BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029F05

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AEW08475.1|  hypothetical protein CL64Contig1_07                   79.3    1e-17   Pinus radiata
gb|AFG63875.1|  hypothetical protein CL17Contig4_07                   79.3    2e-17   Pinus taeda
gb|ABV32015.1|  heat shock protein 70                                 79.0    3e-17   Musa acuminata [banana]
gb|ABR13291.1|  putative 70kDa heat-shock protein                     79.3    4e-17   Prunus dulcis [sweet almond]
gb|AFQ02691.1|  heat shock protein 70                                 79.0    2e-16   Oncidium hybrid cultivar
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                   79.3    3e-16   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AEX55235.1|  heat shock protein 70                                 79.3    4e-16   Allium sativum
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...  78.6    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...  79.7    8e-16   
emb|CAC16168.1|  hsp70 protein                                        77.0    9e-16   Zea mays [maize]
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2        79.3    1e-15   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...  79.3    1e-15   
dbj|BAK07857.1|  predicted protein                                    80.1    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD22854.1|  heat shock protein 70                                78.6    1e-15   Nicotiana benthamiana
emb|CDY03437.1|  BnaC01g16450D                                        77.0    1e-15   
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...  79.3    1e-15   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                   80.1    1e-15   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                  79.7    2e-15   
sp|P26791.1|HSP70_DAUCA  RecName: Full=Heat shock 70 kDa protein      79.3    2e-15   Daucus carota [carrots]
dbj|BAA34919.1|  heat shock protein 70 cognate                        78.2    2e-15   Salix gilgiana
ref|NP_001119156.1|  heat shock cognate protein 70-1                  79.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                   79.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like        79.3    2e-15   Elaeis guineensis
ref|XP_001783048.1|  predicted protein                                79.3    2e-15   
gb|KDP44978.1|  hypothetical protein JCGZ_01478                       79.0    2e-15   Jatropha curcas
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                   79.3    2e-15   Glycine soja [wild soybean]
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  79.7    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|ABM53667.1|  heat shock protein 70                                 76.6    2e-15   Euphorbia characias
gb|KDO37859.1|  hypothetical protein CISIN_1g041209mg                 78.2    2e-15   Citrus sinensis [apfelsine]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                   79.3    2e-15   Eucalyptus grandis [rose gum]
gb|KHG09207.1|  Heat shock 70 kDa 1 -like protein                     78.6    2e-15   Gossypium arboreum [tree cotton]
gb|ACD93209.1|  heat shock protein 70                                 79.0    2e-15   Camellia sinensis [black tea]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                   79.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...  78.6    2e-15   Brassica rapa
dbj|BAA04848.1|  HSP70                                                79.0    2e-15   Lilium longiflorum [Easter lily]
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...  79.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAB99745.1|  HSP70                                                 79.0    2e-15   Triticum aestivum [Canadian hard winter wheat]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                   79.0    2e-15   Triticum urartu
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...  79.0    2e-15   Brassica rapa
emb|CDX73815.1|  BnaA03g32320D                                        79.0    2e-15   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                  79.0    2e-15   
gb|ACJ54890.1|  heat shock protein 70                                 79.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...  79.0    3e-15   Phoenix dactylifera
ref|XP_001751923.1|  predicted protein                                79.0    3e-15   
emb|CDY00784.1|  BnaC03g37680D                                        79.0    3e-15   
emb|CDY50531.1|  BnaA01g30490D                                        79.0    3e-15   Brassica napus [oilseed rape]
emb|CDY52661.1|  BnaC01g38510D                                        78.6    3e-15   Brassica napus [oilseed rape]
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg           78.6    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like        78.6    3e-15   Eucalyptus grandis [rose gum]
ref|XP_001767839.1|  predicted protein                                78.6    3e-15   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382           78.6    3e-15   Selaginella moellendorffii
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390        78.6    3e-15   Sorghum bicolor [broomcorn]
ref|NP_176036.1|  heat shock protein ERD2                             78.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like        78.6    3e-15   Citrus sinensis [apfelsine]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580        78.6    3e-15   Sorghum bicolor [broomcorn]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   Vitis vinifera
gb|EPS64948.1|  hypothetical protein M569_09829                       78.6    3e-15   Genlisea aurea
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Elaeis guineensis
gb|AGL07711.1|  heat shock protein 70                                 78.6    3e-15   Ziziphus jujuba [Chinese jujube]
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...  77.8    3e-15   Eucalyptus grandis [rose gum]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                   79.0    3e-15   Triticum urartu
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein             78.6    3e-15   Elaeis guineensis
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein             78.6    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Sesamum indicum [beniseed]
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like        78.6    3e-15   Populus euphratica
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg           78.6    3e-15   Capsella rubella
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...  78.6    3e-15   Zea mays [maize]
gb|KJB20110.1|  hypothetical protein B456_003G133400                  78.6    3e-15   Gossypium raimondii
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                       78.6    3e-15   Jatropha curcas
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                   78.6    3e-15   Glycine soja [wild soybean]
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   Eucalyptus grandis [rose gum]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Setaria italica
