BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029F09

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      85.5    2e-16   Nicotiana tomentosiformis
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  85.1    3e-16   
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  84.7    4e-16   
gb|AGK82806.1|  alcohol oxidase                                       83.6    9e-16   Solanum lycopersicum
gb|AGK82832.1|  alcohol oxidase                                       83.6    9e-16   Solanum habrochaites
gb|AGK82825.1|  alcohol oxidase                                       83.2    1e-15   Solanum pennellii
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                   82.4    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  82.0    3e-15   Eucalyptus grandis [rose gum]
gb|KDP37816.1|  hypothetical protein JCGZ_06718                       82.0    4e-15   Jatropha curcas
gb|AGK82821.1|  alcohol oxidase                                       82.0    4e-15   Solanum pimpinellifolium [currant tomato]
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      81.6    5e-15   Nicotiana sylvestris
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg           80.5    1e-14   Citrus clementina [clementine]
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                   77.8    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      77.8    1e-13   Eucalyptus grandis [rose gum]
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  77.4    1e-13   Solanum lycopersicum
ref|XP_010644266.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  73.9    2e-13   Vitis vinifera
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  76.6    2e-13   Citrus sinensis [apfelsine]
emb|CDP07225.1|  unnamed protein product                              76.6    2e-13   Coffea canephora [robusta coffee]
gb|KGN53995.1|  hypothetical protein Csa_4G246410                     73.6    3e-13   Cucumis sativus [cucumbers]
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      75.9    4e-13   Prunus mume [ume]
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                 75.9    4e-13   
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  75.9    5e-13   Cucumis melo [Oriental melon]
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg           75.1    1e-12   
emb|CBI29206.3|  unnamed protein product                              73.6    2e-12   Vitis vinifera
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      73.6    3e-12   Vitis vinifera
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg              73.2    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                70.9    2e-11   Medicago truncatula
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  70.9    3e-11   Camelina sativa [gold-of-pleasure]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                      70.5    3e-11   Glycine soja [wild soybean]
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  70.5    4e-11   Glycine max [soybeans]
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                  70.1    4e-11   Arabis alpina [alpine rockcress]
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  70.1    5e-11   Glycine max [soybeans]
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g           69.7    6e-11   Phaseolus vulgaris [French bean]
gb|EPS61567.1|  hypothetical protein M569_13229                       69.3    8e-11   Genlisea aurea
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      67.8    2e-10   Populus euphratica
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                67.8    3e-10   
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein          67.8    3e-10   Medicago truncatula
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  66.6    7e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006385149.1|  alcohol oxidase-related family protein           66.2    7e-10   
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg           66.2    9e-10   Capsella rubella
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g           65.5    1e-09   Phaseolus vulgaris [French bean]
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      65.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  64.7    3e-09   Glycine max [soybeans]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  64.7    3e-09   Glycine max [soybeans]
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg           63.9    4e-09   
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  63.9    5e-09   Sesamum indicum [beniseed]
emb|CDX99381.1|  BnaC01g11710D                                        60.5    8e-09   
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  63.5    8e-09   Cicer arietinum [garbanzo]
emb|CDY66155.1|  BnaA01g34940D                                        60.5    8e-09   Brassica napus [oilseed rape]
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg              63.2    9e-09   Erythranthe guttata [common monkey flower]
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728           62.0    2e-08   
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                    62.0    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98615.1|  BnaA03g44000D                                        61.6    3e-08   
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      61.6    3e-08   Brassica rapa
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  61.6    3e-08   Phoenix dactylifera
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  61.2    4e-08   Phoenix dactylifera
emb|CDY01593.1|  BnaC07g35830D                                        61.2    5e-08   
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  60.8    5e-08   Sesamum indicum [beniseed]
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  60.8    5e-08   Brassica rapa
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  60.5    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...  60.5    9e-08   
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  59.7    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      59.7    1e-07   Elaeis guineensis
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  58.9    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  58.9    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  58.5    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1       57.8    6e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  56.2    2e-06   
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  56.2    2e-06   Cicer arietinum [garbanzo]
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531            55.1    5e-06   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621            55.1    5e-06   
gb|KDO72346.1|  hypothetical protein CISIN_1g0039901mg                49.7    1e-05   Citrus sinensis [apfelsine]
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370        53.1    2e-05   Amborella trichopoda
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  53.1    2e-05   
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  52.8    3e-05   
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  52.8    3e-05   Cucumis melo [Oriental melon]
gb|KHN11790.1|  hypothetical protein glysoja_006243                   47.8    1e-04   Glycine soja [wild soybean]
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg           50.4    1e-04   Citrus clementina [clementine]
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  49.7    2e-04   Citrus sinensis [apfelsine]
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  49.3    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      49.3    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17814.1|  unknown                                               49.3    3e-04   Picea sitchensis
ref|XP_003607655.1|  Annotation was added to scaffolds in Novembe...  47.0    5e-04   
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg           48.1    7e-04   Citrus clementina [clementine]
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  47.8    0.001   



