BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029E22

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   241   4e-76   Nicotiana tomentosiformis
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  237   1e-74   Nicotiana tabacum [American tobacco]
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               236   4e-74   Eucalyptus grandis [rose gum]
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  235   5e-74   Nicotiana tabacum [American tobacco]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   235   5e-74   Nicotiana sylvestris
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   234   9e-74   Nicotiana tomentosiformis
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          231   3e-73   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              233   5e-73   Solanum lycopersicum
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             231   4e-72   Populus trichocarpa [western balsam poplar]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   230   6e-72   Nicotiana tomentosiformis
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        230   7e-72   Solanum tuberosum [potatoes]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               230   8e-72   Populus euphratica
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        229   9e-72   Solanum tuberosum [potatoes]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   229   9e-72   Nicotiana sylvestris
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     226   2e-71   Eucalyptus grandis [rose gum]
gb|KJB36606.1|  hypothetical protein B456_006G166800                    226   2e-71   Gossypium raimondii
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          226   1e-70   Gossypium arboreum [tree cotton]
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   226   2e-70   Solanum tuberosum [potatoes]
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               226   3e-70   Eucalyptus grandis [rose gum]
gb|AFH36337.1|  aquaporin PIP2;2                                        226   3e-70   Quercus petraea [durmast oak]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   224   4e-70   Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             224   4e-70   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   225   6e-70   Eucalyptus grandis [rose gum]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             224   1e-69   Citrus clementina [clementine]
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                224   1e-69   Populus trichocarpa x Populus deltoides
ref|XP_002322877.1|  major intrinsic protein 1                          224   1e-69   Populus trichocarpa [western balsam poplar]
ref|NP_001274308.1|  aquaporin PIP2-1-like                              224   1e-69   Solanum lycopersicum
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         223   5e-69   Helianthemum almeriense
gb|KJB62460.1|  hypothetical protein B456_009G418100                    220   5e-69   Gossypium raimondii
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   222   5e-69   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   222   7e-69   Populus euphratica
gb|KHG08488.1|  putative aquaporin PIP2-2                               222   1e-68   Gossypium arboreum [tree cotton]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    221   1e-68   Gossypium raimondii
emb|CDP06739.1|  unnamed protein product                                221   1e-68   Coffea canephora [robusta coffee]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             221   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                221   2e-68   Theobroma cacao [chocolate]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         221   2e-68   Jatropha curcas
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                221   3e-68   Populus trichocarpa x Populus deltoides
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             221   3e-68   Populus trichocarpa [western balsam poplar]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    221   3e-68   Gossypium raimondii
gb|KJB16797.1|  hypothetical protein B456_002G2484002                   216   3e-68   Gossypium raimondii
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     222   3e-68   Eucalyptus grandis [rose gum]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  221   3e-68   Mimosa pudica [sensitive-plant]
gb|ABK60196.1|  PIP2 protein                                            220   4e-68   Gossypium hirsutum [American cotton]
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        220   4e-68   Eucalyptus grandis [rose gum]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          220   5e-68   Gossypium arboreum [tree cotton]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   220   5e-68   Sesamum indicum [beniseed]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   220   6e-68   Tarenaya hassleriana [spider flower]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         220   6e-68   Ricinus communis
gb|AAV80229.1|  aquaporin 2                                             219   8e-68   Aegiceras corniculatum
gb|AAB18227.1|  MipC                                                    219   8e-68   Mesembryanthemum crystallinum
gb|AIA83104.1|  putative aquaporin PIP2                                 219   8e-68   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         219   1e-67   Ricinus communis
ref|NP_001268058.1|  aquaporin-like                                     219   1e-67   Vitis vinifera
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   218   2e-67   Gossypium raimondii
gb|AAO39007.1|  plasma intrinsic protein 2,1                            218   2e-67   Juglans regia
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         218   2e-67   Jatropha curcas
gb|ABK60195.2|  PIP2 protein                                            218   3e-67   Gossypium hirsutum [American cotton]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   218   3e-67   Populus euphratica
gb|AAO39008.1|  plasma intrinsic protein 2,2                            218   3e-67   Juglans regia
gb|AEC45513.1|  plasma membrane intrinsic protein                       218   3e-67   Hevea brasiliensis [jebe]
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     221   3e-67   Eucalyptus grandis [rose gum]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   218   3e-67   Fragaria vesca subsp. vesca
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         218   3e-67   Jatropha curcas
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             216   3e-67   Elaeis guineensis
gb|AEQ20672.1|  PIP2;1                                                  218   4e-67   Karelinia caspia
gb|KJB56129.1|  hypothetical protein B456_009G107200                    216   4e-67   Gossypium raimondii
gb|AAC17529.1|  aquaporin 2                                             218   5e-67   Samanea saman [cow-tamarind]
gb|ABB88840.1|  aquaporin                                               217   6e-67   Stevia rebaudiana
gb|AGG39693.1|  aquaporin protein AQU15                                 217   6e-67   Camellia sinensis [black tea]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   217   7e-67   Populus euphratica
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   217   8e-67   Phoenix dactylifera
gb|AGD98708.1|  aquaporin protein 5                                     217   8e-67   Camellia sinensis [black tea]
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   217   9e-67   Nelumbo nucifera [Indian lotus]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               217   1e-66   Pyrus x bretschneideri [bai li]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   217   1e-66   Setaria italica
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   216   2e-66   Eucalyptus grandis [rose gum]
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             216   2e-66   Elaeis guineensis
ref|NP_001268056.1|  aquaporin PIP2                                     216   2e-66   Vitis vinifera
gb|ACU23034.1|  unknown                                                 212   2e-66   Glycine max [soybeans]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             216   2e-66   Populus tremula x Populus tremuloides
gb|AIG92831.1|  aquaporin PIP2                                          216   2e-66   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    216   2e-66   Gossypium raimondii
gb|AIA83106.1|  putative aquaporin PIP2                                 216   2e-66   Citrus trifoliata [hardy orange]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   216   2e-66   Fragaria vesca subsp. vesca
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   216   3e-66   Phoenix dactylifera
gb|ACR56613.1|  plasma intrinsic protein 2;3                            215   3e-66   Juglans regia
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               215   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               215   4e-66   Brassica rapa
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                   211   4e-66   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               215   4e-66   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             214   4e-66   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        215   5e-66   Petunia x hybrida [garden petunia]
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     216   5e-66   Eucalyptus grandis [rose gum]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               215   5e-66   Malus domestica [apple tree]
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             215   5e-66   Eutrema salsugineum [saltwater cress]
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     217   5e-66   Eucalyptus grandis [rose gum]
emb|CDX67611.1|  BnaA07g16510D                                          215   6e-66   
gb|ACX37450.1|  plasma membrane intrinsic protein                       215   6e-66   Hevea brasiliensis [jebe]
gb|ACU87558.1|  PIP protein                                             214   7e-66   Gossypium hirsutum [American cotton]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               214   7e-66   Nicotiana tomentosiformis
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   214   8e-66   
gb|KHG00060.1|  putative aquaporin PIP2-2                               214   8e-66   Gossypium arboreum [tree cotton]
gb|AGD98707.1|  aquaporin protein 4                                     214   9e-66   Camellia sinensis [black tea]
gb|AGD98714.1|  aquaporin protein 11                                    214   9e-66   Camellia sinensis [black tea]
emb|CDX74983.1|  BnaA05g07290D                                          211   9e-66   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    214   1e-65   Nicotiana sylvestris
ref|XP_010098191.1|  Aquaporin PIP2-7                                   214   1e-65   Morus notabilis
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   214   1e-65   Glycine max [soybeans]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                214   1e-65   Hevea brasiliensis [jebe]
emb|CDY56697.1|  BnaCnng31040D                                          214   1e-65   Brassica napus [oilseed rape]
emb|CDY07519.1|  BnaC06g15450D                                          214   1e-65   Brassica napus [oilseed rape]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          214   1e-65   Gossypium arboreum [tree cotton]
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               214   1e-65   Populus euphratica
gb|AFK47400.1|  unknown                                                 214   1e-65   Lotus japonicus
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                213   2e-65   Erythranthe guttata [common monkey flower]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   213   2e-65   Elaeis guineensis
gb|AFH36338.1|  aquaporin PIP2;3                                        214   2e-65   Quercus petraea [durmast oak]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    213   2e-65   Gossypium raimondii
gb|ACZ06859.1|  plasma membrane intrinsic protein                       213   2e-65   Glycine soja [wild soybean]
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             213   2e-65   Capsella rubella
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             213   2e-65   Phaseolus vulgaris [French bean]
gb|AHA84284.1|  prolactin-inducible protein                             213   2e-65   Phaseolus vulgaris [French bean]
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   213   2e-65   Cucumis melo [Oriental melon]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    213   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        213   3e-65   Phoenix dactylifera
gb|AAY22203.1|  putative aquaporin                                      213   3e-65   Phaseolus vulgaris [French bean]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              213   3e-65   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   211   3e-65   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    213   3e-65   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    213   4e-65   Mesembryanthemum crystallinum
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   213   4e-65   Glycine max [soybeans]
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   211   4e-65   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       213   5e-65   Raphanus sativus
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              212   5e-65   Populus trichocarpa [western balsam poplar]
gb|AHG32324.1|  PIP2-3                                                  213   5e-65   Pisum sativum [garden pea]
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   212   5e-65   Nicotiana sylvestris
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             212   5e-65   Prunus persica
gb|ACU24483.1|  unknown                                                 212   6e-65   Glycine max [soybeans]
gb|AEQ29857.1|  aquaporin PIP2                                          212   6e-65   Malus prunifolia
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               212   7e-65   Brassica rapa
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             212   7e-65   Phaseolus vulgaris [French bean]
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               212   7e-65   Prunus mume [ume]
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               212   7e-65   Tarenaya hassleriana [spider flower]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   212   7e-65   Fragaria vesca subsp. vesca
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 211   7e-65   Gossypium hirsutum [American cotton]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               212   8e-65   Glycine max [soybeans]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         212   8e-65   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        212   8e-65   Malus domestica [apple tree]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               211   9e-65   Pyrus x bretschneideri [bai li]