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Glycine max [soybeans]
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120           78.6    3e-15   Selaginella moellendorffii
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858           78.6    3e-15   Selaginella moellendorffii
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Brassica rapa
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Setaria italica
gb|ADZ46371.1|  HSP70                                                 78.6    3e-15   Malus hupehensis
dbj|BAK00257.1|  predicted protein                                    78.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001759874.1|  predicted protein                                78.6    3e-15   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Pyrus x bretschneideri [bai li]
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                 78.6    3e-15   Citrus sinensis [apfelsine]
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg           78.6    3e-15   Capsella rubella
ref|XP_003625487.1|  Heat shock protein                               78.6    3e-15   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400        78.6    3e-15   
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                   78.6    3e-15   Eucalyptus grandis [rose gum]
ref|NP_001049719.2|  Os03g0277300                                     77.4    3e-15   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                 78.6    3e-15   Citrus sinensis [apfelsine]
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   
gb|KDO67641.1|  hypothetical protein CISIN_1g0092461mg                78.2    3e-15   Citrus sinensis [apfelsine]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg           78.6    3e-15   Citrus clementina [clementine]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Elaeis guineensis
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                   78.6    3e-15   Glycine soja [wild soybean]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Eucalyptus grandis [rose gum]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Fragaria vesca subsp. vesca
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   Vitis vinifera
ref|XP_007009362.1|  Heat shock cognate protein 70-1                  78.6    3e-15   
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg              78.6    3e-15   Erythranthe guttata [common monkey flower]
gb|AAG23797.1|  heat shock protein 70                                 74.3    3e-15   Cucurbita pepo
ref|XP_002311161.1|  heat shock protein 70                            78.6    3e-15   Populus trichocarpa [western balsam poplar]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                     78.6    3e-15   Glycine soja [wild soybean]
ref|NP_001055754.1|  Os05g0460000                                     78.6    3e-15   
gb|AAV97978.1|  heat shock protein hsp70                              78.6    3e-15   Saussurea medusa
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Phoenix dactylifera
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   Prunus mume [ume]
ref|XP_002528432.1|  heat shock protein, putative                     78.6    3e-15   Ricinus communis
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g           78.6    3e-15   Phaseolus vulgaris [French bean]
gb|KJB49429.1|  hypothetical protein B456_008G119200                  78.6    3e-15   Gossypium raimondii
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465           78.6    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg           78.6    3e-15   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Oryza brachyantha
gb|KDO67640.1|  hypothetical protein CISIN_1g0092461mg                78.2    3e-15   Citrus sinensis [apfelsine]
gb|AAM48131.1|AF509336_1  heat shock protein 70                       78.6    3e-15   Saussurea medusa
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_007009369.1|  Heat shock protein 70                            78.6    3e-15   
gb|AAB65162.1|  heat shock cognate protein                            76.6    3e-15   Solanum commersonii
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                   78.2    3e-15   Eucalyptus grandis [rose gum]
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg           78.6    3e-15   Prunus persica
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...  78.6    3e-15   
ref|NP_001140835.1|  uncharacterized protein LOC100272911             78.2    3e-15   Zea mays [maize]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    3e-15   Sesamum indicum [beniseed]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Sesamum indicum [beniseed]
gb|AIU34470.1|  putative heat shock protein                           78.6    3e-15   Taraxacum brevicorniculatum
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIZ68155.1|  heat shock protein 70                                 78.6    3e-15   Ornithogalum longebracteatum [sea-onion]
gb|ACJ11745.1|  heat shock protein 70                                 78.6    3e-15   Gossypium hirsutum [American cotton]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...  78.6    4e-15   Tarenaya hassleriana [spider flower]
gb|ABD32895.1|  Heat shock protein Hsp70                              78.6    4e-15   Medicago truncatula
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg           78.6    4e-15   Citrus clementina [clementine]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.6    4e-15   Glycine max [soybeans]
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...  78.6    4e-15   Camelina sativa [gold-of-pleasure]
ref|NP_187864.1|  heat shock protein 70-4                             78.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ABR18415.1|  unknown                                               78.6    4e-15   Picea sitchensis
ref|XP_007023492.1|  Heat shock protein 70B                           78.6    4e-15   
gb|ACD45076.1|  heat-shock protein 70                                 78.6    4e-15   Dactylis glomerata [cocksfoot]
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg           78.2    4e-15   Citrus clementina [clementine]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Glycine max [soybeans]
gb|AEO13403.1|  heat shock 70                                         78.2    4e-15   Glycine max [soybeans]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Populus euphratica
ref|XP_003621869.1|  Heat shock protein                               78.2    4e-15   Medicago truncatula
ref|NP_001044757.1|  Os01g0840100                                     78.2    4e-15   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum lycopersicum
gb|ABK25453.1|  unknown                                               78.2    4e-15   Picea sitchensis
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg           78.2    4e-15   Citrus clementina [clementine]
gb|KJB36734.1|  hypothetical protein B456_006G174000                  78.2    4e-15   Gossypium raimondii