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQ--HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  316
            LS   M ++T+I DT LP++D     H    DD    F QTSAS+ GTPQ +AWMIS RL
Sbjct  29   LSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHIAWMISNRL  88

Query  317  QHPKVIllrlalwllSTRIGTLMLCG  394
            QHPK+ L ++ALWLLSTRIGTL+LCG
Sbjct  89   QHPKLNLCKIALWLLSTRIGTLILCG  114



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  319
            LS + M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+Q
Sbjct  24   LSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQ  83

Query  320  HPKVIllrlalwllSTRIGTLMLCG  394
            HPK+ L +LALWLLSTRIGT +LCG
Sbjct  84   HPKLNLCKLALWLLSTRIGTFILCG  108



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  334
            M ++++I DTFLP++D    H    DDSV  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  335  llrlalwllSTRIGTLMLCG  394
            L +LALWLLSTRIGT +LCG
Sbjct  61   LCKLALWLLSTRIGTFILCG  80



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  334
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  335  llrlalwllSTRIGTLMLCG  394
            L +LALWLLSTRIGT +LCG
Sbjct  61   LCKLALWLLSTRIGTFILCG  80



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  334
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  335  llrlalwllSTRIGTLMLCG  394
            L +LALWLLSTRIGT +LCG
Sbjct  61   LCKLALWLLSTRIGTFILCG  80



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  334
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLN  60

Query  335  llrlalwllSTRIGTLMLCG  394
            L +LALWLLSTRIGT +LCG
Sbjct  61   LCKLALWLLSTRIGTFILCG  80



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQH----AAVDDDSVKLFFQTSASIAGTPQRVAWMISE  310
            LSP  M T+TS+ DTFLP++  P H        D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43   LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  311  RLQHPKVIllrlalwllSTRIGTLMLCG  394
            R++HPK+ LL L LWLLST IGT +LCG
Sbjct  103  RMKHPKLWLLPLTLWLLSTCIGTFILCG  130



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQH----AAVDDDSVKLFFQTSASIAGTPQRVAWMISE  310
            LSP  M T+TS+ DTFLP++  P H        D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43   LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  311  RLQHPKVIllrlalwllSTRIGTLMLCG  394
            R++HPK+ LL L LWLLST IGT +LCG
Sbjct  103  RMKHPKLWLLPLTLWLLSTCIGTFILCG  130



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M +++++ DTFLP+ DV   +A  DDS+  FF +SAS+AGTPQR+  +IS+RL+H
Sbjct  31   LSFPEMESLSALCDTFLPSNDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRLKH  90

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  L+R+ LW+LSTR+GT +LCG
Sbjct  91   PKKWLIRVVLWMLSTRVGTFILCG  114



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  334
            M ++T+I DTFLP++D    H    DDS+  F  TSAS+  TPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLN  60

Query  335  llrlalwllSTRIGTLMLCG  394
            L +LALWLLSTRIGT +LCG
Sbjct  61   LCKLALWLLSTRIGTFILCG  80



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  313
            LS   M ++T++ DT LP++D     Q+ A+DD     F QTSAS+ GTPQ +AWMIS R
Sbjct  29   LSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTN-FLQTSASMTGTPQHIAWMISNR  87

Query  314  LQHPKVIllrlalwllSTRIGTLMLCG  394
            L HPK+ L +LALWLLSTRIGTL+LCG
Sbjct  88   LHHPKLNLCKLALWLLSTRIGTLILCG  114



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M +++++ DTFLPAVDV Q AA+D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  27   LSSQEMESLSALCDTFLPAVDVKQAAAIDTD-IADFFRASASAAGTPERLGGLMSERLKH  85

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  L+RL LWLLST IG+L+LCG
Sbjct  86   PKKWLVRLCLWLLSTCIGSLILCG  109



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  298
            LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49   LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  299  MISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            +ISER++HPK+ LLRL LW LST IGT +LCG
Sbjct  109  LISERIKHPKLWLLRLTLWFLSTCIGTFILCG  140