gb|KHN00691.1|  Aquaporin PIP2-2                                        212   9e-65   Glycine soja [wild soybean]
ref|NP_001235204.1|  Pip1 protein                                       211   1e-64   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               212   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        211   1e-64   Brassica rapa
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        211   1e-64   Brassica rapa
ref|XP_003625627.1|  Aquaporin PIP2-1                                   211   1e-64   Medicago truncatula
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          211   1e-64   Cicer arietinum [garbanzo]
gb|AFK33316.1|  unknown                                                 211   1e-64   Medicago truncatula
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        211   1e-64   
gb|ACU19125.1|  unknown                                                 211   1e-64   Glycine max [soybeans]
gb|ACJ85211.1|  unknown                                                 211   1e-64   Medicago truncatula
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   211   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               211   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             211   1e-64   Phaseolus vulgaris [French bean]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               211   1e-64   Populus euphratica
emb|CDX91341.1|  BnaC04g08090D                                          211   2e-64   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    211   2e-64   Arabis alpina [alpine rockcress]
ref|NP_001105639.1|  aquaporin PIP2-7                                   211   2e-64   
ref|NP_001237286.1|  PIP2,2                                             211   2e-64   
gb|KJB20285.1|  hypothetical protein B456_003G141600                    212   2e-64   Gossypium raimondii
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   211   2e-64   Glycine max [soybeans]
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               211   2e-64   Brassica rapa
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    211   2e-64   Brassica rapa
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             211   2e-64   Eutrema salsugineum [saltwater cress]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                211   2e-64   Erythranthe guttata [common monkey flower]
gb|EPS68613.1|  hypothetical protein M569_06155                         211   2e-64   Genlisea aurea
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               211   2e-64   Elaeis guineensis
gb|ABB13430.2|  plasma membrane intrinsic protein                       211   2e-64   Olea europaea
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               210   2e-64   
gb|AFK35635.1|  unknown                                                 206   2e-64   Medicago truncatula
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               211   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               211   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   210   3e-64   Nicotiana tomentosiformis
gb|ACV70050.1|  aquaporin PIP2;1                                        208   3e-64   Quercus macrocarpa [burr oak]
ref|NP_001105616.1|  aquaporin PIP2-5                                   210   3e-64   Zea mays [maize]
emb|CAC82712.1|  major intrinsic protein 1                              210   4e-64   Populus tremula x Populus tremuloides
ref|NP_191042.1|  putative aquaporin PIP2-5                             210   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AFQ23567.1|  aquaporin PIP2;2                                        210   4e-64   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             207   4e-64   
gb|ADK25057.1|  plasma membrane intrinsic protein                       210   4e-64   Glycine max [soybeans]
gb|AEY75242.1|  plasma membrane intrinsic protein                       210   4e-64   Malus hupehensis
ref|NP_001240223.1|  prolactin-inducible protein                        210   5e-64   Glycine max [soybeans]
gb|AGD98705.1|  aquaporin                                               210   5e-64   Camellia sinensis [black tea]
gb|KHN05685.1|  Aquaporin PIP2-7                                        210   5e-64   Glycine soja [wild soybean]
gb|KHG29841.1|  putative aquaporin PIP2-2                               210   5e-64   Gossypium arboreum [tree cotton]
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               209   6e-64   Sesamum indicum [beniseed]
gb|ACG33001.1|  aquaporin PIP2.2                                        210   6e-64   Zea mays [maize]
gb|ACU20229.1|  unknown                                                 209   6e-64   Glycine max [soybeans]
gb|ACV70048.1|  aquaporin PIP2;1                                        207   6e-64   Quercus macrocarpa [burr oak]
gb|AAG44947.1|AF290620_1  putative PIP2                                 209   6e-64   Nicotiana glauca [glaucous tobacco]
ref|NP_001105026.1|  aquaporin PIP2-4                                   209   6e-64   Zea mays [maize]
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             209   6e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               211   6e-64   Camelina sativa [gold-of-pleasure]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           209   7e-64   Raphanus sativus
emb|CDX73446.1|  BnaC08g25570D                                          209   8e-64   
ref|NP_001047491.1|  Os02g0629200                                       209   8e-64   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               209   8e-64   Brassica rapa
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 209   8e-64   Nicotiana tabacum [American tobacco]
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    209   8e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316367.1|  putative aquaporin family protein                  209   9e-64   Populus trichocarpa [western balsam poplar]
gb|EAY86778.1|  hypothetical protein OsI_08158                          209   9e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   209   9e-64   Setaria italica
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   209   9e-64   
emb|CDY13298.1|  BnaC06g14590D                                          209   1e-63   Brassica napus [oilseed rape]
gb|ACU21481.1|  unknown                                                 209   1e-63   Glycine max [soybeans]
gb|ABH09328.1|  putative aquaporin                                      209   1e-63   Vitis vinifera
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        209   1e-63   Fragaria vesca subsp. vesca
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             209   1e-63   Phaseolus vulgaris [French bean]
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        209   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX91340.1|  BnaC04g08100D                                          209   1e-63   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   209   1e-63   Brassica rapa
gb|AFK47442.1|  unknown                                                 209   1e-63   Medicago truncatula
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  207   1e-63   Citrus sinensis [apfelsine]
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   209   1e-63   Setaria italica
gb|AAW80918.1|  putative plasma membrane intrinsic protein              209   1e-63   Astragalus membranaceus
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  209   1e-63   Pyrus communis
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  208   1e-63   Pyrus communis
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               209   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             209   1e-63   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   209   2e-63   Nelumbo nucifera [Indian lotus]
gb|ABC69040.1|  aquaporin PIP2-1                                        208   2e-63   Rhododendron catawbiense [Catawba rosebay]
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   209   2e-63   Nicotiana tomentosiformis
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               208   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        208   2e-63   Glycine max [soybeans]
gb|KHN38765.1|  Aquaporin PIP2-7                                        208   2e-63   Glycine soja [wild soybean]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           208   2e-63   Raphanus sativus
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   208   2e-63   Tarenaya hassleriana [spider flower]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            208   2e-63   Cucumis sativus [cucumbers]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             208   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             208   2e-63   Citrus clementina [clementine]
gb|ABU94631.1|  putative aquaporin PIP2;3                               208   2e-63   Phaseolus vulgaris [French bean]
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   208   2e-63   
dbj|BAE02729.1|  PIP aquaporin                                          208   2e-63   Hordeum vulgare [barley]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                208   3e-63   Erythranthe guttata [common monkey flower]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          208   3e-63   Sorghum bicolor [broomcorn]
gb|ACV70051.1|  aquaporin PIP2;1                                        206   3e-63   Quercus macrocarpa [burr oak]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               208   3e-63   Camelina sativa [gold-of-pleasure]
emb|CDX74984.1|  BnaA05g07300D                                          209   3e-63   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        208   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          207   3e-63   Solanum tuberosum [potatoes]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        207   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   207   3e-63   Cicer arietinum [garbanzo]
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        207   3e-63   Cucumis melo [Oriental melon]
gb|AEO13898.1|  aquaporin 7                                             207   4e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           206   4e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               207   4e-63   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             207   4e-63   Capsella rubella
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   207   5e-63   Brassica rapa
ref|NP_001274397.1|  aquaporin PIP2-1-like                              207   5e-63   Cucumis sativus [cucumbers]
gb|AFQ23186.1|  aquaporin PIP2;1                                        207   5e-63   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   207   6e-63   Cucumis melo [Oriental melon]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               207   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         207   6e-63   Ricinus communis
ref|NP_001275065.1|  major intrinsic protein 2                          207   6e-63   Solanum tuberosum [potatoes]
gb|AEY75244.1|  plasma membrane intrinsic protein                       207   7e-63   Malus hupehensis
emb|CDX10333.1|  aquaporin                                              207   7e-63   Coffea arabica [arabica coffee]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   207   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        207   7e-63   Camelina sativa [gold-of-pleasure]
gb|EMT09900.1|  Putative aquaporin PIP2-2                               207   7e-63   
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     206   7e-63   Eucalyptus grandis [rose gum]
gb|ACV70049.1|  aquaporin PIP2;1                                        205   8e-63   Quercus macrocarpa [burr oak]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   207   8e-63   Camelina sativa [gold-of-pleasure]
gb|ACV70052.1|  aquaporin PIP2;1                                        204   9e-63   Quercus macrocarpa [burr oak]
gb|ABX83874.1|  plasma membrane intrinsic protein                       206   1e-62   Rhododendron catawbiense [Catawba rosebay]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             206   1e-62   Citrus clementina [clementine]
gb|ADJ67992.1|  aquaporin                                               206   1e-62   Fragaria x ananassa
gb|ABK93567.1|  unknown                                                 206   1e-62   Populus trichocarpa [western balsam poplar]
dbj|BAA23744.1|  HvPIP2;1                                               206   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        206   1e-62   Brachypodium distachyon [annual false brome]
gb|ACJ85173.1|  unknown                                                 206   1e-62   
ref|NP_181255.1|  aquaporin PIP2-3                                      206   1e-62   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   206   1e-62   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             206   1e-62   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                206   1e-62   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         206   1e-62   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             206   1e-62   
gb|AIK66515.1|  putative aquaporin                                      206   1e-62   
emb|CAN75442.1|  hypothetical protein VITISV_019657                     206   1e-62   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             206   1e-62   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          206   1e-62   
gb|AAV69744.1|  aquaporin                                               206   1e-62   
ref|NP_001267922.1|  aquaporin-like                                     206   2e-62   
gb|ABH09326.1|  putative aquaporin                                      206   2e-62   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   206   2e-62   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   206   2e-62   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   206   2e-62   
ref|XP_003606384.1|  Aquaporin PIP2-7                                   203   2e-62   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   206   2e-62   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               206   2e-62   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        206   2e-62   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     206   2e-62   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  207   2e-62   
gb|AGD98712.1|  aquaporin protein 9                                     205   2e-62   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               206   2e-62   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             204   2e-62   
gb|ACV70053.1|  aquaporin PIP2;2                                        203   3e-62   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        205   3e-62   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   205   3e-62   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             205   3e-62   
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   204   3e-62   