ref|XP_002527736.1|  heat shock protein, putative                     78.2    4e-15   Ricinus communis
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                   78.2    4e-15   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                     78.2    4e-15   
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Nicotiana tomentosiformis
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Phoenix dactylifera
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Prunus mume [ume]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                       78.2    4e-15   Jatropha curcas
gb|ACJ11742.1|  heat shock protein 70                                 78.2    4e-15   Gossypium hirsutum [American cotton]
ref|XP_006378714.1|  heat shock protein 70 cognate                    78.2    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Setaria italica
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360        78.2    4e-15   Sorghum bicolor [broomcorn]
gb|AAP04522.1|  heat shock protein 70                                 78.2    4e-15   Nicotiana tabacum [American tobacco]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum tuberosum [potatoes]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg           78.2    4e-15   Prunus persica
ref|WP_039310754.1|  molecular chaperone DnaK                         78.2    4e-15   Paenibacillus sp. IHB B 3415
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Cicer arietinum [garbanzo]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Vitis vinifera
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Tarenaya hassleriana [spider flower]
gb|EPS60056.1|  heat shock protein 70                                 78.2    4e-15   Genlisea aurea
gb|AAP42157.1|AF509339_1  heat shock protein 70                       77.4    4e-15   Saussurea medusa
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like        78.2    4e-15   Zea mays [maize]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg           78.2    4e-15   Prunus persica
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Nicotiana sylvestris
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g           78.2    4e-15   Phaseolus vulgaris [French bean]
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Elaeis guineensis
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   
gb|KHN14134.1|  Heat shock 70 kDa protein                             78.2    4e-15   Glycine soja [wild soybean]
ref|XP_006368490.1|  heat shock protein 70 cognate                    78.2    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein     78.2    4e-15   Nicotiana tomentosiformis
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like        78.2    4e-15   Solanum tuberosum [potatoes]
gb|KJB46580.1|  hypothetical protein B456_007G375600                  78.2    4e-15   Gossypium raimondii
dbj|BAP90755.1|  heat shock protein 70                                78.2    4e-15   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   
dbj|BAJ91305.1|  predicted protein                                    78.2    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein     78.2    4e-15   Cucumis melo [Oriental melon]
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                      78.2    4e-15   Morus notabilis
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein             78.2    4e-15   Nicotiana sylvestris
emb|CDP09040.1|  unnamed protein product                              78.2    4e-15   Coffea canephora [robusta coffee]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_007016460.1|  Heat shock cognate protein 70-1                  78.2    4e-15   
gb|ACM42161.1|  heat shock protein 70.58                              78.2    4e-15   Ageratina adenophora
gb|KJB16980.1|  hypothetical protein B456_002G258500                  78.2    4e-15   Gossypium raimondii
gb|ACJ11740.1|  heat shock protein 70                                 78.2    4e-15   Gossypium hirsutum [American cotton]
emb|CAA83548.1|  PsHSC71.0                                            78.2    4e-15   Pisum sativum [garden pea]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Populus euphratica
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein     78.2    4e-15   Brachypodium distachyon [annual false brome]
gb|AAB97316.1|  cytosolic heat shock 70 protein                       78.2    4e-15   Spinacia oleracea
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g           78.2    4e-15   Phaseolus vulgaris [French bean]
gb|KJB83911.1|  hypothetical protein B456_013G270600                  78.2    4e-15   Gossypium raimondii
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70     78.2    4e-15   Cucurbita maxima [Boston marrow]
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like        78.2    4e-15   Glycine max [soybeans]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Cucumis melo [Oriental melon]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Prunus mume [ume]
gb|AAA62445.1|  heat shock protein                                    78.2    4e-15   Spinacia oleracea
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70     78.2    4e-15   Cucurbita maxima [Boston marrow]
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                 76.3    4e-15   Citrus sinensis [apfelsine]
gb|AIU40169.1|  heat shock protein 70                                 78.2    4e-15   Saccharum arundinaceum
gb|AAR17080.1|  heat shock protein 70-3                               78.2    4e-15   Nicotiana tabacum [American tobacco]
gb|KEH30133.1|  heat shock cognate 70 kDa protein                     78.2    4e-15   Medicago truncatula
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g           78.2    4e-15   Phaseolus vulgaris [French bean]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Cicer arietinum [garbanzo]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Cicer arietinum [garbanzo]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum lycopersicum
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like        78.2    4e-15   Pyrus x bretschneideri [bai li]
gb|EPS68565.1|  hypothetical protein M569_06198                       78.2    4e-15   Genlisea aurea
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum tuberosum [potatoes]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Nicotiana tomentosiformis
gb|AEK70336.1|  heat shock protein 70                                 78.2    4e-15   Paeonia lactiflora [common garden peony]
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                     78.2    4e-15   Triticum urartu
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein     78.2    4e-15   Nicotiana sylvestris
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...  78.2    4e-15   Spinacia oleracea
gb|ACJ11741.1|  heat shock protein 70                                 78.2    4e-15   Gossypium hirsutum [American cotton]
ref|XP_002316294.1|  heat shock protein 70                            78.2    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein     78.2    4e-15   Solanum lycopersicum