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  298
            LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49   LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  299  MISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            +ISER++HPK+ LLRL LW LST IGT +LCG
Sbjct  109  LISERIKHPKLWLLRLTLWFLSTCIGTFILCG  140



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 7/91 (8%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVD-------VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWM  301
            LS   + ++T++ DTF+P++          Q    DDDS   F QTSAS+ GTPQ +AWM
Sbjct  26   LSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNIDDDDSYAKFLQTSASMNGTPQHIAWM  85

Query  302  ISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            I+ RLQHPK+ L RLALWLLSTRIGT +LCG
Sbjct  86   INNRLQHPKMNLCRLALWLLSTRIGTFILCG  116



>ref|XP_010644266.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]
 ref|XP_010644267.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]
Length=209

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 70/117 (60%), Gaps = 13/117 (11%)
 Frame = +2

Query  68   DDGDSLFSNGKAERGNDGVYSGG-----CPLSPAVMATVTSISDTFLPAVDVPQ---HAA  223
            +   +L   G  E   + +  GG       LS   M ++ +ISDTFLP+V+ P    HA 
Sbjct  5    EQEHTLIELGVVEARQELLNGGGRQLYLNKLSSREMESLVAISDTFLPSVEAPHNAAHAY  64

Query  224  VDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            VD      F++TSAS+AGTP  V  +ISERL+HPK+ ++R+ LWLLST  GT ++CG
Sbjct  65   VDK-----FYRTSASMAGTPHIVGGLISERLEHPKLWMIRVVLWLLSTWFGTFIICG  116



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M +++++ DTFLPAVDV   A++D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  34   LSSQEMESLSALCDTFLPAVDVKTAASIDKD-IADFFRASASAAGTPERLGGLMSERLKH  92

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  L+RL LWLLST IG+L+LCG
Sbjct  93   PKKWLVRLCLWLLSTCIGSLVLCG  116



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++ ++ DT+LP++D        D+S   F+QTSAS+AGTPQR+  +ISERLQH
Sbjct  47   LSSRQMESLKALCDTYLPSID--GFHTKHDESTARFYQTSASVAGTPQRLGGLISERLQH  104

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK+ + RLALW LST IGT  +CG
Sbjct  105  PKLFMARLALWFLSTSIGTFAMCG  128



>gb|KGN53995.1| hypothetical protein Csa_4G246410 [Cucumis sativus]
Length=224

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  68   DDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL  247
             DG S+  +  A   ND  YS    LS + M ++ ++ DTFLP+V  P  AA  D S   
Sbjct  51   HDGASVEISQHANSNND-YYSSAGHLSASEMESLAALCDTFLPSV-APSTAA--DRSTAF  106

Query  248  FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            FF+TSAS  GTP RV  MI ER++HPK  L+R+ LWLLST  GT +LCG
Sbjct  107  FFETSASAIGTPDRVGEMIKERVKHPKKWLVRVTLWLLSTWYGTYILCG  155



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++T++ DTFLP++DV    A  + S+  F++TSAS+AGTPQRV  +ISERL+HPK+ L
Sbjct  1    MESLTALCDTFLPSIDVSD--ATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWL  58

Query  338  lrlalwllSTRIGTLMLCG  394
            +RLALW LST IG+ +LCG
Sbjct  59   MRLALWFLSTWIGSFILCG  77



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +2

Query  65   SDDGDSLFSNGKAERGNDGVYS-GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSV  241
            S   D      K+   N+ V++     LS   M T+ ++SD FLP+VDV    A  D+S+
Sbjct  51   SSTADQAMKEEKSRNDNNNVFNIYESSLSRRQMDTLIAVSDAFLPSVDVSDLTA--DESL  108

Query  242  KLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
              F+ TSAS+A TPQR+  MISERL+HPK  LL++ALW LST  GT ++CG
Sbjct  109  LKFYATSASMAATPQRLGGMISERLKHPKKWLLKVALWALSTWFGTFVMCG  159



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +2

Query  71   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  250
            DG S+  +  A   ND  YS    LS A M ++ ++ DTFLP+V  P  AA  D S  +F
Sbjct  50   DGASVEISQHANSNND-YYSSAGHLSAAEMESLAALCDTFLPSV-APATAA--DRSTAVF  105

