAPEHELHRGKVLSHGLRKHSQRLLSESSDSEFCKKKGKVPLLSL  147

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  148  EALHQLHIFIFVL  160



>ref|XP_008806171.1| PREDICTED: MLO-like protein 13 isoform X2 [Phoenix dactylifera]
Length=552

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 83/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK+LK   Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ IC+P  I
Sbjct  61   SLLAERFLHYLGKFLKHNQQDALFEALQKLKEELMLLGFISLLLTVFQHTISHICIPASI  120

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------RRLLSGGDSVGYCAKKHKVPLLSL  441
              ++LPC    K    APE   HH            RRLLS      +C ++ KVPLLSL
Sbjct  121  SMYMLPC----KKEGFAPEHELHHGKALSHGLRRHSRRLLSESSDSEFCKRQGKVPLLSL  176

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  177  EALHQLHIFIFVL  189



>ref|XP_010913228.1| PREDICTED: MLO-like protein 13 isoform X1 [Elaeis guineensis]
Length=526

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ G +LK   Q  L+EALQK+KEELMLLGFISLLLTV Q+ I +IC+P  +
Sbjct  32   SLLAERFLHYLGNFLKHNQQDALFEALQKLKEELMLLGFISLLLTVLQNTIRQICIPTSV  91

Query  298  MRHLLPCSLSDKAVHAAPE------------TNSHHRRLLSGGDSVGYCAKKHKVPLLSL  441
              H+LPC    K    APE               H +RLLS      +C KK KVPLLSL
Sbjct  92   SMHMLPC----KKEGFAPEHELHRGKVLSHGLRKHSQRLLSESSDSEFCKKKGKVPLLSL  147

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  148  EALHQLHIFIFVL  160



>ref|XP_009603524.1| PREDICTED: MLO-like protein 13 [Nicotiana tomentosiformis]
Length=480

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+ + K Q  L+EALQK+KEELMLLGFISLLLTV Q  ++++C+PE+I
Sbjct  28   SLIAERGLHRLGKFFRDKKQDALFEALQKLKEELMLLGFISLLLTVFQGLVSQLCIPENI  87

Query  298  MRHLLPCSLSDKAV--HAAPETNSHHRRLLSGGDSVGYCAK-KHKVPLLSLEGLHHLHIF  468
               +LPC+L +     H    T  H   LL+GG+ V +C++ K +VPLLSLE LH LHIF
Sbjct  88   SIIMLPCTLKESGTSNHLTATTGRH---LLAGGNGVDHCSRHKGQVPLLSLEALHQLHIF  144

Query  469  IFVL  480
            IFVL
Sbjct  145  IFVL  148



>emb|CBI29605.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 87/128 (68%), Gaps = 8/128 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S A ER LH  GK L  K+Q  L+EALQK+KEELMLLGFISLLLTV+Q  ITKIC+P+D 
Sbjct  28   SFAAERGLHRLGKLLLHKSQDALFEALQKLKEELMLLGFISLLLTVTQGPITKICIPDDA  87

Query  298  MRHLLPCSLSDKAVHAA------PET-NSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHH  456
              H+LPC +    V  +      P+T N   +RLL    +  +CA+  KVPLLSLE LHH
Sbjct  88   ASHMLPCKMPTSHVSESYHRRYPPQTVNGIGKRLLLESSTGQHCAQG-KVPLLSLEALHH  146

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  147  LHIFIFVL  154



>ref|XP_004294225.1| PREDICTED: MLO-like protein 15 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VE+LLH TGKYLK+K Q PL+EALQKIKEELMLLGFISLLLTV Q  I K C+ + +
Sbjct  27   SLVVEKLLHCTGKYLKRKKQIPLFEALQKIKEELMLLGFISLLLTVFQDSIEKFCISKKL  86

Query  298  MRHLLPC--------SLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLH  453
              H LPC        S +     ++  T++H+ R L    +   C+++ KVPLLS   LH
Sbjct  87   ASHWLPCKEEEPKSKSTTGHFQTSSFFTSNHYSRHLLAAKNPKSCSEQGKVPLLSTTALH  146

Query  454  HLHIFIFVL  480
            HLHIFIFVL
Sbjct  147  HLHIFIFVL  155



>ref|XP_003568437.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=493

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERL+H+ GK  KKKNQKPLYEA+ K+KEELMLLGFISLLLTV Q  I   C+    
Sbjct  30   SLVAERLIHYLGKTFKKKNQKPLYEAILKVKEELMLLGFISLLLTVFQGMIQDTCIRPSW  89

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------RRLLS-GGDSVGYCAKKHKVPLLSLEGLHH  456
              H+LPC   ++       + + H      RRLLS G     +C KK KVPL+SLE +H 
Sbjct  90   TVHMLPCQREEEVESTKEHSVTAHIIGRIGRRLLSDGAAGAEHCRKKGKVPLMSLEAIHQ  149

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  150  LHIFIFVL  157



>ref|XP_011014744.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 86/134 (64%), Gaps = 20/134 (15%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK LK+K+QKPL EALQKIKEELMLLGFISLLLTV Q RI  IC+ +D+
Sbjct  27   SLIVERTLHYLGKLLKRKHQKPLSEALQKIKEELMLLGFISLLLTVFQGRINTICISKDL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSVGYCAKKHKVPLLS  438
             + +LPC    K      ET + H             RRLL+   S   C++  KVPLLS
Sbjct  87   SKKMLPCKDETK------ETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEG-KVPLLS  139

Query  439  LEGLHHLHIFIFVL  480
               LHHLHIFIFVL
Sbjct  140  TTALHHLHIFIFVL  153



>ref|XP_010913229.1| PREDICTED: MLO-like protein 13 isoform X2 [Elaeis guineensis]
Length=501

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ G +LK   Q  L+EALQK+KEELMLLGFISLLLTV Q+ I +IC+P  +
Sbjct  32   SLLAERFLHYLGNFLKHNQQDALFEALQKLKEELMLLGFISLLLTVLQNTIRQICIPTSV  91

Query  298  MRHLLPCSLSDKAVHAAPE------------TNSHHRRLLSGGDSVGYCAKKHKVPLLSL  441
              H+LPC    K    APE               H +RLLS      +C KK KVPLLSL
Sbjct  92   SMHMLPC----KKEGFAPEHELHRGKVLSHGLRKHSQRLLSESSDSEFCKKKGKVPLLSL  147

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  148  EALHQLHIFIFVL  160



>gb|KDO53880.1| hypothetical protein CISIN_1g010805mg [Citrus sinensis]
Length=369

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHGLGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKAVHA-APETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>ref|XP_009391802.1| PREDICTED: MLO-like protein 13 [Musa acuminata subsp. malaccensis]
Length=505

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH+ GK+LK   Q  LY+ALQK+KEELMLLGFISLLLTV Q  I++ICV + +
Sbjct  29   SLLVERFLHYLGKFLKHNQQDALYKALQKLKEELMLLGFISLLLTVFQRTISRICVSKRL  88

Query  298  MRHLLPCSLS----DKAVHAAP----ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLH  453
              H+LPC  +    ++ VH A     +   ++R+LLS  +    C ++ KVPLLSLE LH
Sbjct  89   FHHMLPCKENSFPPNQEVHRAKGLKLQLTWNNRKLLSEDEGSDICMRQGKVPLLSLEALH  148

Query  454  HLHIFIFVL  480
             LHIFIFVL
Sbjct  149  QLHIFIFVL  157



>ref|XP_008806170.1| PREDICTED: MLO-like protein 13 isoform X1 [Phoenix dactylifera]
Length=565

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 83/133 (62%), Gaps = 16/133 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK+LK   Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ IC+P  I
Sbjct  74   SLLAERFLHYLGKFLKHNQQDALFEALQKLKEELMLLGFISLLLTVFQHTISHICIPASI  133

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------RRLLSGGDSVGYCAKKHKVPLLSL  441
              ++LPC    K    APE   HH            RRLLS      +C ++ KVPLLSL
Sbjct  134  SMYMLPC----KKEGFAPEHELHHGKALSHGLRRHSRRLLSESSDSEFCKRQGKVPLLSL  189

Query  442  EGLHHLHIFIFVL  480
            E LH LHIFIFVL
Sbjct  190  EALHQLHIFIFVL  202



>ref|XP_009410721.1| PREDICTED: MLO-like protein 1 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=504

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LK+KNQKPL++ALQK+KEELMLLGFISLLLTV Q  I  IC+PE  
Sbjct  35   SLVAERLLHRLGKVLKRKNQKPLFDALQKVKEELMLLGFISLLLTVFQGVIQGICIPEGW  94