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                   78.2    4e-15   Vigna radiata [mung bean]
gb|ADD71975.1|  heat shock protein 70                                 78.2    4e-15   Rhododendron calophytum
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Fragaria vesca subsp. vesca
emb|CDP00073.1|  unnamed protein product                              78.2    4e-15   Coffea canephora [robusta coffee]
emb|CAB72130.1|  heat shock protein 70                                78.2    4e-15   Cucumis sativus [cucumbers]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Nicotiana sylvestris
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Nicotiana tomentosiformis
gb|KEH30131.1|  heat shock cognate 70 kDa protein                     78.2    4e-15   Medicago truncatula
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum tuberosum [potatoes]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g           78.2    4e-15   Phaseolus vulgaris [French bean]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                   78.2    4e-15   Vigna radiata [mung bean]
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                     78.2    4e-15   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum tuberosum [potatoes]
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein             78.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_006368489.1|  heat shock protein 70 cognate                    78.2    4e-15   Populus trichocarpa [western balsam poplar]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...  78.2    4e-15   Solanum lycopersicum
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   
emb|CCA29121.1|  heat shock protein 70 isoform 2                      78.2    4e-15   Solanum lycopersicum
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                   78.2    4e-15   Petunia x hybrida [garden petunia]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1        78.2    4e-15   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Solanum tuberosum [potatoes]
gb|AGR45355.1|  HSP70                                                 78.2    4e-15   Dendrobium officinale
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Fragaria vesca subsp. vesca
gb|KJB20862.1|  hypothetical protein B456_003G169700                  78.2    4e-15   Gossypium raimondii
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Nicotiana sylvestris
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   Nicotiana tomentosiformis
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g           78.2    4e-15   Phaseolus vulgaris [French bean]
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Setaria italica
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   Cucumis sativus [cucumbers]
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2   78.2    4e-15   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                   78.2    4e-15   Vigna radiata [mung bean]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70         78.2    4e-15   Cucurbita maxima [Boston marrow]
gb|KDP41951.1|  hypothetical protein JCGZ_26969                       78.2    4e-15   Jatropha curcas
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                      78.2    4e-15   Morus notabilis
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...  78.2    4e-15   Petunia x hybrida [garden petunia]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   
ref|XP_010091163.1|  Heat shock 70 kDa protein                        78.2    4e-15   Morus notabilis
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Glycine max [soybeans]
gb|AAL68968.1|  heat shock protein 70                                 78.2    4e-15   Chromochloris zofingiensis
gb|KJB20113.1|  hypothetical protein B456_003G133700                  75.9    4e-15   Gossypium raimondii
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                     78.2    4e-15   Glycine soja [wild soybean]
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein             78.2    4e-15   Nicotiana tomentosiformis
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...  78.2    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein             78.2    4e-15   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    4e-15   
gb|KHN17505.1|  Heat shock 70 kDa protein                             77.8    4e-15   
gb|EPS69582.1|  heat shock protein hsp70                              78.2    5e-15   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg              78.2    5e-15   
gb|AII99890.1|  heat shock protein                                    78.2    5e-15   
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    5e-15   
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...  78.2    5e-15   
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    5e-15   
gb|KJB16979.1|  hypothetical protein B456_002G258500                  78.2    5e-15   
ref|NP_001183165.1|  uncharacterized protein LOC100501536             78.2    5e-15   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    5e-15   
gb|KJB55903.1|  hypothetical protein B456_009G100400                  78.2    5e-15   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...  78.2    5e-15   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg              78.2    5e-15   
gb|AFU34347.1|  70-kDa heat shock protein                             78.2    5e-15   
ref|XP_003610287.1|  Heat-shock protein                               78.2    5e-15   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like        78.2    5e-15   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1  78.2    5e-15   
dbj|BAK02194.1|  predicted protein                                    78.2    5e-15   
gb|ACJ85522.1|  unknown                                               77.8    5e-15   
emb|CCA29120.1|  heat shock protein 70 isoform 1                      77.8    5e-15   
gb|KEH30132.1|  heat shock cognate 70 kDa protein                     77.8    5e-15   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
gb|EMT22558.1|  Heat shock cognate 70 kDa protein 2                   77.8    5e-15   
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                     77.8    5e-15   
emb|CAA44820.1|  heat shock protein 70                                77.8    5e-15   
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    5e-15   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                     77.8    5e-15   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
emb|CAA52684.1|  heat shock protein 70 cognate                        77.8    5e-15   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg              77.8    5e-15   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_002873056.1|  HSC70-1                                          77.8    5e-15   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg           77.8    5e-15   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg           77.8    5e-15   
ref|NP_195870.1|  heat shock cognate protein 70-1                     77.8    5e-15   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...  77.8    5e-15   