Query  251  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            F+TSAS  GTP+RV  MI ER++HPK  L+R++LW+LST  GT +LCG
Sbjct  106  FETSASAVGTPERVGEMIMERVRHPKKWLVRVSLWMLSTWYGTYILCG  153



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T++ DTFLP++DV       + S+  F++TSAS+AGTPQRV  +ISER++H
Sbjct  52   LSSREMESLTALCDTFLPSIDVSD--TTTNASLVAFYRTSASMAGTPQRVGGLISERMKH  109

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK+ L+RLALW LST IG+ +LCG
Sbjct  110  PKLWLMRLALWFLSTWIGSFILCG  133



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35   LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK+ L R+ LWLLST  GT ++CG
Sbjct  93   PKLWLSRVVLWLLSTWFGTFIICG  116



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35   LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK+ L R+ LWLLST  GT ++CG
Sbjct  93   PKLWLSRVVLWLLSTWFGTFIICG  116



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M  +T++ DTFLPA+DV  H      SV  F+QTSAS++ TP  VA  I+E+++HPK++L
Sbjct  18   MEALTALCDTFLPAIDVSDHDPHLPQSVANFYQTSASMSETPPLVAEFIAEKVKHPKILL  77

Query  338  lrlalwllSTRIGTLMLCG  394
             ++A+ +LST IGT +LCG
Sbjct  78   AKVAVKMLSTWIGTFILCG  96



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LSP  M ++ ++ DT LP++     AA  D+ +  F++TSAS+AGTP+ VA ++SE+L+H
Sbjct  60   LSPTQMKSLVALCDTMLPSIKDNNVAASSDEFLNNFYRTSASMAGTPELVANLVSEKLKH  119

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P   LL+L LWLLST  GTL+LCG
Sbjct  120  PSTWLLKLTLWLLSTWFGTLILCG  143



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  125  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  304
            +     L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++
Sbjct  36   FCANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLM  95

Query  305  SERLQHPKVIllrlalwllSTRIGTLMLCG  394
            SERL HPK  +LR+ALW LST IG+ +LCG
Sbjct  96   SERLDHPKKWILRVALWFLSTWIGSFILCG  125



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  125  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  304
            +     L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++
Sbjct  36   FCANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLM  95

Query  305  SERLQHPKVIllrlalwllSTRIGTLMLCG  394
            SERL HPK  +LR+ALW LST IG+ +LCG
Sbjct  96   SERLDHPKKWILRVALWFLSTWIGSFILCG  125



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +2

Query  83   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  262
            L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44   LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  263  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG
Sbjct  99   ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCG  142



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +2

Query  83   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  262
            L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44   LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  263  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG
Sbjct  99   ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCG  142



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P++D  +   V+DD V  ++  SAS  GTP RVA ++SERL H
Sbjct  20   LTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSERLDH  79

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  +LR+ LW LST IG+L+LCG
Sbjct  80   PKKWILRVGLWFLSTWIGSLILCG  103



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +2

Query  83   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  262
            L SNG+ E+    + +    LSP  M ++T++ DT LP+V         D+SV  F+Q S
Sbjct  38   LLSNGEREKKLQPLTNS---LSPRQMKSLTALCDTILPSV-ADHFVDSSDESVTKFYQIS  93

Query  263  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            AS+ GTP+R   MISERL+HP   LL+  LWLLST  GTL+ CG
Sbjct  94   ASMTGTPERFGGMISERLKHPLTGLLKFVLWLLSTWYGTLIFCG  137



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LSP  M ++ ++ DT +P++D     + DD+SV  F++TSAS+AGTPQ +  +ISE+++H
Sbjct  63   LSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANFYKTSASMAGTPQHLGKLISEKVKH  122

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P   LL L LWLLST  GTL+LCG
Sbjct  123  PSTWLLLLTLWLLSTWFGTLILCG  146



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = +2

Query  119  GVYSGG-CPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  295
            G  SGG CP S   M ++ ++ DTFLP ++ P   A DD  +  FF+TSAS A TP +VA
Sbjct  4    GAESGGKCPYSRRQMESLAALCDTFLPEMEPPS-GADDDKDISRFFRTSASTANTPHQVA  62

Query  296  WMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             ++  +++H ++ L  LALW+LST IGT +LCG
Sbjct  63   ILMGHKIRHRRLFLAPLALWVLSTAIGTWVLCG  95



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMIS  307
            LS   M ++T++ DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  
Sbjct  41   LSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSSASMAGTPQRVGELFC  100

