BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028L23

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07923.1|  unnamed protein product                                207   7e-61   Coffea canephora [robusta coffee]
ref|XP_010654914.1|  PREDICTED: UBX domain-containing protein 2 i...    194   8e-56   Vitis vinifera
ref|XP_003631347.1|  PREDICTED: UBX domain-containing protein 2 i...    194   1e-55   Vitis vinifera
ref|XP_011070500.1|  PREDICTED: UBX domain-containing protein 2         191   2e-54   Sesamum indicum [beniseed]
ref|XP_004236895.1|  PREDICTED: UBX domain-containing protein 2         191   3e-54   Solanum lycopersicum
ref|XP_010654910.1|  PREDICTED: UBX domain-containing protein 2 i...    188   2e-53   Vitis vinifera
gb|EYU30238.1|  hypothetical protein MIMGU_mgv1a006061mg                188   3e-53   Erythranthe guttata [common monkey flower]
ref|XP_006355016.1|  PREDICTED: UBX domain-containing protein 2-like    187   3e-53   Solanum tuberosum [potatoes]
ref|XP_008220982.1|  PREDICTED: UBX domain-containing protein 2 i...    186   2e-52   Prunus mume [ume]
ref|XP_008220984.1|  PREDICTED: UBX domain-containing protein 2 i...    186   2e-52   Prunus mume [ume]
ref|XP_009587838.1|  PREDICTED: UBX domain-containing protein 2         184   7e-52   Nicotiana tomentosiformis
gb|EYU30240.1|  hypothetical protein MIMGU_mgv1a006061mg                183   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_002311564.2|  hypothetical protein POPTR_0008s14230g             183   1e-51   
gb|EYU30239.1|  hypothetical protein MIMGU_mgv1a006061mg                183   2e-51   Erythranthe guttata [common monkey flower]
gb|EYU30237.1|  hypothetical protein MIMGU_mgv1a006061mg                183   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_002315828.1|  UBX domain-containing family protein               182   2e-51   
ref|XP_006378421.1|  hypothetical protein POPTR_0010s10910g             183   2e-51   
ref|XP_010043889.1|  PREDICTED: UBX domain-containing protein 2 i...    182   6e-51   Eucalyptus grandis [rose gum]
ref|XP_010043888.1|  PREDICTED: UBX domain-containing protein 2 i...    181   8e-51   Eucalyptus grandis [rose gum]
ref|XP_009351643.1|  PREDICTED: UBX domain-containing protein 2 i...    181   9e-51   Pyrus x bretschneideri [bai li]
ref|XP_010270775.1|  PREDICTED: UBX domain-containing protein 2 i...    181   9e-51   Nelumbo nucifera [Indian lotus]
ref|XP_011025166.1|  PREDICTED: UBX domain-containing protein 7-like    181   1e-50   Populus euphratica
ref|XP_009351644.1|  PREDICTED: UBX domain-containing protein 2 i...    181   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_009351642.1|  PREDICTED: UBX domain-containing protein 2 i...    181   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010270774.1|  PREDICTED: UBX domain-containing protein 2 i...    180   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010270773.1|  PREDICTED: UBX domain-containing protein 2 i...    180   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009775836.1|  PREDICTED: UBX domain-containing protein 2         179   5e-50   Nicotiana sylvestris
gb|AFK39103.1|  unknown                                                 172   8e-50   Lotus japonicus
ref|XP_004509607.1|  PREDICTED: UBX domain-containing protein 7-like    174   4e-48   Cicer arietinum [garbanzo]
ref|XP_011021683.1|  PREDICTED: UBX domain-containing protein 2-like    172   2e-47   Populus euphratica
ref|XP_010680042.1|  PREDICTED: UBX domain-containing protein 2         171   8e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB30688.1|  hypothetical protein B456_005G158000                    169   1e-46   Gossypium raimondii
ref|XP_010088526.1|  UBX domain-containing protein 2                    171   1e-46   Morus notabilis
ref|XP_007045357.1|  UBX domain-containing protein isoform 2            170   1e-46   
gb|KJB30689.1|  hypothetical protein B456_005G158000                    170   1e-46   Gossypium raimondii
ref|XP_007045358.1|  UBX domain-containing protein isoform 3            170   1e-46   
ref|XP_007045356.1|  UBX domain-containing protein isoform 1            170   1e-46   
gb|KJB30687.1|  hypothetical protein B456_005G158000                    170   2e-46   Gossypium raimondii
gb|KHG06883.1|  UBX domain-containing 7                                 170   2e-46   Gossypium arboreum [tree cotton]
gb|KDO53548.1|  hypothetical protein CISIN_1g013325mg                   164   2e-46   Citrus sinensis [apfelsine]
gb|KJB30690.1|  hypothetical protein B456_005G158000                    169   2e-46   Gossypium raimondii
gb|EPS73806.1|  hypothetical protein M569_00949                         169   4e-46   Genlisea aurea
gb|KDO53547.1|  hypothetical protein CISIN_1g013325mg                   164   1e-45   Citrus sinensis [apfelsine]