ref|XP_003083987.1|  putative hsp70 (ISS)                             77.8    5e-15   
ref|XP_006398708.1|  hypothetical protein EUTSA_v10012922mg           77.4    5e-15   
ref|XP_003621886.1|  Heat shock protein                               77.8    5e-15   
gb|AAV98051.1|  heat shock protein 70                                 77.8    5e-15   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...  77.8    6e-15   
gb|ACB70177.1|  70 kDa heat shock protein                             77.8    6e-15   
ref|XP_002873055.1|  predicted protein                                77.8    6e-15   
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720        77.8    6e-15   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like        77.8    6e-15   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...  77.8    6e-15   
gb|AGT97046.1|  heat shock protein 70                                 77.8    6e-15   
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like        77.8    6e-15   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                  77.8    6e-15   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein             77.8    6e-15   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...  77.8    6e-15   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like        77.8    6e-15   
emb|CDX93666.1|  BnaA06g03820D                                        75.1    6e-15   
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
ref|XP_004300724.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                   77.8    6e-15   
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.8    6e-15   
ref|NP_195869.1|  heat shock protein 70                               77.8    7e-15   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                   77.8    7e-15   
gb|AAS09825.1|  heat shock cognate protein 70                         77.4    7e-15   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like        77.4    7e-15   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                   77.4    7e-15   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like        77.4    7e-15   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...  77.4    7e-15   
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg              77.4    8e-15   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.4    8e-15   
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.4    8e-15   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                77.4    8e-15   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein             77.4    8e-15   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like        77.4    8e-15   
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like         76.3    8e-15   
dbj|BAM44862.1|  heat shock protein                                   72.8    8e-15   
gb|ACR38891.1|  heat shock protein 70                                 77.4    8e-15   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2   77.4    8e-15   
ref|XP_005843891.1|  heat shock protein 70                            77.4    8e-15   
ref|XP_002512741.1|  heat shock protein, putative                     77.4    8e-15   
ref|XP_002512742.1|  heat shock protein, putative                     77.4    9e-15   
emb|CAA38267.1|  heat shock protein 70 cognate                        71.2    9e-15   
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.4    9e-15   
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like        77.4    9e-15   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein             77.4    9e-15   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2  77.4    9e-15   
ref|XP_002279097.1|  PREDICTED: heat shock cognate 70 kDa protein     77.4    9e-15   
emb|CAN66715.1|  hypothetical protein VITISV_041184                   77.4    9e-15   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like        77.4    9e-15   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1  77.4    9e-15   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2   77.4    9e-15   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                77.4    9e-15   
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.0    9e-15   
ref|XP_002312089.1|  heat shock protein 70 cognate                    77.0    9e-15   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...  77.0    9e-15   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    9e-15   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    9e-15   
ref|XP_010094065.1|  Heat shock 70 kDa protein                        77.0    9e-15   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg           77.0    9e-15   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    9e-15   
ref|NP_001051724.1|  Os03g0821100                                     77.0    9e-15   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    1e-14   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4  77.0    1e-14   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg           77.0    1e-14   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    1e-14   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...  77.4    1e-14   
gb|KDP35613.1|  hypothetical protein JCGZ_09051                       77.0    1e-14   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3  77.0    1e-14   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1  77.0    1e-14   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    1e-14   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg           77.0    1e-14   
gb|ABR01232.1|  heat shock protein 70                                 77.0    1e-14   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g           77.0    1e-14   
emb|CDY33359.1|  BnaC05g12240D                                        76.6    1e-14   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg           77.0    1e-14   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...  77.0    1e-14   
gb|ABR01238.1|  heat shock protein 70                                 77.0    1e-14   
dbj|BAE48223.1|  heat shock protein 70                                77.0    1e-14   
ref|XP_011398670.1|  Heat shock cognate 70 kDa protein                77.4    1e-14   
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    1e-14   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein             77.0    1e-14   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...  77.0    1e-14   
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...  77.0    1e-14   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like        77.0    1e-14   
gb|AAB42159.1|  Hsc70                                                 77.0    1e-14   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5           77.0    1e-14   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...  77.0    1e-14   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein             77.0    1e-14   
emb|CDY35063.1|  BnaA06g10730D                                        76.6    1e-14   