Query  298  MRHLLPCSLSDKAVHAAPET--NSHH-----RRLL--SGGDSVGYCAKKHKVPLLSLEGL  450
              H+LPC   ++   A  +T  ++ H     RRLL   G  +  +C  K KVPLLSLE +
Sbjct  95   SLHMLPCKKEERITEAHFQTAFSAGHFGGVGRRLLAGGGSGAAAHCLSKGKVPLLSLEAI  154

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  155  HQLHIFIFVL  164



>ref|XP_006375949.1| hypothetical protein POPTR_0013s06670g, partial [Populus trichocarpa]
 gb|ERP53746.1| hypothetical protein POPTR_0013s06670g, partial [Populus trichocarpa]
Length=183

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 99/143 (69%), Gaps = 21/143 (15%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAA+CTVIVA+SLA ERLLH+ G +L++KNQKPLYEALQK+KEELMLLGFISLLLTVS
Sbjct  16   WVVAALCTVIVALSLAAERLLHYCGIFLRRKNQKPLYEALQKVKEELMLLGFISLLLTVS  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNS-----HH------------RRLLSG  387
            Q+ I K CVPE+++  LLPC LS+K       +NS     H+            RRLL+ 
Sbjct  76   QNSIAKTCVPENVVNDLLPCRLSEKQKEEGLGSNSTTTPKHYQSFFPGTISGTVRRLLAE  135

Query  388  GD--SVGYCAKKHKVPLLSLEGL  450
                ++GYCAK  K+P  S + L
Sbjct  136  ASEANLGYCAK--KIPKDSFDSL  156



>gb|KDP29534.1| hypothetical protein JCGZ_19247 [Jatropha curcas]
Length=497

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 87/132 (66%), Gaps = 16/132 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER+LH+ GK LK+K QKPL+EALQKIKEELMLLGFISLLLTV Q  I KIC+ E++
Sbjct  27   SLAVERILHYLGKLLKRKQQKPLFEALQKIKEELMLLGFISLLLTVFQGSINKICITEEL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHHR---RLLSGG--------DSVGYCAKKHKVPLLSLE  444
                LPC    K       T +H++     +SGG        +S   CA+  KVP+LS  
Sbjct  87   ANKWLPC----KEESDTTGTTAHYQTSFSFISGGSRRRLLAEESKSSCAEG-KVPILSTT  141

Query  445  GLHHLHIFIFVL  480
             LHHLHIFIFVL
Sbjct  142  ALHHLHIFIFVL  153



>ref|XP_009410722.1| PREDICTED: MLO-like protein 1 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=502

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LK+KNQKPL++ALQK+KEELMLLGFISLLLTV Q  I  IC+PE  
Sbjct  35   SLVAERLLHRLGKVLKRKNQKPLFDALQKVKEELMLLGFISLLLTVFQGVIQGICIPEGW  94

Query  298  MRHLLPCSLSDKAVHAAPET--NSHH-----RRLL--SGGDSVGYCAKKHKVPLLSLEGL  450
              H+LPC   ++   A  +T  ++ H     RRLL   G  +  +C  K KVPLLSLE +
Sbjct  95   SLHMLPCKKEERITEAHFQTAFSAGHFGGVGRRLLAGGGSGAAAHCLSKGKVPLLSLEAI  154

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  155  HQLHIFIFVL  164



>ref|XP_004242449.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=511

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 110/162 (68%), Gaps = 28/162 (17%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            WVVAAVCTVIV+ISL VERL+H+ GK LKKK QK LYEALQK+KEELMLLGFISLLLTV 
Sbjct  17   WVVAAVCTVIVSISLLVERLIHYAGKRLKKKKQKHLYEALQKVKEELMLLGFISLLLTVF  76

Query  259  QSRITKICVPEDIMRHLLPCSL----------------SDKAVHAAPETNS---------  363
            QSRI +ICVP  ++ HLLPC+L                +    H  P+ N+         
Sbjct  77   QSRIVEICVPPHVVTHLLPCALPLEHTSFSPPTPTPTLTPPPPHKEPQVNNQAVHYHAGP  136

Query  364  HHRRLLSGGDSV---GYCAKKHKVPLLSLEGLHHLHIFIFVL  480
            HH+R L   +++   GYC  K+KVPLLSLE LHHLH+FIFVL
Sbjct  137  HHQRHLLEEETMSAEGYCRHKNKVPLLSLEALHHLHVFIFVL  178



>gb|EAY86311.1| hypothetical protein OsI_07684 [Oryza sativa Indica Group]
Length=449

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 91/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W+V+AVC VIV ISL  ERLLH  GK LKK  +KPLYE L K+KEELMLLGFISLLL V 
Sbjct  26   WIVSAVCFVIVIISLLFERLLHRLGKRLKKSRKKPLYEGLLKVKEELMLLGFISLLLNVF  85

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPET----NSHHRRLLSGGDS-VGYCAKKHK  423
            Q    KICV   +M HL PC L       A  T     +  RRLL+GG +   YC KK  
Sbjct  86   QGLTQKICVKASVMDHLQPCKLDFSGAKTAKTTAHLAAAGVRRLLAGGGAKSDYCEKKGL  145

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VP+LS+E +H LHIFIFVL
Sbjct  146  VPILSVEAIHQLHIFIFVL  164



>ref|XP_009142246.1| PREDICTED: MLO-like protein 15 [Brassica rapa]
Length=502

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 87/130 (67%), Gaps = 13/130 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER LH  GK+  K NQK L  ALQK+KEELMLLGFISLLL+VSQSRI KIC+ +++
Sbjct  27   SFAVERGLHRAGKHFDKNNQKQLSGALQKVKEELMLLGFISLLLSVSQSRIAKICISKEL  86

Query  298  MRHLLPCS--LSDKAVHAAPETNSHH------RRLLSGGDSVG-YCAKKHKVPLLSLEGL  450
               LLPC     DK+++     NSH       R LL+G    G YC++K K PL+S+  L
Sbjct  87   SEKLLPCKKPKEDKSLN----DNSHFQLSFTGRHLLAGDSGAGDYCSQKGKAPLMSISAL  142

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  143  HELHIFIFVL  152



>ref|XP_006283629.1| hypothetical protein CARUB_v10004686mg [Capsella rubella]
 gb|EOA16527.1| hypothetical protein CARUB_v10004686mg [Capsella rubella]
Length=487

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ +  ICVP  +
Sbjct  30   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAVRNICVPPAL  89

Query  298  MRHLLPCSLSDKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++ PC    +  HA   ++S   + R LLS G+S  +C  K KVPL+S+E LH LHIF
Sbjct  90   VNNMFPCKKPLEEYHAPQSSHSVIINARHLLSTGESPNHCLAKGKVPLVSVEALHQLHIF  149

Query  469  IFVL  480
            IFVL
Sbjct  150  IFVL  153



>gb|KDO53879.1| hypothetical protein CISIN_1g010805mg [Citrus sinensis]
Length=492

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHGLGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKA-VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>gb|KDO53878.1| hypothetical protein CISIN_1g010805mg [Citrus sinensis]
Length=500

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHGLGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKA-VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>gb|ABR16800.1| unknown [Picea sitchensis]
Length=483

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 83/132 (63%), Gaps = 11/132 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL +ER +H  GK L+++NQ PLYEAL+K+KEELMLLGFISLLLT  Q  I ++C+PE  
Sbjct  28   SLCLERGIHRLGKTLRRRNQNPLYEALEKLKEELMLLGFISLLLTAFQGAINRLCLPESF  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-----------RRLLSGGDSVGYCAKKHKVPLLSLE  444
              H+LPC   + A   + E  +H            RRLLS G S G    + K P LSLE
Sbjct  88   TNHMLPCKRPESAEGPSSEAVNHSRELIAFVGSNTRRLLSSGGSEGSHCSEGKKPFLSLE  147

Query  445  GLHHLHIFIFVL  480
             +H LHIFIFVL
Sbjct  148  AVHQLHIFIFVL  159



>ref|XP_006470774.1| PREDICTED: MLO-like protein 13-like [Citrus sinensis]
Length=499

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHGLGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKA-VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>ref|XP_003594424.1| MLO-like protein [Medicago truncatula]
Length=513

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK+K QK LY AL K++EELMLLGFISLLLTV Q  I+ IC+  + 
Sbjct  29   SLCAERALHRLGKYLKRKKQKALYRALNKLQEELMLLGFISLLLTVFQGVISHICISPEH  88