ref|XP_003547850.1|  PREDICTED: UBX domain-containing protein 7-l...    167   2e-45   Glycine max [soybeans]
gb|KDP38216.1|  hypothetical protein JCGZ_04859                         167   2e-45   Jatropha curcas
ref|XP_006420698.1|  hypothetical protein CICLE_v10005240mg             164   3e-45   
ref|XP_002521873.1|  UBX domain-containing protein, putative            166   4e-45   
ref|XP_006470883.1|  PREDICTED: UBX domain-containing protein 2-like    164   1e-44   Citrus sinensis [apfelsine]
gb|KDO53543.1|  hypothetical protein CISIN_1g013325mg                   164   1e-44   Citrus sinensis [apfelsine]
gb|KDO53544.1|  hypothetical protein CISIN_1g013325mg                   164   1e-44   Citrus sinensis [apfelsine]
ref|XP_008456878.1|  PREDICTED: UBX domain-containing protein 2         162   9e-44   
ref|XP_003531952.1|  PREDICTED: UBX domain-containing protein 7-l...    162   1e-43   Glycine max [soybeans]
ref|XP_007156392.1|  hypothetical protein PHAVU_003G282600g             160   7e-43   Phaseolus vulgaris [French bean]
ref|XP_010554359.1|  PREDICTED: UBX domain-containing protein 2-like    159   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_003628976.1|  UBX domain-containing protein                      159   2e-42   Medicago truncatula
ref|XP_004160516.1|  PREDICTED: uncharacterized protein LOC101223406    151   5e-42   
ref|XP_010527851.1|  PREDICTED: UBX domain-containing protein 2 i...    155   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_010496241.1|  PREDICTED: UBX domain-containing protein 2-like    155   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010476513.1|  PREDICTED: UBX domain-containing protein 2-like    155   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010458959.1|  PREDICTED: UBX domain-containing protein 2-like    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010935375.1|  PREDICTED: UBX domain-containing protein 5 i...    151   6e-40   
emb|CDY69105.1|  BnaCnng61890D                                          152   9e-40   Brassica napus [oilseed rape]
ref|XP_010935374.1|  PREDICTED: UBX domain-containing protein 2 i...    151   1e-39   Elaeis guineensis
ref|XP_002890064.1|  UBX domain-containing protein                      152   1e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_008389122.1|  PREDICTED: UBX domain-containing protein 2-l...    151   1e-39   Malus domestica [apple tree]
ref|XP_008389121.1|  PREDICTED: UBX domain-containing protein 2-l...    151   1e-39   Malus domestica [apple tree]
ref|XP_008389120.1|  PREDICTED: UBX domain-containing protein 2-l...    151   1e-39   Malus domestica [apple tree]
ref|XP_004140414.1|  PREDICTED: UBX domain-containing protein 7-like    150   2e-39   Cucumis sativus [cucumbers]
ref|XP_006307428.1|  hypothetical protein CARUB_v10009052mg             150   4e-39   Capsella rubella
ref|NP_563954.1|  UBX domain-containing protein                         149   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416998.1|  hypothetical protein EUTSA_v10007578mg             148   2e-38   Eutrema salsugineum [saltwater cress]
emb|CDY45269.1|  BnaA06g09390D                                          146   1e-37   Brassica napus [oilseed rape]
ref|XP_009148836.1|  PREDICTED: UBX domain-containing protein 2         144   5e-37   Brassica rapa
ref|XP_008804300.1|  PREDICTED: UBX domain-containing protein 7         143   1e-36   Phoenix dactylifera
ref|XP_009401234.1|  PREDICTED: UBX domain-containing protein 2         142   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297788.1|  PREDICTED: UBX domain-containing protein 2 i...    140   2e-35   Fragaria vesca subsp. vesca
ref|XP_011463491.1|  PREDICTED: UBX domain-containing protein 2 i...    140   2e-35   Fragaria vesca subsp. vesca
ref|XP_007052064.1|  UBX domain-containing protein                      137   2e-34   
ref|XP_009398016.1|  PREDICTED: UBX domain-containing protein 2-like    127   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007045359.1|  UBX domain-containing protein isoform 4            124   1e-29   
gb|KHN06997.1|  UBX domain-containing protein 7                         123   2e-29   Glycine soja [wild soybean]
ref|NP_001077535.1|  UBX domain-containing protein                      123   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773267.1|  PREDICTED: uncharacterized protein LOC104223510    117   8e-29   Nicotiana sylvestris
ref|XP_009110537.1|  PREDICTED: UBX domain-containing protein 2-like    119   6e-28   Brassica rapa
gb|AFW59833.1|  hypothetical protein ZEAMMB73_017157                    110   3e-26   
gb|AEV41029.1|  putative UBX domain-containing protein                  112   2e-25   Oryza minuta
gb|AEV40978.1|  putative UBX domain-containing protein                  112   2e-25   Oryza punctata