ref|XP_002312090.1|  heat shock protein 70 cognate                    77.0    1e-14   
ref|XP_002532297.1|  heat shock protein, putative                     77.0    1e-14   
gb|KJB49499.1|  hypothetical protein B456_008G122300                  76.6    1e-14   
emb|CDX96825.1|  BnaA08g23680D                                        77.0    1e-14   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                  77.0    1e-14   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...  77.0    1e-14   
emb|CDP09035.1|  unnamed protein product                              76.6    1e-14   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...  77.0    1e-14   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like      76.6    1e-14   
emb|CDX83960.1|  BnaC08g16850D                                        76.6    1e-14   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like        76.6    1e-14   
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...  76.6    1e-14   
ref|XP_005707633.1|  molecular chaperone DnaK                         76.6    1e-14   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...  76.6    1e-14   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...  76.6    1e-14   
emb|CDO98244.1|  unnamed protein product                              76.6    1e-14   
gb|AAA82975.1|  PsHSP71.2                                             76.6    1e-14   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...  76.6    1e-14   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5           76.6    1e-14   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg           76.6    1e-14   
ref|XP_002891955.1|  early-responsive to dehydration 2                76.6    1e-14   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg           76.6    1e-14   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                     76.6    1e-14   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like      76.6    1e-14   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                     76.6    1e-14   
ref|XP_001785822.1|  predicted protein                                76.6    1e-14   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like      76.6    1e-14   
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2   76.6    1e-14   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                       76.6    1e-14   
ref|NP_173055.1|  heat shock protein 70B                              76.6    1e-14   
ref|XP_002892893.1|  HSP70B                                           76.6    1e-14   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5           76.6    1e-14   
dbj|BAJ34597.1|  unnamed protein product                              76.6    2e-14   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...  76.3    2e-14   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                       76.3    2e-14   
emb|CCD74508.1|  early-responsive to dehydration 2                    76.6    2e-14   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg              76.6    2e-14   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...  76.6    2e-14   
gb|KJB73858.1|  hypothetical protein B456_011G256600                  76.6    2e-14   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...  76.3    2e-14   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                     76.3    2e-14   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                     76.3    2e-14   
dbj|BAJ86014.1|  predicted protein                                    76.3    2e-14   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                  76.3    2e-14   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560        76.3    2e-14   
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like        76.3    2e-14   
emb|CAB72129.1|  heat shock protein 70                                76.3    2e-14   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2   76.3    2e-14   
gb|EAZ19310.1|  hypothetical protein OsJ_34853                        76.3    2e-14   
gb|AFA51946.1|  heat shock protein 70                                 76.3    2e-14   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...  76.3    2e-14   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2              76.3    2e-14   
ref|NP_001049712.1|  Os03g0276500                                     76.3    2e-14   
emb|CEG00633.1|  Heat shock protein 70 family                         76.3    2e-14   
gb|AAX07349.1|  heat shock protein 70                                 75.1    2e-14   
ref|XP_001781229.1|  predicted protein                                76.3    2e-14   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2              76.3    2e-14   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...  76.3    2e-14   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530        76.3    2e-14   
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...  76.3    2e-14   
ref|XP_005845752.1|  hypothetical protein CHLNCDRAFT_48993            76.3    2e-14   
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...  76.3    2e-14   
gb|AHW48175.1|  heat shock protein 70                                 75.9    2e-14   
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                   76.3    2e-14   
gb|AEO22185.1|  CytHSP70                                              75.9    2e-14   
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...  75.9    2e-14   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750        76.3    2e-14   
ref|XP_003595252.1|  Heat shock protein                               76.6    2e-14   
gb|KDO55357.1|  hypothetical protein CISIN_1g043979mg                 75.5    2e-14   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                   76.3    2e-14   
gb|KFK24739.1|  hypothetical protein AALP_AA8G018200                  76.6    2e-14   
tpg|DAA44672.1|  TPA: hsp70 protein                                   75.9    2e-14   
ref|XP_010678704.1|  PREDICTED: heat shock cognate 70 kDa protein...  75.9    2e-14   
gb|ABP35942.1|  heat shock protein 70                                 75.9    2e-14   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...  75.9    2e-14   
emb|CAA47948.2|  heat shock protein 70                                75.9    2e-14   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...  75.9    2e-14   
ref|NP_001068540.1|  Os11g0703900                                     75.9    2e-14   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...  75.9    2e-14   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...  75.9    2e-14   
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg           75.9    2e-14   
ref|XP_005643450.1|  heat shock protein 70                            75.9    2e-14   
gb|AFO66468.1|  heat shock 70kDa protein 8 isoform 2                  71.6    3e-14   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g           75.9    3e-14   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...  75.9    3e-14   