Query  308  ERLQHPKVIllrlalwllSTRIGTLMLCG  394
            ER+QHPK  L+RL L+LLST IGT +LCG
Sbjct  101  ERVQHPKKWLIRLTLYLLSTWIGTFILCG  129



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75   LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P  ++L+L LW LST +GT++LCG
Sbjct  135  PMTMVLKLVLWFLSTWLGTIILCG  158



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75   LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P  ++L+L LW LST +GT++LCG
Sbjct  135  PMTMVLKLVLWFLSTWLGTIILCG  158



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T++ DT LPAVD P++ A  D+S+  F++TSAS+AGTP+ +  MIS RL+H
Sbjct  50   LSAREMDSLTALCDTILPAVDPPENTA--DESLVRFYKTSASMAGTPEHLGRMISHRLRH  107

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
              V L+R  L++LSTR+GT +  G
Sbjct  108  -HVFLIRFLLFMLSTRLGTFVFGG  130



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +2

Query  158  MATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMISERLQH  322
            M ++T+I DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  +R+QH
Sbjct  1    MESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQH  60

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  L+RL L+LLST IGT +LCG
Sbjct  61   PKKWLIRLTLYLLSTWIGTFILCG  84



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M T+ +  DT +P++D        DDSV  +F  SAS  GTP RVA ++SERL H
Sbjct  28   LTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGTPDRVARLMSERLDH  87

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  +LR+ALWLLST IG+L+LCG
Sbjct  88   PKKWILRVALWLLSTWIGSLVLCG  111



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M +++++ DT LP++D   H++  D+SV  F++ SAS+AGTPQ    MI E+L+H
Sbjct  60   LSSRQMKSLSALCDTILPSLDHFPHSS--DESVNRFYRISASMAGTPQLFGGMICEKLKH  117

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P   LL+L LW LST  GTL+LCG
Sbjct  118  PMTGLLKLVLWALSTWFGTLILCG  141



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P++D      VDD SV  +F  SAS  GTP RVA +ISERL H
Sbjct  40   LTQREMESLVAICDTLIPSIDGSGVGHVDD-SVAEYFSASASQTGTPDRVAKLISERLDH  98

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  +LR+ALW LST IG+ +LCG
Sbjct  99   PKKWILRVALWFLSTWIGSFILCG  122



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQH---AAVDDDSVKLFFQTSASIAGTPQRVAWMISER  313
            LSP  M ++ ++ DT LP+++   +    + DD+SV  F++TSAS+AGTP+ +  +ISE+
Sbjct  75   LSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTPEHLGILISEK  134

Query  314  LQHPKVIllrlalwllSTRIGTLMLCG  394
            L+HP   LL L+LWLLST  GT +LCG
Sbjct  135  LRHPSTWLLLLSLWLLSTWFGTFILCG  161



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHA-AVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  319
            LSP  M ++ ++ DT LP+++        DD+SV  F++TSAS+AGTP+ +  +ISE+L+
Sbjct  78   LSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPEHLGILISEKLK  137

Query  320  HPKVIllrlalwllSTRIGTLMLCG  394
            HP   LL L LWLLST  GT +LCG
Sbjct  138  HPSTWLLLLTLWLLSTWFGTFILCG  162



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++ +I DT +P++D  +   VDD  V  ++  SAS  G P RVA +ISERL HPK  +
Sbjct  1    MESLVAICDTLIPSIDGSEVGHVDD-GVAGYYSASASQTGAPDRVARLISERLDHPKKWI  59

Query  338  lrlalwllSTRIGTLMLCG  394
            LR A+W LST IG+L+LCG
Sbjct  60   LRAAMWSLSTWIGSLVLCG  78



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 11/86 (13%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDV------PQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  316
            M  ++++ DTFLPA+DV      PQ H+++     + F+QTSAS+AG P  V   +  ++
Sbjct  13   MEALSALCDTFLPAIDVDNYDVGPQLHSSLH----RQFYQTSASMAGIPHHVGEFLGGKV  68

Query  317  QHPKVIllrlalwllSTRIGTLMLCG  394
            +HPK+ L RLA+ LLSTRIG+L+LCG
Sbjct  69   EHPKMCLARLAIMLLSTRIGSLILCG  94



>emb|CDX99381.1| BnaC01g11710D [Brassica napus]
Length=170

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++ +I DT +P+ D  +   +DD  V  ++  SAS+ GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTLIPSFDASEVGHLDD-GVAGYYSASASLTGTPDRVARLMSERLCHPKKWI  59