emb|CDY46759.1|  BnaA03g17030D                                          205   3e-62   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             205   3e-62   
gb|ABN11917.1|  aquaporin                                               205   3e-62   
gb|AAL32127.1|  aquaporin                                               205   3e-62   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    205   3e-62   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   205   4e-62   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       205   4e-62   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             204   5e-62   
ref|NP_001234625.1|  aquaporin                                          204   5e-62   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              204   6e-62   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   204   6e-62   
ref|NP_181254.1|  aquaporin PIP2-2                                      204   6e-62   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 204   6e-62   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  204   6e-62   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        204   8e-62   
gb|ACB87734.1|  aquaporin                                               204   8e-62   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             204   8e-62   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          204   9e-62   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   204   1e-61   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               204   1e-61   
gb|ABM54183.1|  aquaporin                                               204   1e-61   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          204   1e-61   
gb|ABO69705.2|  aquaporin PIP2                                          204   1e-61   
ref|NP_001105025.1|  aquaporin PIP2-3                                   204   1e-61   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          204   1e-61   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             204   1e-61   
dbj|BAE06148.1|  PIP aquaporin isoform                                  204   1e-61   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          203   1e-61   
gb|EMT03221.1|  hypothetical protein F775_43871                         203   2e-61   
ref|NP_001059542.1|  Os07g0448100                                       203   2e-61   
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        202   2e-61   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   203   2e-61   
emb|CDP07111.1|  unnamed protein product                                203   2e-61   
ref|NP_001280185.1|  aquaporin PIP2-2                                   203   2e-61   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          203   2e-61   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   203   2e-61   
gb|AHG32323.1|  PIP2-2                                                  203   2e-61   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           203   2e-61   
gb|ABU94630.1|  putative aquaporin PIP2;2                               203   2e-61   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      203   3e-61   
gb|ABI96813.1|  plasma membrane intrinsic protein                       203   3e-61   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    202   3e-61   
gb|ADG03686.1|  aquaporin                                               203   3e-61   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               202   3e-61   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   202   5e-61   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          203   5e-61   
dbj|BAF33069.1|  aquaporin                                              202   6e-61   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               202   6e-61   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          202   7e-61   
gb|ACV70047.1|  aquaporin PIP2;1                                        199   7e-61   
ref|NP_190910.1|  aquaporin PIP2-1                                      201   8e-61   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   201   9e-61   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   201   1e-60   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        201   1e-60   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          201   1e-60   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               201   1e-60   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        201   1e-60   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   201   1e-60   
ref|NP_001053335.1|  Os04g0521100                                       201   2e-60   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   198   2e-60   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             201   2e-60   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             201   2e-60   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               200   3e-60   
gb|ABI96814.1|  plasma membrane intrinsic protein                       200   3e-60   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               200   3e-60   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   200   3e-60   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        200   3e-60   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          200   3e-60   
gb|ACM50914.1|  aquaporin                                               200   4e-60   
gb|EMS56715.1|  putative aquaporin PIP2-2                               201   4e-60   
gb|KJB73581.1|  hypothetical protein B456_011G239500                    198   5e-60   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   199   5e-60   
gb|EMS51072.1|  Aquaporin PIP2-5                                        199   5e-60   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  199   6e-60   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    199   6e-60   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   199   7e-60   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   199   7e-60   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          199   9e-60   
ref|NP_001105027.1|  aquaporin PIP2-6                                   199   1e-59   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     199   1e-59   
ref|NP_200874.1|  putative aquaporin PIP2-4                             199   1e-59   
ref|NP_001289999.1|  aquaporin PIP2-1                                   198   1e-59   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        198   2e-59   
emb|CAB46351.1|  major intrinsic protein 2                              198   2e-59   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              198   2e-59   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        198   2e-59   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    197   4e-59   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 197   4e-59   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   197   4e-59   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               196   7e-59   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             193   1e-58   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          196   1e-58   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        202   1e-58   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               196   1e-58   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               196   1e-58   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      192   1e-58   
ref|XP_010935141.1|  PREDICTED: aquaporin PIP2-7-like                   195   2e-58   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          196   2e-58   
gb|ACV70057.1|  aquaporin PIP2;3                                        193   3e-58   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                194   3e-58   
ref|NP_001059545.1|  Os07g0448800                                       195   3e-58   
gb|ACR38689.1|  unknown                                                 193   4e-58   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   194   4e-58   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          195   4e-58   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                193   5e-58   
gb|ACV70056.1|  aquaporin PIP2;3                                        192   6e-58   
gb|AFQ23181.1|  aquaporin PIP2;2                                        194   6e-58   
ref|NP_001052292.1|  Os04g0233400                                       194   6e-58   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    194   7e-58   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               194   8e-58   
ref|NP_001267957.1|  aquaporin PIP2;2                                   194   8e-58   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             194   8e-58   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             194   1e-57   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               193   1e-57   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               193   1e-57   
ref|NP_001105638.1|  aquaporin PIP2-2                                   193   1e-57   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   192   1e-57   
gb|ABH09327.1|  putative aquaporin                                      193   1e-57   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    193   1e-57   
gb|ACV66986.1|  plasma membrane aquaporin 2                             192   2e-57   
ref|NP_001105024.1|  aquaporin PIP2-1                                   193   2e-57   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             190   2e-57   
gb|AAO86707.1|  aquaporin                                               193   2e-57   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     192   3e-57   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    192   3e-57   
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       192   3e-57   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      192   3e-57   
gb|ACF79873.1|  unknown                                                 192   3e-57   
gb|ACV70054.1|  aquaporin PIP2;3                                        190   3e-57   
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   192   4e-57   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                193   4e-57   
gb|AFH36336.1|  aquaporin PIP2;1                                        192   4e-57   
gb|EMS55627.1|  Aquaporin PIP2-3                                        187   4e-57   
gb|AAC16545.1|  aquaporin                                               192   5e-57   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          192   5e-57   
ref|NP_179277.1|  putative aquaporin PIP2-8                             191   5e-57   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             191   5e-57   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               191   6e-57   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               191   6e-57   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   192   6e-57   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               191   8e-57   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               191   9e-57   
gb|ABI96815.1|  plasma membrane intrinsic protein                       191   9e-57   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   191   1e-56   
gb|ABL76066.1|  aquaporin 2                                             191   1e-56   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             191   1e-56   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                191   1e-56   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             191   1e-56   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             191   1e-56   
gb|KJB15836.1|  hypothetical protein B456_002G198900                    188   1e-56   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      191   1e-56   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     191   1e-56   
gb|KJB15839.1|  hypothetical protein B456_002G198900                    188   2e-56   
gb|KHG01329.1|  Aquaporin PIP2-7 -like protein                          189   2e-56   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     190   2e-56   
gb|AFN53685.1|  putative aquaporin PIP2-8                               199   2e-56   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          190   2e-56   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               190   2e-56   
gb|ACU87556.1|  PIP protein                                             190   2e-56   
emb|CDX69112.1|  BnaC01g03410D                                          190   2e-56   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               190   2e-56   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 190   2e-56   
ref|XP_003604054.1|  Aquaporin PIP22                                    190   2e-56   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        190   2e-56   
gb|KJB15838.1|  hypothetical protein B456_002G198900                    188   2e-56   
emb|CDP21564.1|  unnamed protein product                                190   2e-56   
gb|ACB42441.1|  aquaporin PIP2;4                                        190   2e-56   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        190   3e-56   
gb|KJB12139.1|  hypothetical protein B456_002G002500                    189   3e-56   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                190   3e-56   
gb|ACU87555.1|  PIP protein                                             189   3e-56   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               189   3e-56   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   189   4e-56   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             189   5e-56   
gb|AEF32110.1|  aquaporin PIP2                                          189   5e-56   
dbj|BAG06230.1|  plasma membrane intrinsic protein                      189   5e-56   
gb|ACG39551.1|  aquaporin PIP2.1                                        189   6e-56   
ref|XP_002306187.1|  membrane intrinsic family protein                  189   6e-56   
ref|XP_008806122.1|  PREDICTED: aquaporin PIP2-7-like                   188   7e-56   
gb|ACV70055.1|  aquaporin PIP2;3                                        186   7e-56   
ref|XP_006664813.1|  PREDICTED: probable aquaporin PIP2-6-like          188   8e-56   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  189   8e-56   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   189   8e-56   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            189   8e-56   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       189   8e-56   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  189   8e-56   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    188   9e-56   
emb|CDX76314.1|  BnaA08g10860D                                          188   1e-55   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   188   1e-55   
gb|ACB42440.1|  aquaporin PIP2;3                                        188   1e-55   