>gb|AEW08475.1| hypothetical protein CL64Contig1_07, partial [Pinus radiata]
 gb|AFG64116.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64117.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64118.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64119.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64120.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64121.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64122.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64123.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64124.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64125.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64126.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64127.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64128.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64129.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64130.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
 gb|AFG64131.1| hypothetical protein CL64Contig1_07, partial [Pinus taeda]
Length=78

 Score = 79.3 bits (194),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  17   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  66



>gb|AFG63875.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63876.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63877.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63878.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63879.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63880.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63881.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
 gb|AFG63882.1| hypothetical protein CL17Contig4_07, partial [Pinus taeda]
Length=90

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  2    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  51



>gb|ABV32015.1| heat shock protein 70, partial [Musa acuminata]
Length=89

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  32   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  81



>gb|ABR13291.1| putative 70kDa heat-shock protein [Prunus dulcis]
Length=125

 Score = 79.3 bits (194),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  29   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  78



>gb|AFQ02691.1| heat shock protein 70, partial [Oncidium hybrid cultivar]
Length=184

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  125  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  174



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  28   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  77



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  59   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  108



>ref|XP_010452091.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=340

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQ AILSGE
Sbjct  28   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGE  77



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  235  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  284



>emb|CAC16168.1| hsp70 protein [Zea mays]
Length=210

 Score = 77.0 bits (188),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIP+VQQLLQDFFNGKELCK+INPDEAVAYGAAVQAAILSGE
Sbjct  106  VVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGAAVQAAILSGE  155



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  356  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  405



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>dbj|BAK07857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  451  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  500



>dbj|BAD22854.1| heat shock protein 70 [Nicotiana benthamiana]
Length=383

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  72   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  121



>emb|CDY03437.1| BnaC01g16450D [Brassica napus]
Length=264

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPK+QQLLQDFFNG ELCKSINPDEAVAYGAAVQAAIL+GE
Sbjct  210  VVLVGGSTRIPKIQQLLQDFFNGNELCKSINPDEAVAYGAAVQAAILTGE  259



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EMT15100.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=1430

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIP+VQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPRVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AFW88810.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=782

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  471  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  520



>sp|P26791.1|HSP70_DAUCA RecName: Full=Heat shock 70 kDa protein [Daucus carota]
 emb|CAA42685.1| heat shock protein 70 [Daucus carota]
Length=655

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
             VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  100  AVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  149



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQ AILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGE  389



>gb|KCW53915.1| hypothetical protein EUGRSUZ_J03127 [Eucalyptus grandis]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  336  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  385



>ref|XP_010929169.1| PREDICTED: heat shock 70 kDa protein-like [Elaeis guineensis]
Length=647

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDP44978.1| hypothetical protein JCGZ_01478 [Jatropha curcas]
Length=570

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  269  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  318



>gb|KHN13890.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=729

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010669896.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104887018 
[Beta vulgaris subsp. vulgaris]
Length=1526

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3     VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
             VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  1215  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  1264



>gb|ABM53667.1| heat shock protein 70 [Euphorbia characias]
Length=273

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAIL GE
Sbjct  108  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILCGE  157



>gb|KDO37859.1| hypothetical protein CISIN_1g041209mg [Citrus sinensis]
Length=412

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  125  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  174



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  433  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  482



>gb|KHG09207.1| Heat shock 70 kDa 1 -like protein [Gossypium arboreum]
Length=506

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  251  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  300



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  389



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  433  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  482



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQ AILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGE  389



>dbj|BAA04848.1| HSP70 [Lilium longiflorum]
Length=649

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ABF95267.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ26449.1| hypothetical protein OsJ_10337 [Oryza sativa Japonica Group]
Length=653

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  388



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  388



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007016452.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34071.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=677

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACJ54890.1| heat shock protein 70 [Oryza sativa Japonica Group]
Length=653

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>ref|XP_008812036.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=647

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010034044.1| PREDICTED: heat shock 70 kDa protein-like [Eucalyptus grandis]
 gb|KCW53916.1| hypothetical protein EUGRSUZ_J03127 [Eucalyptus grandis]
Length=652

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  336  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  385



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002968525.1| hypothetical protein SELMODRAFT_440382 [Selaginella moellendorffii]
 ref|XP_002994402.1| hypothetical protein SELMODRAFT_187834 [Selaginella moellendorffii]
 gb|EFJ04536.1| hypothetical protein SELMODRAFT_187834 [Selaginella moellendorffii]
 gb|EFJ30779.1| hypothetical protein SELMODRAFT_440382 [Selaginella moellendorffii]
Length=657

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  338  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  387



>ref|XP_002465468.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
 gb|EER92466.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
Length=652

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006493389.1| PREDICTED: heat shock 70 kDa protein-like [Citrus sinensis]
Length=661

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  311  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  360



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  348  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  397



>ref|XP_010937656.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Elaeis guineensis]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  107  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  156



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  455  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  504



>ref|XP_010905019.1| PREDICTED: heat shock 70 kDa protein [Elaeis guineensis]
Length=653

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPK+QQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKIQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010273662.1| PREDICTED: heat shock 70 kDa protein [Nelumbo nucifera]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_011034569.1| PREDICTED: heat shock 70 kDa protein-like [Populus euphratica]
Length=655

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008658250.1| PREDICTED: uncharacterized protein LOC100272911 isoform X1 [Zea 
mays]
 gb|AFW88811.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=652

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_008656365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002976219.1| hypothetical protein SELMODRAFT_443120 [Selaginella moellendorffii]
 gb|EFJ22479.1| hypothetical protein SELMODRAFT_443120 [Selaginella moellendorffii]
Length=655

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  338  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  387



>ref|XP_002987127.1| hypothetical protein SELMODRAFT_446858 [Selaginella moellendorffii]
 gb|EFJ11703.1| hypothetical protein SELMODRAFT_446858 [Selaginella moellendorffii]
Length=655

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  338  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  387



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004984743.1| PREDICTED: heat shock cognate 70 kDa protein-like [Setaria italica]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDO55354.1| hypothetical protein CISIN_1g043296mg [Citrus sinensis]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006290203.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
 gb|EOA23101.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002446329.1| hypothetical protein SORBIDRAFT_06g014400 [Sorghum bicolor]
 gb|EES10657.1| hypothetical protein SORBIDRAFT_06g014400 [Sorghum bicolor]
Length=575