Query  298  MRHLLPCSLSDKAVHAAP----ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
               +LPC  S ++V  +     +T  + RRLLS      +C  + KVPLLSLEGLHHLHI
Sbjct  89   ATQMLPCKRSHESVQGSEHDHYDTIINRRRLLSTDTGSQHCRLEGKVPLLSLEGLHHLHI  148

Query  466  FIFVL  480
            FIFVL
Sbjct  149  FIFVL  153



>gb|ABD32919.1| Mlo-related protein [Medicago truncatula]
Length=515

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK+K QK LY AL K++EELMLLGFISLLLTV Q  I+ IC+  + 
Sbjct  29   SLCAERALHRLGKYLKRKKQKALYRALNKLQEELMLLGFISLLLTVFQGVISHICISPEH  88

Query  298  MRHLLPCSLSDKAVHAAP----ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
               +LPC  S ++V  +     +T  + RRLLS      +C  + KVPLLSLEGLHHLHI
Sbjct  89   ATQMLPCKRSHESVQGSEHDHYDTIINRRRLLSTDTGSQHCRLEGKVPLLSLEGLHHLHI  148

Query  466  FIFVL  480
            FIFVL
Sbjct  149  FIFVL  153



>ref|XP_006431344.1| hypothetical protein CICLE_v10000909mg [Citrus clementina]
 gb|ESR44584.1| hypothetical protein CICLE_v10000909mg [Citrus clementina]
Length=511

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHELGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKA-VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>gb|AES64675.2| seven transmembrane MLO family protein [Medicago truncatula]
Length=479

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GKYLK+K QK LY AL K++EELMLLGFISLLLTV Q  I+ IC+  + 
Sbjct  29   SLCAERALHRLGKYLKRKKQKALYRALNKLQEELMLLGFISLLLTVFQGVISHICISPEH  88

Query  298  MRHLLPCSLSDKAVHAAP----ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
               +LPC  S ++V  +     +T  + RRLLS      +C  + KVPLLSLEGLHHLHI
Sbjct  89   ATQMLPCKRSHESVQGSEHDHYDTIINRRRLLSTDTGSQHCRLEGKVPLLSLEGLHHLHI  148

Query  466  FIFVL  480
            FIFVL
Sbjct  149  FIFVL  153



>ref|XP_006431345.1| hypothetical protein CICLE_v10000909mg [Citrus clementina]
 gb|ESR44585.1| hypothetical protein CICLE_v10000909mg [Citrus clementina]
Length=499

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S   ER LH  GK+LKK  Q  L+EALQK+KEELMLLGFISLLLTV Q  I+ +C+P  +
Sbjct  30   SFCAERGLHELGKFLKKNKQDALFEALQKLKEELMLLGFISLLLTVFQDVISHMCIPTYL  89

Query  298  MRHLLPCSLSDKA-VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              H+LPC ++  +    +  T ++ R+LLS   S  +CAKK K PLLSLE LH LHIFIF
Sbjct  90   ASHMLPCKMNSVSHEKFSLGTINNRRQLLSEDTSTEHCAKKGKTPLLSLEALHQLHIFIF  149

Query  475  VL  480
            VL
Sbjct  150  VL  151



>ref|XP_011005242.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=480

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH  GK LK+K+QKP +EALQKIKEELMLLGFISLLLTV Q RI  IC+ ED+
Sbjct  27   SLIVERFLHLLGKLLKRKHQKPPFEALQKIKEELMLLGFISLLLTVFQGRINTICISEDL  86

Query  298  MRHLLPCSLSDKAVHAAPET------NSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHL  459
             + +LPC    K   A  +           RRLL+       C +  KVP+LS   LHHL
Sbjct  87   SKKMLPCKKETKGTTAHFQAFFSFFPGGTSRRLLAEDSPANSCPEG-KVPMLSTTALHHL  145

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  146  HIFIFVL  152



>ref|XP_009779220.1| PREDICTED: MLO-like protein 13 [Nicotiana sylvestris]
Length=480

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+ + K Q  L+EALQK+KEELMLLGFISLLLTV Q  ++++C+P++I
Sbjct  28   SLLAERGLHRLGKFFRDKKQDALFEALQKLKEELMLLGFISLLLTVFQGPVSQLCIPKNI  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCAK-KHKVPLLSLEGLHHLHIFIF  474
               +LPC+L +    +   T +  R LL+GG+ V +C++ K +VPLLSLE LH LHIFIF
Sbjct  88   SIIMLPCTLKESGT-SNHLTTTTGRHLLAGGNGVDHCSRHKGQVPLLSLEALHQLHIFIF  146

Query  475  VL  480
            VL
Sbjct  147  VL  148



>gb|EEE57203.1| hypothetical protein OsJ_07160 [Oryza sativa Japonica Group]
Length=497

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 80/126 (63%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LKK  +KPLYE L K+KEELMLLGFISLLL V Q    KICV   +
Sbjct  39   SLLFERLLHRLGKRLKKSRKKPLYEGLLKVKEELMLLGFISLLLNVFQGLTQKICVKASV  98

Query  298  MRHLLPCSLSDKAVHAAPET----NSHHRRLLSGGDS-VGYCAKKHKVPLLSLEGLHHLH  462
            M HL PC L       A  T     +  RRLL+GG +   YC KK  VP+LS+E +H LH
Sbjct  99   MDHLQPCKLDFSGAKTAKTTAHLAAAGVRRLLAGGGAKSDYCEKKGLVPILSVEAIHQLH  158

Query  463  IFIFVL  480
            IFIFVL
Sbjct  159  IFIFVL  164



>ref|NP_567697.1| MLO-like protein 13 [Arabidopsis thaliana]
 sp|Q94KB2.1|MLO13_ARATH RecName: Full=MLO-like protein 13; Short=AtMlo13; Short=AtMlo20 
[Arabidopsis thaliana]
 gb|AAK53806.1|AF369574_1 membrane protein Mlo13 [Arabidopsis thaliana]
 dbj|BAD95219.1| membrane protein Mlo13 [Arabidopsis thaliana]
 gb|ABH04480.1| At4g24250 [Arabidopsis thaliana]
 gb|AEE84878.1| MLO-like protein 13 [Arabidopsis thaliana]
Length=478

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVP  +
Sbjct  28   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAIRHICVPPAL  87

Query  298  MRHLLPCSLSDKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++ PC    +  HA   ++S   + R LLS G+S  +CA K +VPL+S+E LH LHIF
Sbjct  88   VNNMFPCKKPLEEHHAPKSSHSIINNARHLLSTGESPDHCAAKGQVPLVSVEALHQLHIF  147

Query  469  IFVL  480
            IFVL
Sbjct  148  IFVL  151



>ref|XP_010040939.1| PREDICTED: MLO-like protein 1, partial [Eucalyptus grandis]
Length=388

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GKYLKK+NQKPL++ALQKIKEELMLLGFISLLL V Q  I KIC+ E++
Sbjct  29   SLAAERFLHYAGKYLKKRNQKPLFDALQKIKEELMLLGFISLLLAVFQDSIGKICISEEL  88

Query  298  MRHLLPCSLSDK-AVHAAPETNSHH---------RRLLS--GGDSVGYCAKKHKVPLLSL  441
                LPC  + K A      T +H          RR L+     S  Y + K KVPLLS 
Sbjct  89   ADKWLPCEKNAKIATDKHSSTTAHFLTNFFPPGGRRHLTEDSAASSDYGSGK-KVPLLSQ  147

Query  442  EGLHHLHIFIFVL  480
              LHHLHIFIFVL
Sbjct  148  TALHHLHIFIFVL  160



>ref|XP_004231310.1| PREDICTED: MLO-like protein 13 [Solanum lycopersicum]
Length=475

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 4/122 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH  GK+  +KNQ  L++ALQK+KEELMLLGFISLLLTVSQ  I++ICVPE+I
Sbjct  28   SLAAERGLHRLGKFFLQKNQDALFKALQKLKEELMLLGFISLLLTVSQGAISQICVPENI  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCA-KKHKVPLLSLEGLHHLHIFIF  474
             + +LPC L + +      T  H   LL+G     +C   + KVPLLSLE LH LHIFIF
Sbjct  88   SKVMLPCKLKEASTSKHLITGRH---LLAGSSGEQHCNHHEGKVPLLSLEALHQLHIFIF  144

Query  475  VL  480
            VL
Sbjct  145  VL  146



>ref|XP_010448588.1| PREDICTED: MLO-like protein 13 [Camelina sativa]
Length=491

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  IC PE +
Sbjct  28   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAIQHICAPEAL  87