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 2/145 (1%)
 Frame = +3

Query  84   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTDP+ KG ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQTDPDHKG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA+MYM+AQCLGAICGCGLVK
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVK  150



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 2/145 (1%)
 Frame = +3

Query  84   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA+MYM+AQCLGAICGCGLVK
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVK  150



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+EGA    A +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDLEGAQPPLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP + G+D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTMNGSD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICGCGLVK
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVK  143



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYM+AQCLGAICGCGLVK
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVK  142



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYM+AQCLGAICGCGLVK
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVK  142



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   234 bits (598),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD +  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDTDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYM+AQCLGAICGCGLVK
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVK  142



>ref|XP_006367009.1| PREDICTED: probable aquaporin PIP2-2-like [Solanum tuberosum]
Length=204

 Score =   231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 6/144 (4%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MY+VAQCLGAICGCGLVK
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVK  138



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 6/144 (4%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDMEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MY+VAQCLGAICGCGLVK
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVK  138



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E A      KDYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICGCGLVK
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVK  143



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   230 bits (586),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            +SL RAVMYM+AQCLGAICGCGLVK
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVK  144



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   230 bits (586),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            Y SQ   +  G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   YNSQNSTDQCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA+MY+VAQCLGAICGCGLVK
Sbjct  120  RKVSLVRAIMYIVAQCLGAICGCGLVK  146



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   230 bits (586),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E A      +DYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICGCGLVK
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVK  143



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 132/144 (92%), Gaps = 6/144 (4%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YNSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MY+VAQCLGAICGCGLVK
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVK  138



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAI+AEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            +SL RAVMYM+AQCLGAICGCGLVK
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVK  144



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 134/146 (92%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A   E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV YMVAQCLGAICGCGLVK
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVK  144



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMAAQCLGAICGCGLVK  142



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMAAQCLGAICGCGLVK  142



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA+ Y+VAQCLGAICGCGLVK
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVK  140



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E        +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDMESGEPPFGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP + GT EC GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQVDPALNGT-ECDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICGCGLVK
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVK  143



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A   EY+A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGEYSA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-LKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+YMVAQCLGAICG GLVK
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVK  144



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 134/150 (89%), Gaps = 8/150 (5%)
 Frame = +3

Query  87   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  249  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  428
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  429  FLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            FL RKVSL+RA++YMVAQCLGAICGCG VK
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVK  148



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 134/150 (89%), Gaps = 8/150 (5%)
 Frame = +3

Query  87   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  249  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  428
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  429  FLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            FL RKVSL+RA++YMVAQCLGAICGCG VK
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVK  148



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   225 bits (573),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 134/146 (92%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A   E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV YMVAQCLGAICGCGLVK
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVK  144



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 134/150 (89%), Gaps = 8/150 (5%)
 Frame = +3

Query  87   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  249  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  428
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  429  FLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            FL RKVSL+RA++YMVAQCLGAICGCG VK
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVK  148



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 132/145 (91%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA+ Y+VAQCLGAICGCGLVK
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVK  140



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 5/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+ E A E+ A KDY DPPPAPL D EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKEAEAAGEFRA-KDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID----GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  115

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  116  SLVRAILYMVAQCLGAICGCGLVK  139



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVK  142



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 4/139 (3%)
 Frame = +3

Query  111  TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPN  290
            TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ   +
Sbjct  1    TEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQNSTD  59

Query  291  VKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA  461
              G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA
Sbjct  60   QCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA  119

Query  462  VMYMVAQCLGAICGCGLVK  518
            +MY+VAQCLGAICGCGLVK
Sbjct  120  IMYIVAQCLGAICGCGLVK  138



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   222 bits (566),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD N  G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  267  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVK  145



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQGSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  267  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVK  145



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 130/147 (88%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKD+E      E+   KDYQDPPPAPL+DPEEL +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  61   VIGYKSQSDTKANG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRAV+YMVAQCLGAICGCGLVK
Sbjct  120  RKVSLVRAVLYMVAQCLGAICGCGLVK  146



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVK  142



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 4/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E   ++ A KDY DPPPAPL+D EEL KWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGQFQA-KDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ D   KG DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID---KGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  116

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  117  SLVRAILYMAAQCLGAICGCGLVK  140



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVEG    A  KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEGGDFQA--KDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP+ K +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQTDPS-KNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  117

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  118  SLVRAILYMAAQCLGAICGCGLVK  141



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGREFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVK  142



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEVRGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVK  142



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVK  142



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score =   216 bits (549),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAP +D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVK  142



>gb|KCW51593.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=336

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  123  APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGT  302
            + KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GT
Sbjct  111  SAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGT  170

Query  303  DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQ  482
            D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQ
Sbjct  171  DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQ  230

Query  483  CLGAICGCGLVK  518
            CLGAICG GLVK
Sbjct  231  CLGAICGVGLVK  242



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 3/146 (2%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTD  V   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA++Y+VAQCLGAICG GLVK
Sbjct  120  KVSLIRAILYIVAQCLGAICGVGLVK  145



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVK  142



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K       ++A KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKHAAEHGSFSA-KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD    GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYMVAQCLGAICG GLVK
Sbjct  120  SLVRAIMYMVAQCLGAICGVGLVK  143



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG+ +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVK  142



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 132/145 (91%), Gaps = 7/145 (5%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G TEY A KDYQDPPPAPLIDPEELGKWS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGTEYGA-KDYQDPPPAPLIDPEELGKWSLYRAVIAEFIATLLFLYITVLTVI  59

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+      TDECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   GYKSQS-----ATDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  114

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAV+Y++AQCLGAI G GLVK
Sbjct  115  VSLVRAVLYIIAQCLGAISGVGLVK  139



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 132/147 (90%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE    A E+ A KDY DPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQESAPEFTA-KDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKVQSDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  RKVSLVRALLYMVAQCLGAICGCGLVK  145



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 129/147 (88%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M KDVE      E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEVGGHGGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQTDP-AKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA+MYM AQCLGAICGCGLVK
Sbjct  119  RKVSLVRAIMYMAAQCLGAICGCGLVK  145



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E      APKDYQDPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQTDP+ K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA+KV
Sbjct  61   YSSQTDPD-KNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM+AQCLGAICGCGLVK
Sbjct  120  SLVRAMLYMMAQCLGAICGCGLVK  143



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M KDVE A + A   + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQTDPN    D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKSQTDPNTNA-DQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL++AV+YMVAQCLGAICG G VK
Sbjct  120  RKVSLIKAVLYMVAQCLGAICGVGFVK  146



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 129/150 (86%), Gaps = 7/150 (5%)
 Frame = +3

Query  87   MAKDVEGATEYA------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KDVE A +        + KDY DPPPAPLID EELGKWSFYRA+IAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  249  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  428
            VLT IGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   VLTAIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  429  FLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            FL RKVSL+RA++YMVAQCLGAICGCG VK
Sbjct  120  FLGRKVSLIRALLYMVAQCLGAICGCGFVK  149



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 133/148 (90%), Gaps = 6/148 (4%)
 Frame = +3

Query  87   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKDVE A     E++A KDY DPPPAPLID +ELGKWSFYRA+IAEFIATLLFLY+TVL
Sbjct  1    MAKDVEVAEATGGEFSA-KDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVL  59

Query  255  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            TVIGYKSQTDP+ K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDPD-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
             RKVSL+RA+ YMVAQCLGAICGCGLVK
Sbjct  119  GRKVSLIRALGYMVAQCLGAICGCGLVK  146