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  272  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  321



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|NP_001049719.2| Os03g0277300 [Oryza sativa Japonica Group]
 dbj|BAF11633.2| Os03g0277300 [Oryza sativa Japonica Group]
Length=398

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  86   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  135



>gb|KDO55360.1| hypothetical protein CISIN_1g038511mg [Citrus sinensis]
Length=624

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  330  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  379



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDO67641.1| hypothetical protein CISIN_1g0092461mg, partial [Citrus sinensis]
Length=499

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDEAVAYGAAVQAAILSGE
Sbjct  301  VVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEAVAYGAAVQAAILSGE  350



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAG23797.1| heat shock protein 70 [Cucurbita pepo]
Length=134

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +3

Query  12   VGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  1    VGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  47



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  389



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  337  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  386



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KJB49429.1| hypothetical protein B456_008G119200 [Gossypium raimondii]
Length=617

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  329  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  378



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  328  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  377



>ref|XP_006649853.1| PREDICTED: heat shock cognate 70 kDa protein-like [Oryza brachyantha]
Length=653

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>gb|KDO67640.1| hypothetical protein CISIN_1g0092461mg, partial [Citrus sinensis]
Length=515

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDEAVAYGAAVQAAILSGE
Sbjct  301  VVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEAVAYGAAVQAAILSGE  350



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  30   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  79



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007203774.1| hypothetical protein PRUPE_ppa002595mg [Prunus persica]
 gb|EMJ04973.1| hypothetical protein PRUPE_ppa002595mg [Prunus persica]
Length=654

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  407  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  456



>ref|NP_001140835.1| uncharacterized protein LOC100272911 [Zea mays]
 gb|ACF84762.1| unknown [Zea mays]
Length=562

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  251  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  300



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009380663.1| PREDICTED: heat shock cognate 70 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVA GAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVACGAAVQAAILSGE  388



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ABR18415.1| unknown [Picea sitchensis]
 gb|ACN39931.1| unknown [Picea sitchensis]
 gb|ACN39963.1| unknown [Picea sitchensis]
Length=652

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_007023492.1| Heat shock protein 70B [Theobroma cacao]
 gb|EOY26114.1| Heat shock protein 70B [Theobroma cacao]
Length=654

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACD45076.1| heat-shock protein 70 [Dactylis glomerata]
Length=656

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  341  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  390



>ref|XP_006427662.1| hypothetical protein CICLE_v10025114mg [Citrus clementina]
 gb|ESR40902.1| hypothetical protein CICLE_v10025114mg [Citrus clementina]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  277  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  326



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  251  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  300



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ABK25453.1| unknown [Picea sitchensis]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_006427666.1| hypothetical protein CICLE_v10025102mg [Citrus clementina]
 gb|ESR40906.1| hypothetical protein CICLE_v10025102mg [Citrus clementina]
Length=656

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EMT06830.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  389



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  120  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  169



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010931247.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIP+VQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPRVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KHN14134.1| Heat shock 70 kDa protein [Glycine soja]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  338  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  387



>ref|XP_006368490.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP65059.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=655

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  389



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006346613.1| PREDICTED: heat shock 70 kDa protein-like [Solanum tuberosum]
Length=639

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009789460.1| PREDICTED: heat shock 70 kDa protein [Nicotiana sylvestris]
Length=654

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQA ILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQATILSGE  388



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVA GAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVACGAAVQAAILSGE  389



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KJB83911.1| hypothetical protein B456_013G270600 [Gossypium raimondii]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_003519161.1| PREDICTED: heat shock 70 kDa protein-like [Glycine max]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA+VQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGASVQAAILSGE  388



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  21   VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  70



>gb|AIU40169.1| heat shock protein 70 [Saccharum arundinaceum]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVA+GAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAHGAAVQAAILSGE  388



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007154870.1| hypothetical protein PHAVU_003G154800g [Phaseolus vulgaris]
 gb|ESW26864.1| hypothetical protein PHAVU_003G154800g [Phaseolus vulgaris]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009354217.1| PREDICTED: heat shock 70 kDa protein-like [Pyrus x bretschneideri]
Length=656

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EMS65063.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=657

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  344  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  393



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>sp|P29357.3|HSP7E_SPIOL RecName: Full=Chloroplast envelope membrane 70 kDa heat shock-related 
protein [Spinacia oleracea]
 emb|CAA43711.1| 70 kDa heat shock protein [Spinacia oleracea]
Length=653

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  342  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  391



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  339  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  388



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>gb|EMT17408.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=657

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            +VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  344  IVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  393



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_004287145.1| PREDICTED: heat shock 70 kDa protein [Fragaria vesca subsp. vesca]
Length=653

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



>ref|XP_006368489.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP65058.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=655

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEavaygaavqaaILSGE  152
            VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE
Sbjct  340  VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGE  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568782686340