Query  338  lrlalwllSTRIGTLMLCG  394
            LR+ LW LST IG+L++CG
Sbjct  60   LRVGLWSLSTWIGSLVMCG  78



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LSP  M ++ ++ DT +P+++         +SV  F++TSAS+AGTPQR+  +I E+L+H
Sbjct  69   LSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLGILI-EKLKH  127

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P   LL + LWLLST  GTL+LCG
Sbjct  128  PSTRLLMVTLWLLSTWFGTLILCG  151



>emb|CDY66155.1| BnaA01g34940D [Brassica napus]
Length=170

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTLIPSLDASEVGHLDD-GVAGYYSASASHTGTPDRVARLMSERLHHPKKWI  59

Query  338  lrlalwllSTRIGTLMLCG  394
            LR+ LW LST IG+L++CG
Sbjct  60   LRVGLWSLSTWIGSLVMCG  78



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M  +T++ DTFLP++ +  H          F+QTSAS+  TP  +A ++ E+++HPK+ L
Sbjct  1    MEELTAVCDTFLPSIHLSDHHRHHQ-----FYQTSASMTQTPHHLAELLGEKIKHPKIYL  55

Query  338  lrlalwllSTRIGTLMLCG  394
             RLAL+ LSTR+GT +LCG
Sbjct  56   SRLALFSLSTRLGTFILCG  74



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP R A ++SERL HPK  +
Sbjct  1    MESLVAICDTFISSIDGSGVGHVDD-CVAGYFSASASQTGTPDRAARLMSERLHHPKKWI  59

Query  338  lrlalwllSTRIGTLMLCG  394
            LR  LWLLST IGTL+LCG
Sbjct  60   LRAGLWLLSTWIGTLILCG  78



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTFISSIDDSGVGHVDD-CVAGYFSASASQTGTPDRVARLMSERLHHPKKWI  59

Query  338  lrlalwllSTRIGTLMLCG  394
            LR  LWLLST IG+L+LCG
Sbjct  60   LRAGLWLLSTWIGSLVLCG  78



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  +LR+ LW LST IG+L+LCG
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCG  121



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 3/106 (3%)
 Frame = +2

Query  77   DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  256
            D  F   + E     VY+    ++   M ++ +I DT +P+ D  +   +DD  V  ++ 
Sbjct  19   DVEFGGLRQEDETKTVYANS--MTAREMESLVAICDTLIPSRDASEVGHLDD-GVAGYYS  75

Query  257  TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             SAS  GTP RVA ++SERL HPK  +LR+ LW LST IG+L++CG
Sbjct  76   ASASHTGTPDRVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCG  121



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +2

Query  134  GCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  313
            G  L+   M ++T+ISDTFLP++D+P      ++S++ F+  SAS+ GTP+ V   +S R
Sbjct  48   GNGLTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLASASMIGTPEIVGGYVSRR  104

Query  314  LQHPKVIllrlalwllSTRIGTLMLCG  394
            L+H  + LLRL+LWLLST  GT + CG
Sbjct  105  LRHALLGLLRLSLWLLSTWYGTFIFCG  131



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T+  D FLP+VDV   +   D+ +  F+ TSAS+AGTP+R+  ++S  +QH
Sbjct  42   LSKREMDSLTAACDAFLPSVDV---SDTGDEGLIAFYGTSASMAGTPERIGGLLSGGMQH  98

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P + LLRLALWLLST  GT +LCG
Sbjct  99   PAIGLLRLALWLLSTWYGTFILCG  122



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  +LR+ LW LST IG+L+LCG
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCG  121



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  337
            M  ++++ DT LP+VDV     +     + F+QTSAS+  TP  VA ++  +++HPK+ L
Sbjct  18   MEALSALCDTLLPSVDV--DGQLHPSFHRQFYQTSASMTATPHHVAELLGGKIEHPKIYL  75

Query  338  lrlalwllSTRIGTLMLCG  394
             RLA+ LLSTRIGT +LCG
Sbjct  76   GRLAVGLLSTRIGTFVLCG  94



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSIDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P+  +LR+ LW LST IG+L+LCG
Sbjct  98   PRKWILRVGLWSLSTWIGSLVLCG  121



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  316
            LSP  M  +T+ SDT LP+V  D+     ++D   K F++TSAS+AGTP+ V   +S ++
Sbjct  60   LSPRQMEVLTAFSDTLLPSVFPDINCSGQLEDSLFK-FYRTSASMAGTPELVGGFLSGKI  118