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A       KDY DPPPAPL+DPEELG WSFYRAIIAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK+QTDP   G +EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQC GAICGCGLVK
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVK  144



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVK  142



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAV YM AQCLGA+CGCGLVK
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVK  144



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 3/146 (2%)
 Frame = +3

Query  87   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A  T   + KDY DPPPAPLID +ELG+WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDPN K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKSQTDPN-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA+ YM+AQCLGAICGCGLVK
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVK  145



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIA LLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQCLGAICGCGLVK
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVK  142



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ D    G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAV YM AQCLGA+CGCGLVK
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVK  144



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 131/147 (89%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE A    E++A KDY DPPPAPLID EELGKWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVEVAENPGEFSA-KDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQTDP +K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   VIGYKSQTDP-LKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQCLGAICGCGLVK
Sbjct  119  RKVSLIRALLYMVAQCLGAICGCGLVK  145



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K       ++A KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  100  MTKHAAEHGSFSA-KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIG  158

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD    GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  159  YKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  218

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYMVAQCLGAICG GLVK
Sbjct  219  SLVRAIMYMVAQCLGAICGVGLVK  242



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M +D+E    +AA KDYQDPPP PLIDPEE GKWSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGRDIE-VGGFAA-KDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLTVIG  58

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL RAV+Y+VAQCLGAICGCGLVK
Sbjct  118  SLPRAVLYIVAQCLGAICGCGLVK  141



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV     ++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVAEQGSFSA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQ LGAICG GLVK
Sbjct  119  SLVRAVMYMVAQSLGAICGVGLVK  142



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  267  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YM+AQCLGAICG GLVK
Sbjct  120  VSLIRALLYMIAQCLGAICGVGLVK  144



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 129/145 (89%), Gaps = 3/145 (2%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G  +Y A KDYQDPPPA L D EEL KWSFYRAIIAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDIEVGGNDYGA-KDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLTVI  59

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTDP    +D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR 
Sbjct  60   GYKSQTDP-ANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARX  118

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL RA MYMVAQCLGAICGCGLVK
Sbjct  119  VSLPRAFMYMVAQCLGAICGCGLVK  143



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M KD+E A ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  258  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
             RKVSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVK  148



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSDTKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA++YMVAQCLGAICG GLVK
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVK  144



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   217 bits (553),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  114  EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNV  293
            E+   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIGYKSQTDPN+
Sbjct  7    EHHGGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNL  66

Query  294  KGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYM  473
              TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM
Sbjct  67   N-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYM  125

Query  474  VAQCLGAICGCGLVK  518
            VAQCLGAICG GLVK
Sbjct  126  VAQCLGAICGVGLVK  140



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   217 bits (553),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAVMY+VAQCLGAICG  LVK
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVK  144



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   217 bits (553),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFNA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ D    G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   217 bits (553),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E        KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  60

Query  267  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   YKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YM+AQCLGAICG GLVK
Sbjct  121  VSLIRALLYMIAQCLGAICGAGLVK  145



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAVMY+VAQCLGAICG  LVK
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVK  144



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   217 bits (552),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE +  ++++A KDY DPPPA LIDP+EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVESSEHSQFSA-KDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK QTD +  GTD CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKRQTDSSHNGTD-CGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAVMY++AQCLGAICG GLVK
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVGLVK  144



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQ LGAICG GLVK
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVK  142



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  105  GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTD  284
            G  E+AA KDY DPPPAPLID  ELG WS YRA+IAEFIATLLFLY+TVLTVIGYK QTD
Sbjct  12   GGGEFAA-KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTD  70

Query  285  PNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV  464
            PNV GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+
Sbjct  71   PNVAGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAL  130

Query  465  MYMVAQCLGAICGCGLVK  518
            +Y+VAQCLGAICG GLVK
Sbjct  131  LYIVAQCLGAICGVGLVK  148



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 130/146 (89%), Gaps = 5/146 (3%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRAV+YMVAQCLGA+CGCGLVK
Sbjct  118  KVSLVRAVLYMVAQCLGAVCGCGLVK  143



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  267  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YM+AQCLGAICG GLVK
Sbjct  120  VSLIRALLYMIAQCLGAICGVGLVK  144



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 5/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE + +  + KDY DPPPAPLIDP+EL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+D     TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQSD-----TDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  115

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+MYM+AQCLGA+CG GLVK
Sbjct  116  SLVRALMYMIAQCLGAVCGVGLVK  139



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVK  144



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD   K  D CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCLGAICGCGLVK
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVK  142



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV     ++A KDY DPPPAPLIDP EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVPEQGSFSA-KDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKS TDP +   D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSTTDPALNA-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA+MYMVAQCLGAICG GLVK
Sbjct  119  SLIRAIMYMVAQCLGAICGVGLVK  142



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M KD+E A ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  258  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
             RKVSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVK  148



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 130/152 (86%), Gaps = 9/152 (6%)
 Frame = +3

Query  87   MAKDVEGATEYA--------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllfly  242
            M KDVE A +          + KDY D PPAPLID +ELGKWSFYRA+IAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  243  vtvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  422
            VTVLTVIGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  61   VTVLTVIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119

Query  423  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            GLFL RKVSL+RA++YMVAQCLGAICGCG VK
Sbjct  120  GLFLGRKVSLIRALLYMVAQCLGAICGCGFVK  151



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 3/144 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E    +AA KDY DPPP PLIDPEE GKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIE-VGGFAA-KDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL RAVMY+VAQ LGAICGC LVK
Sbjct  118  SLPRAVMYIVAQSLGAICGCALVK  141



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 126/147 (86%), Gaps = 3/147 (2%)
 Frame = +3

Query  87   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KDVE A E      KDY DPPPAPLID EEL  WS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVATV  60

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YM+AQCLGAICG GLV+
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVR  147



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 5/146 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KDVEGA   EY+A KDYQDPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEGAEQGEYSA-KDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK Q+  +    D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKVQS--SAPDADDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+YMVAQCLGAICG GLVK
Sbjct  118  KVSLIRAVLYMVAQCLGAICGVGLVK  143



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDV     ++  KDY DPPPAPL D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEHGSFSG-KDYHDPPPAPLFDATELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            Y SQT+  +  G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YNSQTNTTLNPGADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQCLGAICG GLVK
Sbjct  120  VSLVRAVMYMVAQCLGAICGVGLVK  144



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E   E  A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVIG
Sbjct  1    MAKDLE-VQEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKAQTDASAGGAD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVR V+Y+VAQCLGAICGCGLVK
Sbjct  119  SLVRTVLYIVAQCLGAICGCGLVK  142



>ref|XP_008345040.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=166

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E  +   A KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGSGNPA-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK QTD  + G ++CGGVGI GIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL RKV
Sbjct  60   YKQQTDTTLNG-NQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLTRKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA++YMVAQ LGAI G GLVK
Sbjct  119  SLMRAILYMVAQSLGAIWGVGLVK  142



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQ LGAICG GLVK
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVK  142



>ref|XP_006291621.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24519.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=271

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG  LVK
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVK  143



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+V G+      KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNV-GSEGSFTTKDYQDPPPAPLIDPAELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKS++DP  K  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSESDP-AKNADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAVMYMVAQCLGAICG GLVK
Sbjct  119  SLIRAVMYMVAQCLGAICGVGLVK  142



>gb|KCW88816.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=325

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +3

Query  78   ELKMAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  251
            E  MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  252  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSLVRAV+YMVAQCLGA+CGCGLVK
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCGLVK  213



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YM AQ LGAICG GLVK
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVK  142



>ref|XP_006403531.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
 gb|ESQ44984.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
Length=286

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKRSFSGKDYQDPPPEPLFDAAELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRAVMYMVAQCLGAICG  LVK
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVK  143



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +3

Query  78   ELKMAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  251
            E  MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  252  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSLVRAV+YMVAQCLGA+CGCGLVK
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCGLVK  213



>emb|CDX67611.1| BnaA07g16510D [Brassica napus]
Length=286

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRAVMYMVAQCLGAICG  LVK
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVK  143



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 128/147 (87%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      E+ A KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVGGQGGEFQA-KDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   VIGYKSQTDP-AKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM AQCLGAICGCGLVK
Sbjct  119  RKVSLVRAILYMAAQCLGAICGCGLVK  145



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 127/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE     AA +DY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVE----MAAGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  267  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            Y+ QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQCLGAICGCGLVK
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVK  141



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE ATE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA++YMVAQCLGAICG G VK
Sbjct  119  SLIRALVYMVAQCLGAICGVGFVK  142



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 5/130 (4%)
 Frame = +3

Query  129  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  308
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KTYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  309  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  488
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  489  GAICGCGLVK  518
            GAICGCGLVK
Sbjct  119  GAICGCGLVK  128



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M KD+E A +     + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  258  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
             RKVSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVK  148



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   214 bits (546),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA +YMVAQCLGAICG  LVK
Sbjct  119  KVSLIRAGLYMVAQCLGAICGVALVK  144