Query  298  MRHLLPCSLSDKAVHAAPETNS---HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
            + ++ PC    +  HA   +++   + R LLS G+    CA K KVPL+S+E LH LHIF
Sbjct  88   VSNMFPCKKPLEKHHAPQSSHTAIINARHLLSTGEGSNQCAAKGKVPLVSVEALHQLHIF  147

Query  469  IFVL  480
            IFVL
Sbjct  148  IFVL  151



>ref|XP_004486414.1| PREDICTED: MLO-like protein 13-like [Cicer arietinum]
Length=465

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK+LKK++Q  LYEAL K++EELMLLGFISLLLTV Q  I+ IC+    
Sbjct  28   SLCAERALHYLGKFLKKRSQTALYEALTKLEEELMLLGFISLLLTVFQGLISDICITPKH  87

Query  298  MRHLLPCSLSDKAVHAA--PETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFI  471
               +LPC  SD+ +      +T  + RRL S      +C ++ KVPLLSLE LHHLHIFI
Sbjct  88   ATQMLPCKRSDEGLEHEIHYDTIINKRRLFSSDSGSQHCRQEGKVPLLSLEALHHLHIFI  147

Query  472  FVL  480
            FVL
Sbjct  148  FVL  150



>emb|CDY30455.1| BnaA04g25560D [Brassica napus]
Length=672

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 87/130 (67%), Gaps = 13/130 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER LH  GK+  K NQK L  ALQK+KEELMLLGFISLLL+VSQSRI KIC+ +++
Sbjct  27   SFAVERGLHRAGKHFDKNNQKQLSGALQKVKEELMLLGFISLLLSVSQSRIAKICISKEL  86

Query  298  MRHLLPCS--LSDKAVHAAPETNSHH------RRLLSGGDSVG-YCAKKHKVPLLSLEGL  450
               LLPC     DK+++     NSH       R LL+G    G YC++K K PL+S+  L
Sbjct  87   SEKLLPCKKPKEDKSLN----DNSHFQLSFTGRHLLAGDSGAGDYCSQKGKAPLMSISAL  142

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  143  HELHIFIFVL  152



>ref|XP_002533335.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis]
Length=507

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVERLLH+ GK LK+K QKPL+EALQKIKEELMLLGFISLLLTV Q RI  IC+PE++
Sbjct  31   SLAVERLLHYLGKLLKRKQQKPLFEALQKIKEELMLLGFISLLLTVFQGRINSICIPEEM  90

Query  298  MRHLLPCSLSD----------KAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEG  447
             +  LPC              +   +     +  R LL+          + KVP+LS   
Sbjct  91   SKKWLPCKEESETATTTTAHFQTFFSFISGGAPQRHLLAESSDSSSSCPEGKVPILSTTA  150

Query  448  LHHLHIFIFVL  480
            LHHLHIFIFVL
Sbjct  151  LHHLHIFIFVL  161



>ref|XP_002454019.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
 gb|EES06995.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
Length=533

 Score =   123 bits (309),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 70/113 (62%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = +1

Query  151  GKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSL--  324
            GK L K  +KPLYEAL K+KEELMLLGFISLLLTV Q    KICV E +MRHLLPCSL  
Sbjct  92   GKRLTKGRRKPLYEALLKVKEELMLLGFISLLLTVFQGTTQKICVQESVMRHLLPCSLPA  151

Query  325  SDKAVHAAPETNSHHRRLLSGGD-SVGYCAKKHKVPLLSLEGLHHLHIFIFVL  480
             DK            RRLL+GG  S  YC K  KVP+LS+E +H LHIFIFVL
Sbjct  152  DDKVTAHFMIAGGGTRRLLAGGGASSDYCLKG-KVPILSVEAIHQLHIFIFVL  203



>ref|XP_009799525.1| PREDICTED: MLO-like protein 13 [Nicotiana sylvestris]
Length=299

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 86/122 (70%), Gaps = 3/122 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+ + K Q  L+EALQK+KEELMLLGFISLLLTV Q RI+KIC+P +I
Sbjct  28   SLLAERGLHRLGKFFRDKKQDALFEALQKLKEELMLLGFISLLLTVFQERISKICIPANI  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCA-KKHKVPLLSLEGLHHLHIFIF  474
               +LPC+L + +V +   T +  R LL+GG  V +C   K +VP LSLE LH LHIF+F
Sbjct  88   SIIMLPCTLKE-SVTSNNLTATTGRHLLAGG-GVDHCTHHKGQVPFLSLEALHDLHIFVF  145

Query  475  VL  480
            VL
Sbjct  146  VL  147



>emb|CDY23418.1| BnaC04g49460D [Brassica napus]
Length=511

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 88/130 (68%), Gaps = 13/130 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER LH  GK+  K +QK L  ALQK+KEELMLLGFISLLL+VSQSRI KIC+ +++
Sbjct  27   SFAVERGLHRAGKHFDKNDQKQLSGALQKVKEELMLLGFISLLLSVSQSRIAKICISKEL  86

Query  298  MRHLLPCS--LSDKAVHAAPETNSHH------RRLLSGGDSVG-YCAKKHKVPLLSLEGL  450
               LLPC     DK+++     NSH       R LL+G  + G YC++K K PL+S+  L
Sbjct  87   SEKLLPCKKPKEDKSLN----DNSHFQLSFTGRHLLAGDSAAGDYCSQKGKAPLMSISAL  142

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  143  HELHIFIFVL  152



>ref|XP_006413455.1| hypothetical protein EUTSA_v10024937mg [Eutrema salsugineum]
 gb|ESQ54908.1| hypothetical protein EUTSA_v10024937mg [Eutrema salsugineum]
Length=517

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 88/128 (69%), Gaps = 9/128 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQS I  ICVP  +
Sbjct  26   SLLAERGLHRLGKCLKRRRQDALFEALQKLKEELMLLGFISLMLTVSQSAIRHICVPPGL  85

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------RRLLS-GGDSVGYCAKKHKVPLLSLEGLHH  456
            + ++ PC    +  H APE+ SHH      R LLS GG S   CA K +VPL+S+E LH 
Sbjct  86   VNNMFPCKKPLEN-HHAPES-SHHALVINARHLLSTGGASPDNCAAKGQVPLVSVEALHQ  143

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  144  LHIFIFVL  151



>ref|XP_002867673.1| hypothetical protein ARALYDRAFT_914165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43932.1| hypothetical protein ARALYDRAFT_914165 [Arabidopsis lyrata subsp. 
lyrata]
Length=482

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVP  +
Sbjct  28   SLLAERGLHHLGKCLKRRQQDALFEALQKLKEELMLLGFISLMLTVSQAAIRHICVPPAL  87

Query  298  MRHLLPCSLSDKAVHAAPETNS----HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
            + ++ PC    +  H AP+++     + R LLS G+S  +CA K +VPL+S+E LH LHI
Sbjct  88   VNNMFPCKKPLEK-HDAPKSSHSVIINARHLLSTGESPDHCAAKGQVPLVSVEALHQLHI  146

Query  466  FIFVL  480
            FIFVL
Sbjct  147  FIFVL  151



>ref|XP_011469571.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=463

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL +ER LH  G YLK+K Q PLYEAL K+KEELML+GFISLLLTV    ITKIC+ E  
Sbjct  29   SLMLERGLHSAGNYLKRKEQNPLYEALLKVKEELMLVGFISLLLTVFTKTITKICIKESK  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIFIFV  477
            M   LPC L ++        +     LL   D + YCA+K KVP+LS E +H LHIFIF 
Sbjct  89   MDKWLPCPLGEE---PQDMDDLDQDTLLKLDDELSYCARKGKVPVLSAEAVHQLHIFIFT  145

Query  478  L  480
            L
Sbjct  146  L  146



>ref|XP_007147546.1| hypothetical protein PHAVU_006G133800g [Phaseolus vulgaris]
 gb|ESW19540.1| hypothetical protein PHAVU_006G133800g [Phaseolus vulgaris]
Length=474

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 14/131 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VER LH  GKYL+ KNQ  LYE L K++EELMLLGFISLLLTV Q  I+ IC+  ++
Sbjct  28   SLCVERALHKLGKYLRSKNQNELYEVLTKLEEELMLLGFISLLLTVFQGLISDICISPNL  87

Query  298  MRHLLPCSLSDKAVHAAPETNSHH----------RRLLSGGDSVGYCAKKHKVPLLSLEG  447
               +LPC    K  H + + + H+          RRL S G    +C  K KVPLLSLE 
Sbjct  88   ATQMLPC----KRPHRSSQGSEHYQIYYDSIINRRRLFSTGSGSDHCTHKGKVPLLSLES  143