Query  317  QHPKVIllrlalwllSTRIGTLMLCG  394
            +HP + +L LALWLLST  GT +LCG
Sbjct  119  EHPMLGVLLLALWLLSTWFGTFILCG  144



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            +S   M ++T+I D FLP++ V    A    +   F+Q+SAS+A TP+RV  ++SER++H
Sbjct  387  ISSREMESLTAICDAFLPSLHVSAADADAVAT---FYQSSASMAATPERVGGLLSERMEH  443

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  ++RLALWLLST +GT +LCG
Sbjct  444  PKKWMIRLALWLLSTWLGTFVLCG  467



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS   M ++T++ DT LPAVD P+  +  D+SV  F++TSAS+ GTP+ V  MIS+RL+ 
Sbjct  45   LSSWEMESLTALCDTLLPAVDPPE--STTDESVVRFYRTSASMNGTPEHVGRMISQRLRQ  102

Query  323  PKVIllrlalwllSTRIGTLM  385
              V+L R+ L LL+TR+GT +
Sbjct  103  -HVLLGRIILVLLATRLGTFV  122



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++T+ISDTFLP++D+P      ++S++ F+ TSAS+ GTP+ V   +S RL+H
Sbjct  51   LTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLTSASMIGTPEIVGGYMSGRLRH  107

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
              + LLRL+LWLLST  GT + CG
Sbjct  108  ASLWLLRLSLWLLSTWYGTFIFCG  131



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33   LTAREMESLWAICDTLIPSINGSEVCHVDD-HVAGFFAASASQMGTPDRVARKISGTLDH  91

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  LLR ALWLLST IG+L+LCG
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCG  115



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS     ++ ++ D FLP++ VP HA     S++ ++  SAS+ GTP+ V   +SER+QH
Sbjct  47   LSSREKDSLAAVCDAFLPSIHVP-HAP--HQSLRTYYANSASMIGTPEVVGGYLSERIQH  103

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            P++  LRLALWLLST  GT +LCG
Sbjct  104  PRLWQLRLALWLLSTWFGTFILCG  127



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33   LTAREMESLWAICDTLIPSINGSEVCHVDDH-VAGFFAASASQMGTPDRVARKISGTLDH  91

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
            PK  LLR ALWLLST IG+L+LCG
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCG  115



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQ---HAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  313
            LS + M ++ SI +TF P +D P    H    ++S+K FFQ+SAS    P  VA ++ +R
Sbjct  24   LSSSEMESLISICETFFPPLDPPSKLDHHDQINNSIKYFFQSSASQKPIPNEVAEVMKDR  83

Query  314  LQHPKVIllrlalwllSTRIGTLMLCG  394
                 VIL+R+ LWL+STR+GTL+LCG
Sbjct  84   GLVEAVILVRVVLWLISTRLGTLLLCG  110



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  334
            M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64   MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  335  llrlalwllSTRIGTLMLCG  394
            LL+  LWLLST +GT++LCG
Sbjct  123  LLKFVLWLLSTLVGTIILCG  142



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  158  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  334
            M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64   MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  335  llrlalwllSTRIGTLMLCG  394
            LL+  LWLLST +GT++LCG
Sbjct  123  LLKFVLWLLSTLVGTIILCG  142



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16   LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
             +   +   L LLS+RIGTL+LCG
Sbjct  75   AQQAGVLRVLSLLSSRIGTLILCG  98



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16   LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
             +   +   L LLS+RIGTL+LCG
Sbjct  75   AQQAGVLRVLSLLSSRIGTLILCG  98



>gb|KDO72346.1| hypothetical protein CISIN_1g0039901mg, partial [Citrus sinensis]
Length=74

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQR  289
            LS   M +++++ DTFLPAVDV   A++D D +  FF+ SAS AGTP+R
Sbjct  27   LSSQEMESLSALCDTFLPAVDVKTAASIDKD-IADFFRASASAAGTPER  74



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 34/122 (28%)
 Frame = +2

Query  131  GGCP-----LSPAVMATVTSISDTFLPAVDV------PQHAAVD----------------  229
            GG P     LSP  M ++T++ DT +P++DV      P++A  D                
Sbjct  48   GGLPPSPNHLSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSDFHG  107

Query  230  -------DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLML  388
                   DD+++ FF TSAS++GTP  VA ++S +++H    +LRL LWLLST  GT ++
Sbjct  108  QQQQNAGDDAIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFII  167