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   214 bits (546),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 131/148 (89%), Gaps = 6/148 (4%)
 Frame = +3

Query  87   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAK+VE       E++A KDY DPPPAPL+D  EL KWSFYRAIIAEFIATLLFLY+TVL
Sbjct  1    MAKEVEETVVTEQEFSA-KDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVL  59

Query  255  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            TVIGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDP-IKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  118

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            ARKVSL+RA++YMVAQC GAICG GLVK
Sbjct  119  ARKVSLIRALLYMVAQCSGAICGVGLVK  146



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   211 bits (538),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICG G VK
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE ATE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTV TVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA++YMVAQCLGAICG G VK
Sbjct  119  SLIRALVYMVAQCLGAICGVGFVK  142



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE     E+ A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLYVT+LTV
Sbjct  1    MAKDVEVVEGGEFQA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ+      TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRAV+Y+VAQCLGAICG GLVK
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTGLVK  140



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVK  141



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV     + A KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVTEQGSFPA-KDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAI G GLVK
Sbjct  119  SLVRAVMYMVAQCLGAIAGVGLVK  142



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++YMVAQCLGAICG G VK
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVK  144



>emb|CDY07519.1| BnaC06g15450D [Brassica napus]
Length=286

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLY-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRAVMYMVAQCLGAICG  LVK
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVK  143



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK +E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATL FLY+TVLTVIG
Sbjct  1    MAKAIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTD   KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDL-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA+ YM AQCLGAICGCGLVK
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVK  142



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ D N    D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVK  142



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSDVK-NGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YMVAQCLGAICG GLVK
Sbjct  120  VSLIRAILYMVAQCLGAICGVGLVK  144



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 124/144 (86%), Gaps = 6/144 (4%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDV     + A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MAKDVAEQGSFGA-KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVATVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ        DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQA-----AVDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG GLVK
Sbjct  115  SLVRAVMYMVAQCLGAICGVGLVK  138



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE   E+ A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MGKDVE--AEFTA-KDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVATVIG  57

Query  267  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  58   YKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YM+AQCLGAICG GLVK
Sbjct  118  VSLIRALLYMIAQCLGAICGVGLVK  142



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV     + A KDY DPPPAPL DP EL KWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MTKDVAEHGSFPA-KDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ DP +KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPALKG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICG  LVK
Sbjct  119  SLIRAVLYMVAQCLGAICGVALVK  142



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 127/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDVE A    A +DY DPPPAPLI+ EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVETA----AGRDYHDPPPAPLINAEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  267  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQCLGAICGCGLVK
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVK  141



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVK  141



>ref|XP_006291622.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24520.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=286

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG  LVK
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVK  143



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA++Y+VAQC GAICG GL K
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAK  144



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA++Y+VAQC GAICG GL K
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAK  144



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD   A    + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTAARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQTD N  GT+ C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YNSQTDTNKPGTNACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV YM+AQCLGA+CG GLVK
Sbjct  121  SLVRAVAYMIAQCLGAVCGAGLVK  144



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQ LGAICG GLVK
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVK  142



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +3

Query  87   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KDVE A E      KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVATV  60

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+D NV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YM+AQCLGAICG GLVK
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVK  147



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA++Y+VAQC GAICG GL K
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAK  144



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 130/149 (87%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAK+VE    G  E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYV+VL
Sbjct  1    MAKEVETAEQGGGEFSA-KDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVL  59

Query  255  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK QTD      D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            L RKVSL+RA+MYMVAQCLGAICGCGLVK
Sbjct  120  LGRKVSLIRAIMYMVAQCLGAICGCGLVK  148



>ref|XP_008345410.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=227

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 3/145 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E  +   A KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGSGNPA-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGIS-GGHINPAVTFGLFLARK  443
            YK QTD  + G ++CGGVGI GIAWAFGGMIF+LVYCTAGIS GGHINPAVTFGLFL RK
Sbjct  60   YKQQTDTTLNG-NQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGGHINPAVTFGLFLTRK  118

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YMVAQ LGAICG GLVK
Sbjct  119  VSLMRAILYMVAQSLGAICGVGLVK  143



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEIGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQ LGAICG GLVK
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVK  142



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 126/147 (86%), Gaps = 3/147 (2%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD E  G       KDYQDPPP+PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DP V G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RK+SL+RA+MYMVAQCLGAICG G VK
Sbjct  121  RKLSLIRAIMYMVAQCLGAICGVGFVK  147



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +   A KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGS--FAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|XP_010325989.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=259

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 5/130 (4%)
 Frame = +3

Query  129  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  308
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KIYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  309  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  488
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  489  GAICGCGLVK  518
            GAICGCGLVK
Sbjct  119  GAICGCGLVK  128



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK +TD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIETDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++YMVAQCLGAICG G VK
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVK  144



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQC GAICG GLVK
Sbjct  118  VSLIRAVMYMVAQCAGAICGVGLVK  142



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY  QTD    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQ LGAICG GLVK
Sbjct  120  VSLIRAVMYMVAQSLGAICGVGLVK  144



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+V G+      KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNV-GSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS---ATATDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAVMYMVAQCLGAICG GLVK
Sbjct  117  SLIRAVMYMVAQCLGAICGVGLVK  140



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSE-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRA++YMVAQ LGAICG GLVK
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVK  141



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   212 bits (540),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 127/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCL AICG GLVK
Sbjct  117  VSLIRAIMYMVAQCLSAICGVGLVK  141



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+EGA   E+A+ KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIEGAEHGEFAS-KDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+Y+VAQCLGAICG GLVK
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVGLVK  140



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E     A A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVR V+Y+VAQCLGAICGCGLVK
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVK  144



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA+MYMVAQCLGAICG GLVK
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVK  144



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   212 bits (539),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 128/146 (88%), Gaps = 7/146 (5%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDSEVGGGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRA++YMVAQ LGAICG GLVK
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVK  141



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDV     ++  KDY DPPPAP+ D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEQGSFSG-KDYHDPPPAPVFDTAELGKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YKSQTD  +  G D+CGGVGILGIAWAFGGMIFILVYCT GISGGHINPAVTFGL LARK
Sbjct  60   YKSQTDATLNAGADQCGGVGILGIAWAFGGMIFILVYCTGGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMY+VAQCLGAICG GLVK
Sbjct  120  VSLVRAVMYIVAQCLGAICGVGLVK  144



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            M KD+E G     + KDY DPPP PLID EE GKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDIEVGPQGGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL RAV+Y+VAQ LGAICGCGLVK
Sbjct  120  VSLPRAVLYIVAQSLGAICGCGLVK  144



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 8/151 (5%)
 Frame = +3

Query  87   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KD+E      G  E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  249  vltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  425
            VLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG
Sbjct  60   VLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  119

Query  426  LFLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LF+ RKVSL+RA++YMVAQCLGAICGCGLVK
Sbjct  120  LFVGRKVSLIRALLYMVAQCLGAICGCGLVK  150



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVK  144



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+EGA     A KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV+Y+VAQCLGAICG GLVK
Sbjct  116  VSLIRAVLYIVAQCLGAICGVGLVK  140



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVEGA   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+Y++AQCLGAICG GLVK
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVK  140



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+E A   EY A KDY DPPPAPL+D EEL KWS YRA IAEFIAT+LFLYVTVLTV
Sbjct  1    MAKDIEVAEQGEYTA-KDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLTV  59

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA +Y+VAQCLGAICG GLVK
Sbjct  120  RKVSLVRAFLYIVAQCLGAICGVGLVK  146



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE  + E    +DYQDPPPAPL DP EL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++YMVAQCLGAICG G VK
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVK  144



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICG G VK
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV+YMVAQCLGAICG GLVK
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVK  144



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD++   + A P KDYQDPPPAPL D  EL +WSFYRA+IAEF+ATLLFLYVTV TVI
Sbjct  1    MAKDIQTEPQTALPNKDYQDPPPAPLFDTSELSQWSFYRALIAEFVATLLFLYVTVATVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY SQTDP   GT  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNSQTDPAHNGT-ACDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA++YMV QCLGAICG GLVK
Sbjct  120  VSLIRAILYMVVQCLGAICGVGLVK  144



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV+YMVAQCLGAICG GLVK
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVK  144



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQC GAICG GL K
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAK  146



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQC GAICG GL K
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAK  146



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV+YMVAQCLGAICG GLVK
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVK  144



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  Y A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGYQA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICG G VK
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 126/148 (85%), Gaps = 5/148 (3%)
 Frame = +3

Query  87   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE A    EYA  KDY DPPPAPL D EEL KWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGHGEYAV-KDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  258  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            VIGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            ARKVSL+RA++YM+ QCLGAICG GLVK
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVGLVK  147



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDAKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVK  142



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICG G VK
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVK  142



>gb|KFK34721.1| hypothetical protein AALP_AA5G183600 [Arabis alpina]
Length=286

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDY DPPP P+ D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGENRSFSGKDYHDPPPEPIFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +L+RAVMYMVAQCLGAICG  LVK
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVK  143



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQC GAICG GL K
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAK  146