Query  448  LHHLHIFIFVL  480
            LH LHIFIFVL
Sbjct  144  LHQLHIFIFVL  154



>ref|XP_003636206.1| MLO-like protein [Medicago truncatula]
Length=501

 Score =   122 bits (305),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 70/129 (54%), Positives = 81/129 (63%), Gaps = 25/129 (19%)
 Frame = +1

Query  166  KKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSLSDKAVHA  345
            KKNQKPLY+ALQKIKEELMLLGFISL LT++Q+ ITKICVP++   H+LPCSL +     
Sbjct  28   KKNQKPLYQALQKIKEELMLLGFISLFLTITQNGITKICVPDEWTYHMLPCSLEEIEEEE  87

Query  346  APETNSHH-------------RRLLS-----------GGDSVGYCAKKHKVPLLSLEGLH  453
              + NSH              RRLL              + VGYC  K KVPLLS+E LH
Sbjct  88   M-KKNSHFQTFFSSDLVSGTARRLLGGGGGGDDPFGFTDEKVGYCTAKGKVPLLSVEALH  146

Query  454  HLHIFIFVL  480
             LHIFIFVL
Sbjct  147  KLHIFIFVL  155



>ref|XP_009137434.1| PREDICTED: MLO-like protein 13 [Brassica rapa]
Length=491

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 7/126 (6%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK++ Q  L+EALQK+KEELMLLGFISL+LTVSQ+ I  ICVP  +
Sbjct  26   SLLAERGLHHLGKCLKRRRQDALFEALQKLKEELMLLGFISLMLTVSQAAIRHICVPRAL  85

Query  298  MRHLLPCSLSDKAVHAAPETNSH-----HRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLH  462
            + ++ PC    +  H APE+ SH      R LLS G S  +CA K +VPL+S+E LH LH
Sbjct  86   VSNMFPCKKPLEK-HHAPES-SHTLSFSARHLLSTGASPDHCAAKGQVPLVSVEALHQLH  143

Query  463  IFIFVL  480
            IFIFVL
Sbjct  144  IFIFVL  149



>ref|XP_009376309.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=466

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 91/136 (67%), Gaps = 15/136 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ER LH  GKYLKKK QKPLYEAL K+KEELMLLGFISLLLTV Q RITKICV   I
Sbjct  29   SLAMERALHSGGKYLKKKKQKPLYEALLKVKEELMLLGFISLLLTVFQKRITKICVSPRI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSV--GYCAKKHKVPL  432
            M   LPC L+    H   E  +H+             RRLL+ G     GYC KK+KVPL
Sbjct  89   MVKWLPCKLNHYDDHLNGEKTAHYSANSVFGGILGPTRRLLAAGGEAQRGYCGKKNKVPL  148

Query  433  LSLEGLHHLHIFIFVL  480
            LS+E  HHLHIFIFVL
Sbjct  149  LSVEAFHHLHIFIFVL  164



>ref|XP_008344996.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
 ref|XP_008345003.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
Length=466

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 91/136 (67%), Gaps = 15/136 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ER LH  GKYLKKK QKPLYEAL K+KEELMLLGFISLLLTV Q RITKICV   I
Sbjct  29   SLAMERALHSGGKYLKKKKQKPLYEALLKVKEELMLLGFISLLLTVFQKRITKICVSPRI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSV--GYCAKKHKVPL  432
            M   LPC L+    H   E  +H+             RRLL+ G     GYC KK+KVPL
Sbjct  89   MVKWLPCKLNHYDDHLNGEKTAHYSANSVFGGILGPTRRLLAAGGEAQRGYCGKKNKVPL  148

Query  433  LSLEGLHHLHIFIFVL  480
            LS+E  HHLHIFIFVL
Sbjct  149  LSVEAFHHLHIFIFVL  164



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GK+L+   Q  L+EALQK+KEELMLLGFISLLLTV+Q+ I++IC+P  +
Sbjct  632  SIFAERGLHKLGKFLRNTKQDALFEALQKLKEELMLLGFISLLLTVTQNTISRICIPPHL  691

Query  298  MRHLLPCSLSDKAVHAAPETN---SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               +LPC    ++ +     N   ++ R LLS  +S   CA++ KVPL+S+E LH LHIF
Sbjct  692  AITMLPCKRETESSNHEKIYNQALNNRRHLLSATNSAERCAREGKVPLVSVEALHQLHIF  751

Query  469  IFVL  480
            IFVL
Sbjct  752  IFVL  755



>gb|KFK37229.1| hypothetical protein AALP_AA4G230500 [Arabis alpina]
Length=507

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERLLH  GK+ +K +QK L+ ALQKIKEELMLLGFISLLL+VSQS+I KIC+ + +
Sbjct  27   SFAVERLLHRAGKHFQKNDQKQLFGALQKIKEELMLLGFISLLLSVSQSKIAKICISKAL  86

Query  298  MRHLLPCS--LSDKAVHAAP--ETNSHHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHLH  462
                LPC     DK V  +   + +   R LL+G  + G YC+ K K PL+S+  LH LH
Sbjct  87   SEKFLPCKKPKDDKLVKDSSHFQFSFTGRHLLAGDSASGEYCSLKGKAPLMSVAALHELH  146

Query  463  IFIFVL  480
            IFIFVL
Sbjct  147  IFIFVL  152



>gb|KDP32468.1| hypothetical protein JCGZ_13393 [Jatropha curcas]
Length=459

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+LK K+ + L+EALQK+KEELMLLGFISLLLTV+Q  I++ICVP D+
Sbjct  27   SLFAERGLHKLGKWLKGKHHEALFEALQKLKEELMLLGFISLLLTVTQGSISRICVPPDL  86

Query  298  MRHLLPCSLSDKAVHAAP---ETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
              H+LPC     + H      +  +  RRLLS  ++  +C  K KV L  LE LH LHIF
Sbjct  87   ATHMLPCKRKTDSSHHEKYFHQVLNGQRRLLSASNA-AHCTNKGKVQLFPLEALHQLHIF  145

Query  469  IFVL  480
            IFVL
Sbjct  146  IFVL  149



>gb|KJB70716.1| hypothetical protein B456_011G089600 [Gossypium raimondii]
Length=478

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GKYLK K Q  L+EALQK+KEELMLLGFISLLLTV Q  + +IC+P   
Sbjct  29   SIIAERGLHRLGKYLKHKKQDALFEALQKLKEELMLLGFISLLLTVFQGLVCEICIPAYF  88

Query  298  MRHLLPCSL-SDKAVHA--APETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               LLPC   S++  H     +  ++ RRL S      +C+++ KVPLLS E LHHLHIF
Sbjct  89   ATSLLPCKRHSEEKTHEEYTSQAINNRRRLFSTDSGSDHCSREGKVPLLSREALHHLHIF  148

Query  469  IFVL  480
            IFVL
Sbjct  149  IFVL  152



>ref|XP_008674721.1| PREDICTED: MLO-like protein 1 [Zea mays]
 gb|ACF84059.1| unknown [Zea mays]
 tpg|DAA56450.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=514

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK  K KNQK L+EAL K+KEELMLLGFISLLLTV Q  + + C+P   
Sbjct  32   SLAAERCLHYLGKTFKGKNQKALFEALLKVKEELMLLGFISLLLTVFQGVMQRTCIPPGW  91

Query  298  MRHLLPCSLSDKAVHAAP-ETNSH--------HRRLLS-GGDSVGYCAKKHKVPLLSLEG  447
              ++LPC  + +    +P E + H         RRLL+ GG     C KK +VPLLS+E 
Sbjct  92   TIYMLPCRSAKEQAELSPTEAHGHAAGILGLTRRRLLAEGGPRTQRCQKKGEVPLLSVEA  151

Query  448  LHHLHIFIFVL  480
            LH LHIFIF+L
Sbjct  152  LHQLHIFIFIL  162



>ref|XP_009361360.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=489

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 90/135 (67%), Gaps = 14/135 (10%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LH  GKYLKKK QKPLYEAL K+KEELMLLGFISLLLTV Q+RITKICV   I
Sbjct  29   SLAVERALHSGGKYLKKKKQKPLYEALLKVKEELMLLGFISLLLTVFQNRITKICVSPKI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------RRLLSGGDSV--GYCAKKHKVPLL  435
            M   LPC L    +    ET  +             RRLL+ G     GYC KK+KVPLL
Sbjct  89   MDKWLPCKLHHDGLLDGEETAHYSATSVFGGIFGPTRRLLAAGAKAQEGYCGKKNKVPLL  148