Query  389  CG  394
            CG
Sbjct  168  CG  169



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  275  GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            GTPQ +AWMI+ RLQHPK+ L +LALWLLSTRIGT +LCG
Sbjct  3    GTPQHIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCG  42



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  319
            LS   M ++ ++ DT LP+++   H+A D DDS+  F+  SAS   TPQ VA +I+E+L 
Sbjct  21   LSSREMHSLCTLCDTLLPSIN---HSATDEDDSLSNFYWASASTTATPQLVAGIITEKLP  77

Query  320  HPKVIllrlalwllSTRIGTLMLCG  394
             PK  +LRL LWLLST  GT +L G
Sbjct  78   LPKAGILRLTLWLLSTWFGTFILTG  102



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +2

Query  71   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  250
            DG S+  +  A   ND  YS    LS A M ++ ++ DTFLP+V  P  AA  D S  +F
Sbjct  50   DGASVEISQHANSNND-YYSSAGHLSAAEMESLAALCDTFLPSV-APATAA--DRSTAVF  105

Query  251  FQTSASIAGTPQRV  292
            F+TSAS  GTP+RV
Sbjct  106  FETSASAVGTPERV  119



>gb|KHN11790.1| hypothetical protein glysoja_006243 [Glycine soja]
Length=103

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  83   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  262
            L SNG+ E+    + +    LSP  M ++T++ DT LP+V         D+SV  F+Q S
Sbjct  38   LLSNGEREKKLQPLTNS---LSPRQMKSLTALCDTILPSV-ANHFVDSSDESVTKFYQIS  93

Query  263  ASIAGTPQRV  292
            AS+ GTP+RV
Sbjct  94   ASMTGTPERV  103



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 10/102 (10%)
 Frame = +2

Query  98   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  268
            KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKHNHG-------LSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFYKASGA  67

Query  269  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG
Sbjct  68   QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCG  109



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 10/102 (10%)
 Frame = +2

Query  98   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  268
            KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKHNHG-------LSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFYKASGA  67

Query  269  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG
Sbjct  68   QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCG  109



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 62/115 (54%), Gaps = 14/115 (12%)
 Frame = +2

Query  74   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAA--------VD  229
            G  L   G+  R   G Y  G  LS A M T++++  TF+P V  P  AA          
Sbjct  6    GHPLLRGGR--RAEKGGYRHG--LSAAQMRTLSAMCGTFVPTV--PIEAACLGGGKDEAP  59

Query  230  DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
            D++V+ FF  S S +  P  VA ++  R Q   V L++L LW+L+TR+GTL+LCG
Sbjct  60   DEAVEAFFLASGSDSPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCG  114



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  164  TVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllr  343
            ++ ++ DT LP VDV   ++V D+ +  F+ TSAS+ GT + +  ++S  L+HP   LL 
Sbjct  29   SLAAVCDTLLPQVDV---SSVGDEGLVEFYGTSASMVGTSEHIGGLLSGGLKHPAAGLLY  85

Query  344  lalwllSTRIGTLMLCG  394
            LALWLLST  GT  +CG
Sbjct  86   LALWLLSTWYGTFAMCG  102



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +2

Query  143  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  322
            LS + + ++ +I D F+P++  P    + D  V+ F++ S S  G P++VA +I+ R++ 
Sbjct  25   LSASQIKSLAAICDAFIPSI--PPTNDLQDPEVESFYRLSGSQNGIPEQVAELIARRVKP  82

Query  323  PKVIllrlalwllSTRIGTLMLCG  394
               ++ R  LWLLSTR+GT +LCG
Sbjct  83   IAFLMARWLLWLLSTRLGTWLLCG  106



>ref|XP_003607655.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1, partial [Medicago truncatula]
Length=189

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 5/93 (5%)
 Frame = +2

Query  125  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVA  295
            Y  G   S A M ++TSI +   P++ +      DD+S   V+ FF  SAS    P  VA
Sbjct  18   YKHG--FSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDEVA  75

Query  296  WMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             M  +R     VIL+R+ LWLL+TR+GTL++CG
Sbjct  76   EMFEKRAVIEAVILIRVILWLLATRLGTLLICG  108



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 10/102 (10%)
 Frame = +2

Query  98   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  268
            KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  269  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG
Sbjct  68   QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCG  109



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 10/102 (10%)
 Frame = +2

Query  98   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  268
            KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  269  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG  394
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG
Sbjct  68   QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCG  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559124820270