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQC GAICG GL K
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAK  146



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 129/152 (85%), Gaps = 8/152 (5%)
 Frame = +3

Query  84   KMAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  245
             M KD+E      G  E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYV
Sbjct  29   NMTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYV  87

Query  246  tvltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  422
            TVLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  88   TVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  147

Query  423  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVK
Sbjct  148  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVK  179



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGA+CG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAMCGVGLVK  142



>ref|XP_009103935.1| PREDICTED: probable aquaporin PIP2-5 [Brassica rapa]
Length=286

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGG+IFILVYCT GISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGLIFILVYCTVGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRAVMYMVAQCLGAICG  LVK
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVK  143



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 8/148 (5%)
 Frame = +3

Query  87   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E    GAT   A +DY DPPPAPL+D EE GKWS YRA+IAEF+ TLLFLYV+VL
Sbjct  1    MAKDLEVQEGGAT---AARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVL  57

Query  255  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            TVIGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            ARKVSLVR V+Y+VAQCLGAICGCGLVK
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGLVK  144



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE    E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVPGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++YMVAQCLGAICG G VK
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVK  144



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 128/147 (87%), Gaps = 9/147 (6%)
 Frame = +3

Query  87   MAKDVEG---ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKD+EG   A EY A KDY DPPPAPLID EEL KWS YRA+IAEF ATLLFLY+TVLT
Sbjct  1    MAKDIEGGAAAHEYGA-KDYHDPPPAPLIDSEELTKWSLYRAVIAEFTATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQS-----AADGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRAV+Y++AQCLGAICGCGLVK
Sbjct  115  RKVSLVRAVLYIIAQCLGAICGCGLVK  141



>gb|EPS68613.1| hypothetical protein M569_06155, partial [Genlisea aurea]
Length=280

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 7/146 (5%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KD+E   + EY   KDY DPPPAPLIDPEEL KWS YRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MTKDLEVGRSGEYGHAKDYHDPPPAPLIDPEELVKWSLYRAVIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ       TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQF-----ATDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRA +Y+VAQCLGAICGCGLVK
Sbjct  116  KVSLVRAFLYIVAQCLGAICGCGLVK  141



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +3

Query  87   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KDVE A E      KDY DPPPA LID EE+ KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEGGEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVATV  60

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQCLGAICG GLVK
Sbjct  121  RKVSLVRALLYMIAQCLGAICGVGLVK  147



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 128/148 (86%), Gaps = 6/148 (4%)
 Frame = +3

Query  87   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            M KDVE     A EY+A KDY DPPPAPLID +EL  WSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVESHVEPAEEYSA-KDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVL  59

Query  255  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            TVIGYKSQ DP   G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL
Sbjct  60   TVIGYKSQIDP-AHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFL  118

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
             RKVSL+RAV+YMVAQCLGAICG GLVK
Sbjct  119  GRKVSLIRAVLYMVAQCLGAICGVGLVK  146



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVEGA     A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV+Y++AQCLGAICG GLVK
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVK  140



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAI G GLVK
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVK  144



>ref|XP_010427203.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=286

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG  LVK
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVK  143



>ref|XP_010516024.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=286

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG  LVK
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVK  143



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA+MYMVAQCLGAICG GLVK
Sbjct  117  SLIRALMYMVAQCLGAICGVGLVK  140



>gb|ACV70050.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 4/131 (3%)
 Frame = +3

Query  129  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  305
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  306  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQC  485
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  486  LGAICGCGLVK  518
            LGAICGCGLVK
Sbjct  118  LGAICGCGLVK  128



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD+E A  +   KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MAKDIEAAAAHEG-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  59

Query  267  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            YK QTD    G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFLARK
Sbjct  60   YKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++Y+VAQCLGAICG GLVK
Sbjct  120  VSLVRALLYIVAQCLGAICGVGLVK  144



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M KD EG  E +A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDFEGGGELSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+QTD +  G  ECGGVGILGIAWAFGGM FILVYCTAGISG HINPAVTFGLFLARKV
Sbjct  60   YKNQTDVHKNG-HECGGVGILGIAWAFGGMNFILVYCTAGISGRHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRA++YMVAQCL AICGCGLVK
Sbjct  119  SLVRAILYMVAQCLWAICGCGLVK  142



>ref|NP_191042.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
 sp|Q9SV31.1|PIP25_ARATH RecName: Full=Probable aquaporin PIP2-5; AltName: Full=Plasma 
membrane intrinsic protein 2-5; Short=AtPIP2;5; AltName: Full=Plasma 
membrane intrinsic protein 2d; Short=PIP2d; Contains: 
RecName: Full=Probable aquaporin PIP2-5, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAK44166.1|AF370351_1 putative aquaporin/MIP protein [Arabidopsis thaliana]
 emb|CAB41102.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAL34155.1| putative aquaporin/MIP protein [Arabidopsis thaliana]
 gb|AAM61408.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAN31817.1| putative aquaporin/plasma membrane intrinsic protein [Arabidopsis 
thaliana]
 gb|AEE79295.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
Length=286

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVT++TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRAVMYMVAQCLGAICG  LVK
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVK  143



>gb|AFQ23567.1| aquaporin PIP2;2 [Eustoma exaltatum subsp. russellianum]
Length=287

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK V     + A KDY +PPP PL D EELGKWSFYRA+IAEFIA+LLFLY+ V TVIG
Sbjct  1    MAKQVSENGSFEA-KDYHEPPPTPLFDREELGKWSFYRALIAEFIASLLFLYIGVTTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            + +Q+DP +   D+CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   HSNQSDPTLHPGDQCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAVMYM+AQCLGAICG GL K
Sbjct  120  SLIRAVMYMMAQCLGAICGAGLAK  143



>ref|XP_006436426.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 gb|ESR49666.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=206

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 124/146 (85%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  1    MAKDT-GVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRAVMYMVAQCLGAI G GLVK
Sbjct  119  KVSLVRAVMYMVAQCLGAISGVGLVK  144



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQC GAICG GL K
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAK  145



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E G     + KDYQDPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQ LGAI G  LVK
Sbjct  120  VSLVRAVMYMVAQSLGAIAGVALVK  144



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQC GAICG GL K
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAK  145



>gb|AGD98705.1| aquaporin [Camellia sinensis]
Length=283

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK VE   E   + KDY+DPPPAPL+DP+ELGKWSFYRA+IAEFIATLLFLY+T+LTVI
Sbjct  1    MAKGVEVVEEGTFSAKDYEDPPPAPLMDPKELGKWSFYRALIAEFIATLLFLYITILTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+      TD+CGGVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQS-----ATDDCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAV YM+AQCLGAICG GLVK
Sbjct  116  VSLIRAVSYMIAQCLGAICGVGLVK  140



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK QTD  V GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQC GAICG GL K
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAK  145



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 10/152 (7%)
 Frame = +3

Query  87   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  248
            M KD+E      G  E++A KDY DPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  249  vltvIGYKSQTDPNVKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  422
            VLTVIGYK QTDP VK T++  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  60   VLTVIGYKVQTDP-VKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118

Query  423  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVK
Sbjct  119  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVK  150



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 124/144 (86%), Gaps = 6/144 (4%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V     Y A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKEVAEHGSYGA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+       D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS-----AADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  114

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG GLVK
Sbjct  115  SLVRAVMYMVAQCLGAICGVGLVK  138



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 129/149 (87%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E     A E++A KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  255  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSLVRA++Y+VAQCLGAICG GLVK
Sbjct  120  LARKVSLVRALLYIVAQCLGAICGVGLVK  148



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK DVEG +  A  KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>gb|ACV70048.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 4/131 (3%)
 Frame = +3

Query  129  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  305
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYVDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  306  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQC  485
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  486  LGAICGCGLVK  518
            LGAICGCGLVK
Sbjct  118  LGAICGCGLVK  128



>gb|AAG44947.1|AF290620_1 putative PIP2 [Nicotiana glauca]
Length=284

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+V G+      KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNV-GSEGSFTTKDYQDPPPAPLIDPVELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSATT---TDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAVMYMVAQCLGAICG GLVK
Sbjct  117  SLIRAVMYMVAQCLGAICGVGLVK  140



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 129/149 (87%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E     A E++A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  255  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSLVRA++Y++AQCLGAICG GLVK
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVK  148



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  + A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFPA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RAV+YMVAQCLGAICG G VK
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_010507447.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=322

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAVMYMVAQCLGAICG  LVK
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVK  143



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDVEGA-EGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICG G VK
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVK  142



>emb|CDX73446.1| BnaC08g25570D [Brassica napus]
Length=286

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKGSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +L+RAVMYMVAQCLGAICG  LVK
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVK  143



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  255  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSL+RAV+Y++AQCLGAICG GLVK
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVK  148



>ref|XP_009116159.1| PREDICTED: probable aquaporin PIP2-5 [Brassica rapa]
 emb|CDX78265.1| BnaA09g34600D [Brassica napus]
Length=286

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKGSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +L+RAVMYMVAQCLGAICG  LVK
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVK  143