Query  436  SLEGLHHLHIFIFVL  480
            S+E  HHLHIFIFVL
Sbjct  149  SVEAFHHLHIFIFVL  163



>gb|KJB70717.1| hypothetical protein B456_011G089600 [Gossypium raimondii]
Length=424

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GKYLK K Q  L+EALQK+KEELMLLGFISLLLTV Q  + +IC+P   
Sbjct  29   SIIAERGLHRLGKYLKHKKQDALFEALQKLKEELMLLGFISLLLTVFQGLVCEICIPAYF  88

Query  298  MRHLLPCSL-SDKAVHA--APETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               LLPC   S++  H     +  ++ RRL S      +C+++ KVPLLS E LHHLHIF
Sbjct  89   ATSLLPCKRHSEEKTHEEYTSQAINNRRRLFSTDSGSDHCSREGKVPLLSREALHHLHIF  148

Query  469  IFVL  480
            IFVL
Sbjct  149  IFVL  152



>ref|XP_009399302.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=495

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 84/139 (60%), Gaps = 25/139 (18%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH+ GK LK KNQKPLY ALQK+KEELMLLGFISLLLTV Q  I  IC+P+  
Sbjct  40   SLVAERYLHYLGKVLKSKNQKPLYNALQKVKEELMLLGFISLLLTVFQEGIQNICIPKRW  99

Query  298  MRHLLPCS------------------LSDKAVHAAPETNSHHRRLLSGGDSVGYCAKKHK  423
              ++LPC+                   SD+      E     RRLL+ G  V +C  K +
Sbjct  100  TLYMLPCNPEKAHHHHHHHHHHHHRVYSDEIPGGGGE-----RRLLAEG--VAHCMSKGE  152

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VPLLS+E +H LHIFIFVL
Sbjct  153  VPLLSVEAIHQLHIFIFVL  171



>ref|XP_008345009.1| PREDICTED: MLO-like protein 1 isoform X2 [Malus domestica]
Length=457

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 91/136 (67%), Gaps = 15/136 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA+ER LH  GKYLKKK QKPLYEAL K+KEELMLLGFISLLLTV Q RITKICV   I
Sbjct  29   SLAMERALHSGGKYLKKKKQKPLYEALLKVKEELMLLGFISLLLTVFQKRITKICVSPRI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSV--GYCAKKHKVPL  432
            M   LPC L+    H   E  +H+             RRLL+ G     GYC KK+KVPL
Sbjct  89   MVKWLPCKLNHYDDHLNGEKTAHYSANSVFGGILGPTRRLLAAGGEAQRGYCGKKNKVPL  148

Query  433  LSLEGLHHLHIFIFVL  480
            LS+E  HHLHIFIFVL
Sbjct  149  LSVEAFHHLHIFIFVL  164



>ref|XP_010253612.1| PREDICTED: MLO-like protein 6 isoform X2 [Nelumbo nucifera]
Length=328

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+ +E ++H  GK+L  K+++ LYEAL+KIK ELMLLGFISLLLTV Q  I++IC+PE +
Sbjct  29   SVIIEHIIHLIGKWLTAKHKRALYEALEKIKSELMLLGFISLLLTVGQGIISEICIPEKV  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGY------------CAKKHKVPLLSL  441
             R   PCS   +       +  H RRLL+  DSVG             CA+K KVP +S 
Sbjct  89   GRTWHPCSKKQEEAKEEESSEEHRRRLLAIPDSVGSVRRVLAGGGTDKCAEKGKVPFVSA  148

Query  442  EGLHHLHIFIFVL  480
            +G+H LHIFIFVL
Sbjct  149  DGIHQLHIFIFVL  161



>ref|NP_973686.1| MLO-like protein 15 [Arabidopsis thaliana]
 gb|AEC10377.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=497

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERL+H  GK+ K  +QK L+ ALQKIKEELML+GFISLLL+V QS+I KIC+ +++
Sbjct  27   SFAVERLIHRAGKHFKNNDQKQLFGALQKIKEELMLVGFISLLLSVGQSKIAKICISKEL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-----RRLLSGGDSVG-YCAKKHKVPLLSLEGLHHL  459
                LPC+    A  +  +++        R LL+G    G YC+ K KVP++SL  LH L
Sbjct  87   SEKFLPCTKPAGAEKSLKDSSHFQFSFTGRHLLAGDAPAGDYCSLKGKVPIMSLSALHEL  146

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  147  HIFIFVL  153



>ref|NP_181939.1| MLO-like protein 15 [Arabidopsis thaliana]
 sp|O80580.1|MLO15_ARATH RecName: Full=MLO-like protein 15; Short=AtMlo15 [Arabidopsis 
thaliana]
 gb|AAK53808.1|AF369576_1 membrane protein Mlo15 [Arabidopsis thaliana]
 gb|AAC23431.1| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC10376.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=496

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVERL+H  GK+ K  +QK L+ ALQKIKEELML+GFISLLL+V QS+I KIC+ +++
Sbjct  27   SFAVERLIHRAGKHFKNNDQKQLFGALQKIKEELMLVGFISLLLSVGQSKIAKICISKEL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-----RRLLSGGDSVG-YCAKKHKVPLLSLEGLHHL  459
                LPC+    A  +  +++        R LL+G    G YC+ K KVP++SL  LH L
Sbjct  87   SEKFLPCTKPAGAEKSLKDSSHFQFSFTGRHLLAGDAPAGDYCSLKGKVPIMSLSALHEL  146

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  147  HIFIFVL  153



>ref|XP_009411538.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009411539.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 87/139 (63%), Gaps = 18/139 (13%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+ +E ++   GK+LKK+++K LYE+L+KIK ELML+GFISLLLTV QS I+KICVP+ +
Sbjct  31   SIIIEHVIDLVGKWLKKRHRKALYESLEKIKSELMLMGFISLLLTVGQSLISKICVPKSV  90

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------------------RRLLSGGDSVGYCAKKHK  423
                 PC   D++   + + +S                    RR+L+GG     CA K K
Sbjct  91   GDSWHPCKPGDESAATSADGHSQDSSTTGRRLLQDSVSAGVFRRILAGGGGSDKCAAKGK  150

Query  424  VPLLSLEGLHHLHIFIFVL  480
            VPL+S +G+H LHIFIFVL
Sbjct  151  VPLISTDGIHQLHIFIFVL  169



>ref|XP_003636497.1| MLO-like protein [Medicago truncatula]
Length=729

 Score =   122 bits (306),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 70/129 (54%), Positives = 81/129 (63%), Gaps = 25/129 (19%)
 Frame = +1

Query  166  KKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDIMRHLLPCSLSDKAVHA  345
            KKNQKPLY+ALQKIKEELMLLGFISL LT++Q+ ITKICVP++   H+LPCSL +     
Sbjct  28   KKNQKPLYQALQKIKEELMLLGFISLFLTITQNGITKICVPDEWTYHMLPCSLEEIEEEE  87

Query  346  APETNSHH-------------RRLLS-----------GGDSVGYCAKKHKVPLLSLEGLH  453
              + NSH              RRLL              + VGYC  K KVPLLS+E LH
Sbjct  88   M-KKNSHFQTFFSSDLVSGTARRLLGGGGGGDDPFGFTDEKVGYCTAKGKVPLLSVEALH  146

Query  454  HLHIFIFVL  480
             LHIFIFVL
Sbjct  147  KLHIFIFVL  155



>gb|EMT15554.1| MLO-like protein 1 [Aegilops tauschii]
Length=444

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+A ER LH+  K LK+ NQKPLYEA+ K+KEELMLLGFISLLLTV Q  I +IC+P D 
Sbjct  30   SMAAERGLHYLAKKLKRNNQKPLYEAVLKVKEELMLLGFISLLLTVCQGMIQEICIPPDW  89

Query  298  MRHLLPCSLSDKA-----VHAAPETNSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLHHL  459
              H+LPC   + A     + A        RRLLS G      C +K K+ L+SLE +H L
Sbjct  90   RIHMLPCKRQEVAPAKEHLVATQIIGRIGRRLLSKGATGAETCRQKGKIQLMSLESVHQL  149

Query  460  HIFIFVL  480
            H+FIFVL
Sbjct  150  HVFIFVL  156



>ref|XP_003575162.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=495

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 83/133 (62%), Gaps = 14/133 (11%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK LK+  +KPL+EAL K+KEELMLLGFISLLL V Q  + K+CV   +
Sbjct  30   SLLFERLLHRLGKRLKQSRKKPLFEALLKVKEELMLLGFISLLLNVLQGPMGKVCVDRSV  89

Query  298  MRHLLPCS-----------LSDKAVHAAPETNSHHRRLLSGGD-SVGYCAKKHKVPLLSL  441
            MRHLLPC            L   AV  A    +  RRLL+G   S  YC KK KVP+LS 
Sbjct  90   MRHLLPCKPPPRQLNKTKHLGVDAVFTAVVGGA--RRLLAGASASDDYCLKKGKVPILSA  147

Query  442  EGLHHLHIFIFVL  480
            E +H LHIFIF L
Sbjct  148  EAVHQLHIFIFFL  160



>ref|XP_002299404.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
 gb|EEE84209.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
Length=488

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GK+L+   Q  L+EALQK+KEELMLLGFISLLLTV+Q+ I++IC+P  +
Sbjct  27   SIFAERGLHKLGKFLRNTEQDALFEALQKLKEELMLLGFISLLLTVTQNTISRICIPPQL  86

Query  298  MRHLLPCSLSDKAVHAAPETN---SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               +LPC    ++ +     N   ++ R LLS  +S   CA++ KVPL+S+E LH LHIF
Sbjct  87   AITMLPCKRETESSNHEKIYNQAINNRRHLLSATNSAERCAREGKVPLVSVEALHQLHIF  146

Query  469  IFVL  480
            IFVL
Sbjct  147  IFVL  150



>ref|XP_010521420.1| PREDICTED: MLO-like protein 13 isoform X1 [Tarenaya hassleriana]
Length=480

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 86/125 (69%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK + Q  L+EALQK+KEELMLLGFISLLLTVSQ+ I+ ICVP  +
Sbjct  26   SLLAERGLHRLGKCLKHRRQDALFEALQKLKEELMLLGFISLLLTVSQNAISHICVPPAV  85

Query  298  MRHLLPCSLSDKAVHAAPETNS----HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
            + ++ PC    +  H A  ++S    + RRLLS   S  +CA K KVPL+++E LH LHI
Sbjct  86   VDNMFPCKKPSENNHHAGSSHSVIFFNGRRLLSTA-SPDHCAPKGKVPLVTIEALHQLHI  144

Query  466  FIFVL  480
            FIFVL
Sbjct  145  FIFVL  149



>ref|XP_010521421.1| PREDICTED: MLO-like protein 13 isoform X2 [Tarenaya hassleriana]
Length=478

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 86/125 (69%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK LK + Q  L+EALQK+KEELMLLGFISLLLTVSQ+ I+ ICVP  +
Sbjct  26   SLLAERGLHRLGKCLKHRRQDALFEALQKLKEELMLLGFISLLLTVSQNAISHICVPPAV  85

Query  298  MRHLLPCSLSDKAVHAAPETNS----HHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
            + ++ PC    +  H A  ++S    + RRLLS   S  +CA K KVPL+++E LH LHI
Sbjct  86   VDNMFPCKKPSENNHHAGSSHSVIFFNGRRLLSTA-SPDHCAPKGKVPLVTIEALHQLHI  144

Query  466  FIFVL  480
            FIFVL
Sbjct  145  FIFVL  149



>ref|XP_010253610.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=581

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 72/146 (49%), Positives = 94/146 (64%), Gaps = 12/146 (8%)
 Frame = +1

Query  79   WvvaavctvivaiSLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVS  258
            W VA VC ++V IS+ +E ++H  GK+L  K+++ LYEAL+KIK ELMLLGFISLLLTV 
Sbjct  16   WAVAVVCFLLVLISVIIEHIIHLIGKWLTAKHKRALYEALEKIKSELMLLGFISLLLTVG  75

Query  259  QSRITKICVPEDIMRHLLPCSLSDKAVHAAPETNSHHRRLLSGGDSVGY-----------  405
            Q  I++IC+PE + R   PCS   +       +  H RRLL+  DSVG            
Sbjct  76   QGIISEICIPEKVGRTWHPCSKKQEEAKEEESSEEHRRRLLAIPDSVGSVRRVLAGGGTD  135

Query  406  -CAKKHKVPLLSLEGLHHLHIFIFVL  480
             CA+K KVP +S +G+H LHIFIFVL
Sbjct  136  KCAEKGKVPFVSADGIHQLHIFIFVL  161



>ref|XP_006397586.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
 gb|ESQ39039.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
Length=505

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 85/128 (66%), Gaps = 9/128 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER LH  GK+ +K +QK L+ ALQKIKEELMLLGFISLLL+VSQS+I KIC+ + +
Sbjct  27   SFAVERFLHRAGKHFQKNDQKQLFGALQKIKEELMLLGFISLLLSVSQSKIAKICISKGL  86

Query  298  MRHLLPCSLSDKAVHAAPETNSHH------RRLLSGGDSVG-YCAKKHKVPLLSLEGLHH  456
                LPC      V  + + +SH       R LL+   + G YC++K K PL+S+  LH 
Sbjct  87   SEKFLPC--KKPKVDKSLKDSSHFQFSFTARHLLAEDSTAGDYCSQKGKAPLMSVSALHE  144

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  145  LHIFIFVL  152



>ref|XP_004952743.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=497

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L K ++KP+Y+AL K+K+ELMLLGFISL+L V Q  + KICV   +
Sbjct  37   SLLFERLLHRLGKRLSKSHRKPMYDALLKVKDELMLLGFISLMLNVVQGTMQKICVRRSV  96

Query  298  MRHLLPCSLSDKAVHAAPE----------TNSHHRRLLSGGDSVGYCAKKHKVPLLSLEG  447
            M HLLPC L    +    E            S  R L  GG +  YC  K KVP+LS E 
Sbjct  97   MHHLLPCPLPPSKLAKTTEHYGATVFTGVLGSTRRLLAGGGKNSDYCLNKGKVPILSTEA  156

Query  448  LHHLHIFIFVL  480
            +H LHIFIFVL
Sbjct  157  IHQLHIFIFVL  167



>ref|XP_010247041.1| PREDICTED: MLO-like protein 13 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL+ ERLLH  GK+LK K Q  L+EAL+K+KEELMLLGFISLLLTV +  I+ IC+  D+
Sbjct  26   SLSAERLLHRLGKFLKHKGQHALFEALEKLKEELMLLGFISLLLTVFEGLISNICISTDL  85

Query  298  MRHLLPC-----SLSDKAVHAAPETN----SHHRRLLSGGDSVGYCAKKHKVPLLSLEGL  450
              H+ PC     S S++ +H     +       R+LL+   +  +CA+  KVP LSLEGL
Sbjct  86   ASHMNPCKREEVSSSEQEIHNYKAFSLGIARKGRQLLAEDTNSNHCARMGKVPFLSLEGL  145

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  146  HQLHIFIFVL  155



>ref|XP_010069192.1| PREDICTED: MLO-like protein 1 isoform X2 [Eucalyptus grandis]
Length=307

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 87/128 (68%), Gaps = 7/128 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL VERLLH+TGKYLKKK QKPL+EAL KIKEELMLLGFISLLLTV QSRI  IC+ +  
Sbjct  31   SLTVERLLHYTGKYLKKKKQKPLFEALLKIKEELMLLGFISLLLTVFQSRINTICISQHS  90

Query  298  MRHLLPCSLSDKA------VHAAPETNSHHRRLLS-GGDSVGYCAKKHKVPLLSLEGLHH  456
                LPC   D           +  T+ + RRLL+    +  +CA++ KVPLLS   LHH
Sbjct  91   SSKWLPCKKEDDTSTTHFQTSFSSFTSGNARRLLAEASAATDHCAQQGKVPLLSATALHH  150

Query  457  LHIFIFVL  480
            LHIFIFVL
Sbjct  151  LHIFIFVL  158



>ref|XP_002967927.1| hypothetical protein SELMODRAFT_88157 [Selaginella moellendorffii]
 gb|EFJ31274.1| hypothetical protein SELMODRAFT_88157 [Selaginella moellendorffii]
Length=456

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 88/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S  + R +H  G+YL+++ +K LY+AL KIKEELMLLGFISLLLTV Q  I  IC+P + 
Sbjct  32   SFGLVRAIHHLGRYLRRRQEKSLYQALDKIKEELMLLGFISLLLTVFQPVIASICMPHNF  91