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK+Q+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKNQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA+MYMVAQCLGAICG GLVK
Sbjct  117  SLIRALMYMVAQCLGAICGVGLVK  140



>ref|XP_009413716.1| PREDICTED: probable aquaporin PIP2-3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 124/147 (84%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD E  G  EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YMVAQCLGAICG GLVK
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVGLVK  146



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ D +    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGS---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVK  142



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  255  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSL+RAV+Y++AQCLGAICG GLVK
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVK  148



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 127/149 (85%), Gaps = 6/149 (4%)
 Frame = +3

Query  87   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E     A E++A KDY DPPPAPLID EEL KWS YRA IAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVA  59

Query  255  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  431
            TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  432  LARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            LARKVSLVRAV+Y++AQCLGAICG GLVK
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVK  148



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M+KD+E      A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL+RA++YMVAQCLGAICGC LVK
Sbjct  118  SLIRAILYMVAQCLGAICGCALVK  141



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEG-ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE  A E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVAGEGFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
             YK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   CYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRA++YMVAQCLGAICG G V+
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVQ  144



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE  TE   Y+A KDY DPPPAPLI P+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YM+AQC GAICG GL K
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAK  146



>gb|ABH09328.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A       KDY D PPAPL+ PEELG WSFYRAII+EF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDSPPAPLVYPEELGSWSFYRAIISEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYK+QTDP   G +EC GVGILGIAWAFGG+IFILVYCTAGISGGHINPAVTFG+FLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGVIFILVYCTAGISGGHINPAVTFGVFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAVMYMVAQC GAICGCGLVK
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVK  144



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVEGA   E+AA KDY DPPP PL D +EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+Y+VAQ LGAICG GLVK
Sbjct  115  KVSLLRAVLYIVAQSLGAICGVGLVK  140



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +3

Query  87   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAK D EG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDAEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAICG GLVK
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVK  142



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 124/147 (84%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD E  G  EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSLVRA++YMVAQCLGAICG GLVK
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVGLVK  146



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+VEGA  +A+ +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICG G VK
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKDVEGA  +AA +DYQDPPP P  D EEL +WS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTTAGGV-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            +LVRA++YMVAQCLGAICG G VK
Sbjct  119  TLVRALLYMVAQCLGAICGVGFVK  142



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RA+MYMVAQCLGAI G GLVK
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVK  144



>gb|KDO44717.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=256

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 124/146 (85%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  51   MAKD-TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  109

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  110  IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  168

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRAVMYMVAQCLGAI G GLVK
Sbjct  169  KVSLVRAVMYMVAQCLGAISGVGLVK  194



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 126/150 (84%), Gaps = 7/150 (5%)
 Frame = +3

Query  87   MAKDVEGAT-----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  251
            MAKD+E A      EY A KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV
Sbjct  1    MAKDIEAAAAPEGGEYTA-KDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITV  59

Query  252  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  428
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGL  119

Query  429  FLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            FLARKVSLVRA++Y+VAQCLGAICG GLVK
Sbjct  120  FLARKVSLVRALLYIVAQCLGAICGVGLVK  149



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 127/146 (87%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M KDVE A   E++A KDY DPPPAPLID  EL  WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEVAEHGEFSA-KDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAVMYMVAQCLGAICG G VK
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGFVK  140



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAV+YMVAQ LGAI G  LVK
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVK  144



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 8/146 (5%)
 Frame = +3

Query  87   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE A   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+Y++AQCLGAICG GLVK
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVK  140



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD++   E  AP  +DY+DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVR V+Y+VAQCLGAICGCGLVK
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVK  144



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD++   E  AP  +DY+DPPPAPL+D EELGKWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  13   MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVLTV  71

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  72   IGYKAQTDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  130

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVR V+Y+VAQCLGAICGCGLVK
Sbjct  131  KVSLVRTVLYIVAQCLGAICGCGLVK  156



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            M KDVE A   + + KDY DPPP PLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDVEVAEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GY+SQTD    G D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYRSQTDQAHNGGD-CEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL+RAVMYMVAQCLGAICG GLVK
Sbjct  120  VSLIRAVMYMVAQCLGAICGVGLVK  144



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 6/145 (4%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            M+KDVE A + A + KDY DPPPA LID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MSKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQT      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTT-----TDPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSL RAV+YMVAQCLGAICG GLVK
Sbjct  116  VSLFRAVLYMVAQCLGAICGVGLVK  140



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 127/147 (86%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            M K+VE A E AA    KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RAV+YMVAQCLGAICG GLVK
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVGLVK  146



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  87   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  263
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  264  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  443
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  444  VSLVRAVMYMVAQCLGAICGCGLVK  518
            VSLVRAV+YMVAQ LGAI G  LVK
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVK  144



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQC GAICG GL K
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAK  145



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++YMVAQC GAICG GL K
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAK  145



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+VEGA  +A  +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAT-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICG G VK
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 127/146 (87%), Gaps = 3/146 (2%)
 Frame = +3

Query  87   MAKDVEG--ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVEG  A E    +DY DPPPA L+D EEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGGVAGEGFPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTD    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  61   IGYKSQTDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KV+LVRA++YMVAQCLGAICG GLVK
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVK  145



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            M+KD+E      A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SL RA++YMVAQCLGAICGC LVK
Sbjct  118  SLTRAILYMVAQCLGAICGCALVK  141



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 129/148 (87%), Gaps = 8/148 (5%)
 Frame = +3

Query  87   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  254
            MAKD+E    GAT   A +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV++L
Sbjct  1    MAKDLEVQEGGAT---AARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSIL  57

Query  255  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  434
            TVIGYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDASAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  435  ARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            ARKVSLVR V+Y+VAQCLGAICGCG VK
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGFVK  144



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 132/146 (90%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+E  G  E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVRAVMYMVAQCLGAICGCGLVK
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVK  144



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 127/146 (87%), Gaps = 4/146 (3%)
 Frame = +3

Query  87   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RA+MYMVAQCLGAICG GLVK
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVK  144



>ref|XP_004157526.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33483.1| plasma intrinsic protein 2-7 [Cucumis sativus]
 gb|KGN52272.1| hypothetical protein Csa_5G623360 [Cucumis sativus]
Length=287

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAKD        + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTTARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            Y SQTD +  G + C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YNSQTDTDKPGANACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV YMVAQCLGA+CG GLVK
Sbjct  121  SLVRAVAYMVAQCLGAVCGAGLVK  144



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 3/147 (2%)
 Frame = +3

Query  87   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RA++Y++AQCLGAICG GLVK
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVK  147



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 130/147 (88%), Gaps = 9/147 (6%)
 Frame = +3

Query  87   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  257
            MAK+VE    A E+AA KDY DPPPAPLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECAEPAAEFAA-KDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  258  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            VIGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQSE-----YDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RKVSL+RAV+YMVAQCLGAICG G VK
Sbjct  115  RKVSLIRAVLYMVAQCLGAICGVGFVK  141



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 128/152 (84%), Gaps = 9/152 (6%)
 Frame = +3

Query  87   MAKDVEGAT-------EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  245
            MAKD+E A        EY A KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+
Sbjct  1    MAKDIEAAAAAHGGGGEYTA-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYI  59

Query  246  tvltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  422
            TV TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTF
Sbjct  60   TVATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTF  119

Query  423  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVK  518
            GLFLARKVSLVRA++Y+VAQCLGAICG GLVK
Sbjct  120  GLFLARKVSLVRALLYIVAQCLGAICGVGLVK  151



>gb|ACV70051.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=223

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 4/130 (3%)
 Frame = +3

Query  132  DYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTDE  308
            DY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D+
Sbjct  1    DYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---ADQ  57

Query  309  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  488
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQCL
Sbjct  58   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQCL  117

Query  489  GAICGCGLVK  518
            GAICGCGLVK
Sbjct  118  GAICGCGLVK  127



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 3/146 (2%)
 Frame = +3

Query  87   MAKD--VEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKD  V+     AA +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSLVR V+Y+VAQCLGAICGCGLVK
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVK  145



>emb|CDX74984.1| BnaA05g07300D [Brassica napus]
Length=310

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +3

Query  87   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  266
            MAK+VEGA  +A+ +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  267  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  446
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  447  SLVRAVMYMVAQCLGAICGCGLVK  518
            SLVRAV+YMVAQCLGAICG G VK
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVK  142



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +3

Query  87   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            MAKDVE  G  EY   KDY DPPP PL+D EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDVEAGGRGEYGG-KDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  261  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  437
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  438  RKVSLVRAVMYMVAQCLGAICGCGLVK  518
            RK+SLVRA++YM+AQCLGAICG GLVK
Sbjct  120  RKISLVRALLYMIAQCLGAICGVGLVK  146



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = +3

Query  87   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  260
            M K+VE  TE    + KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+T+LTV
Sbjct  1    MTKEVESVTERGEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILTV  60

Query  261  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  440
            IGY+ Q D +  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYQHQADVDAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  441  KVSLVRAVMYMVAQCLGAICGCGLVK  518
            KVSL+RAV+YMVAQCLGAICG G VK
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVK  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000