Query  298  MRHLLPC-------SLSDKAVHAAP----ETNSHH--------RRLLSGGDS-----VGY  405
            + H+LPC       +L+ +A H AP    ET S H        RR+LS   S        
Sbjct  92   IEHMLPCKFDTKTLTLAGEAPHGAPNGTSETPSGHARRLLALNRRMLSSESSKEAAETSK  151

Query  406  CAKKHKVPLLSLEGLHHLHIFIFVL  480
            C  K+KVP +S EGLH LHIFIFVL
Sbjct  152  CFAKNKVPFVSREGLHKLHIFIFVL  176



>ref|XP_010247040.1| PREDICTED: MLO-like protein 13 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 9/130 (7%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL+ ERLLH  GK+LK K Q  L+EAL+K+KEELMLLGFISLLLTV +  I+ IC+  D+
Sbjct  26   SLSAERLLHRLGKFLKHKGQHALFEALEKLKEELMLLGFISLLLTVFEGLISNICISTDL  85

Query  298  MRHLLPC-----SLSDKAVHAAPETN----SHHRRLLSGGDSVGYCAKKHKVPLLSLEGL  450
              H+ PC     S S++ +H     +       R+LL+   +  +CA+  KVP LSLEGL
Sbjct  86   ASHMNPCKREEVSSSEQEIHNYKAFSLGIARKGRQLLAEDTNSNHCARMGKVPFLSLEGL  145

Query  451  HHLHIFIFVL  480
            H LHIFIFVL
Sbjct  146  HQLHIFIFVL  155



>gb|EMS49775.1| MLO-like protein 1 [Triticum urartu]
Length=477

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 81/127 (64%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L +  +KPLYEAL K+KEELMLLGFISLLLTV Q  + K+CV    
Sbjct  30   SLLFERLLHRLGKRLMRSRKKPLYEALLKVKEELMLLGFISLLLTVFQGPMGKLCVSPGT  89

Query  298  MRHLLPCSLSD-KAVHAAPETNS----HHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHL  459
            M HLLPC     K  H      +      RRLL+GG S   YC KK KVPLLS E +H L
Sbjct  90   MHHLLPCKPPPHKTDHLGGAVFTGVMGGARRLLAGGASSDEYCLKKGKVPLLSSEAIHQL  149

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  150  HIFIFVL  156



>ref|XP_011026716.1| PREDICTED: MLO-like protein 13 isoform X2 [Populus euphratica]
Length=488

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GK+L+   Q  L+EALQK+KEELMLLGFISLLLTV+Q+ I++IC+P  +
Sbjct  27   SIFAERGLHKLGKFLRNTKQDALFEALQKLKEELMLLGFISLLLTVTQNTISRICIPPHL  86

Query  298  MRHLLPCSLSDKAVHAAPETN---SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               +LPC    ++ +     N   ++ R LLS  +S   CA++ KVPL+S+E LH LHIF
Sbjct  87   AITMLPCKRETESSNHEKIYNQALNNRRHLLSATNSAERCAREGKVPLVSVEALHQLHIF  146

Query  469  IFVL  480
            IFVL
Sbjct  147  IFVL  150



>ref|XP_008375669.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=489

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 91/136 (67%), Gaps = 16/136 (12%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLAVER LH  GKYLKKK QKPLYEAL K+KEELMLLGFISLLLTV Q+RITKICV   I
Sbjct  29   SLAVERALHSGGKYLKKKKQKPLYEALLKVKEELMLLGFISLLLTVFQNRITKICVNPKI  88

Query  298  MRHLLPCSLSDKAVHAAPETNSHH-------------RRLLSGGDSV--GYCAKKHKVPL  432
            M   LPC L     H   +  +H+             RRLL+ G     GYC KK+KVPL
Sbjct  89   MDKWLPCKLHHDG-HLDGKETAHYSATSVFGGIFGPTRRLLAAGAKAQQGYCGKKNKVPL  147

Query  433  LSLEGLHHLHIFIFVL  480
            LS+E  HHLHIFIFVL
Sbjct  148  LSVEAFHHLHIFIFVL  163



>ref|XP_010559057.1| PREDICTED: MLO-like protein 15 isoform X2 [Tarenaya hassleriana]
Length=433

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 87/133 (65%), Gaps = 12/133 (9%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S AVER+LH  GK  ++KNQK L+ ALQKIKEELMLLGFISLLL+V Q +I KIC+ +++
Sbjct  53   SFAVERILHQAGKRFQRKNQKQLFGALQKIKEELMLLGFISLLLSVFQGKIEKICISKEL  112

Query  298  MRHLLPC-------SLSD----KAVHAAPETNSHHRRLLSGGD-SVGYCAKKHKVPLLSL  441
                LPC       SL D    + +  +  ++   R LL+G   + GYC+ K K PL++L
Sbjct  113  STKFLPCKKPKDDNSLKDASHFQTLFLSQASHLTGRHLLAGDSAAAGYCSAKGKAPLMTL  172

Query  442  EGLHHLHIFIFVL  480
              +H LHIFIFVL
Sbjct  173  SAVHELHIFIFVL  185



>ref|XP_011026715.1| PREDICTED: MLO-like protein 13 isoform X1 [Populus euphratica]
Length=510

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            S+  ER LH  GK+L+   Q  L+EALQK+KEELMLLGFISLLLTV+Q+ I++IC+P  +
Sbjct  49   SIFAERGLHKLGKFLRNTKQDALFEALQKLKEELMLLGFISLLLTVTQNTISRICIPPHL  108

Query  298  MRHLLPCSLSDKAVHAAPETN---SHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHIF  468
               +LPC    ++ +     N   ++ R LLS  +S   CA++ KVPL+S+E LH LHIF
Sbjct  109  AITMLPCKRETESSNHEKIYNQALNNRRHLLSATNSAERCAREGKVPLVSVEALHQLHIF  168

Query  469  IFVL  480
            IFVL
Sbjct  169  IFVL  172



>dbj|BAJ86219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 81/127 (64%), Gaps = 6/127 (5%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ERLLH  GK L +  +KPLYEAL K+KEELMLLGFISLLLTV Q  + K+CV    
Sbjct  30   SLLFERLLHRLGKRLMRSRKKPLYEALLKVKEELMLLGFISLLLTVFQGPMGKLCVSPSA  89

Query  298  MRHLLPCSLSD-KAVHAAPETNS----HHRRLLSGGDSVG-YCAKKHKVPLLSLEGLHHL  459
            M HLLPC     K  H      +      RRLL+GG S   YC KK KVPLLS E +H L
Sbjct  90   MLHLLPCKPPPHKTDHLGGAVFTGVMGGARRLLAGGASSDEYCLKKGKVPLLSSEAIHQL  149

Query  460  HIFIFVL  480
            HIFIFVL
Sbjct  150  HIFIFVL  156



>dbj|BAK08220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SLA ER LH+ GK LK+K QK L+EAL K+KEELMLLGFISLL+TVSQ  I + C+P   
Sbjct  32   SLAAERCLHYLGKTLKRKRQKALFEALLKVKEELMLLGFISLLMTVSQDVIQRTCIPPSW  91

Query  298  MRHLLPCSLSDKAVHAAPETNSHHRRLLSGG-DSVGYCAKKHKVPLLSLEGLHHLHIFIF  474
              +LLPC  ++   HAA       RRLL        +C  K KVPLLSLE LH LHIFIF
Sbjct  92   TNYLLPCKKTE-GHHAAALGG---RRLLPKSVPRSDHCRNKGKVPLLSLEALHQLHIFIF  147

Query  475  VL  480
            VL
Sbjct  148  VL  149



>ref|XP_002519395.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF43012.1| calmodulin binding protein, putative [Ricinus communis]
Length=471

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  SLAVERLLHFTGKYLKKKNQKPLYEALQKIKEELMLLGFISLLLTVSQSRITKICVPEDI  297
            SL  ER LH  GK+L KK Q+ L+EALQK+KEELMLLGFISLLLTV+Q+ I++IC+P   
Sbjct  27   SLFAERALHKLGKWLNKKKQEALFEALQKLKEELMLLGFISLLLTVTQNAISRICIPPQF  86

Query  298  MRHLLPCSLSDKA----VHAAPETNSHHRRLLSGGDSVGYCAKKHKVPLLSLEGLHHLHI  465
               +LPC    ++     H     NS  RRLLS   +  +C+ +  V L SLE LH LHI
Sbjct  87   ASVMLPCKRETESRNHGEHFHQALNS-RRRLLSASSNAAHCSHEGTVQLFSLEALHQLHI  145

Query  466  FIFVL  480
            FIFVL
Sbjct  146  FIFVL  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140