tpg|DAA35439.1|  TPA: hypothetical protein ZEAMMB73_856149              110   4e-25   
ref|XP_002447303.1|  hypothetical protein SORBIDRAFT_06g032400          110   4e-25   Sorghum bicolor [broomcorn]
gb|KGN50781.1|  hypothetical protein Csa_5G259710                       106   5e-25   Cucumis sativus [cucumbers]
ref|XP_008668717.1|  PREDICTED: UBX domain-containing protein 2-like    110   1e-24   
ref|NP_001170636.1|  uncharacterized protein LOC100384688               109   1e-24   Zea mays [maize]
ref|XP_004960126.1|  PREDICTED: UBX domain-containing protein 2-like    108   3e-24   Setaria italica
ref|XP_010240593.1|  PREDICTED: UBX domain-containing protein 7 i...    106   9e-24   
ref|XP_006855568.1|  hypothetical protein AMTR_s00044p00018360          106   2e-23   Amborella trichopoda
ref|XP_003580790.1|  PREDICTED: UBX domain-containing protein 2 i...    106   2e-23   Brachypodium distachyon [annual false brome]
gb|AEV41122.1|  putative UBX domain-containing protein                  103   1e-22   Oryza officinalis
gb|EEE61882.1|  hypothetical protein OsJ_16574                          102   5e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05667.1|  predicted protein                                      102   7e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAE02831.2|  OSJNBa0043A12.36                                       102   8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAF63167.1|AC010657_3  T5E21.7                                       102   8e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24728.1|  hypothetical protein MIMGU_mgv1a025994mg              99.4    2e-21   Erythranthe guttata [common monkey flower]
ref|XP_009601783.1|  PREDICTED: uncharacterized protein LOC104097...  94.7    1e-19   Nicotiana tomentosiformis
ref|XP_001758899.1|  predicted protein                                93.6    8e-19   
ref|XP_009759130.1|  PREDICTED: UBX domain-containing protein 7-like  85.9    2e-16   Nicotiana sylvestris
ref|XP_008342902.1|  PREDICTED: LOW QUALITY PROTEIN: membrane-ass...  83.6    4e-16   
ref|XP_006343881.1|  PREDICTED: UBX domain-containing protein 7-like  81.6    1e-14   Solanum tuberosum [potatoes]
ref|XP_009601784.1|  PREDICTED: uncharacterized protein LOC104097...  79.7    3e-14   Nicotiana tomentosiformis
ref|XP_010527852.1|  PREDICTED: UBX domain-containing protein 2 i...  79.7    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_008801336.1|  PREDICTED: UBX domain-containing protein 2-like  77.8    9e-14   
ref|XP_010325366.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  78.2    1e-13   
ref|XP_006414812.1|  hypothetical protein EUTSA_v10027208mg           77.4    3e-13   
ref|XP_010253434.1|  PREDICTED: UBX domain-containing protein 7-like  76.6    3e-13   Nelumbo nucifera [Indian lotus]
tpg|DAA35438.1|  TPA: hypothetical protein ZEAMMB73_856149            75.9    9e-13   
ref|XP_009599661.1|  PREDICTED: UBX domain-containing protein 7 h...  73.2    5e-12   Nicotiana tomentosiformis
emb|CDX84023.1|  BnaC08g16220D                                        72.8    1e-11   
ref|XP_009139538.1|  PREDICTED: UBX domain-containing protein 2       72.0    2e-11   Brassica rapa
ref|XP_006653862.1|  PREDICTED: UBX domain-containing protein 2-like  70.1    8e-11   
emb|CDY01207.1|  BnaA04g06120D                                        67.4    1e-09   
gb|AIE88273.1|  hypothetical protein OG_BBa0063K01.4                  66.2    2e-09   Oryza glaberrima
gb|KDO53545.1|  hypothetical protein CISIN_1g013325mg                 65.5    3e-09   Citrus sinensis [apfelsine]
ref|XP_010519462.1|  PREDICTED: UBX domain-containing protein 2-like  65.1    4e-09   Tarenaya hassleriana [spider flower]
gb|AEV41076.1|  putative UBX domain-containing protein                65.1    4e-09   Oryza minuta
ref|XP_006414811.1|  hypothetical protein EUTSA_v10027532mg           65.1    4e-09   
gb|EMT10976.1|  hypothetical protein F775_30110                       64.3    6e-09   
gb|EMS63720.1|  UBX domain-containing protein 7                       64.7    6e-09   Triticum urartu
gb|KFK22408.1|  hypothetical protein AALP_AAs65522U000100             63.5    1e-08   Arabis alpina [alpine rockcress]
gb|KDO48110.1|  hypothetical protein CISIN_1g021440mg                 62.8    2e-08   Citrus sinensis [apfelsine]
gb|KDO48111.1|  hypothetical protein CISIN_1g021440mg                 62.8    2e-08   Citrus sinensis [apfelsine]
ref|XP_006480638.1|  PREDICTED: UBX domain-containing protein 7-l...  60.8    3e-08   
ref|XP_006480636.1|  PREDICTED: UBX domain-containing protein 7-l...  61.2    5e-08   
ref|XP_006480637.1|  PREDICTED: UBX domain-containing protein 7-l...  60.8    5e-08   
ref|XP_006480635.1|  PREDICTED: UBX domain-containing protein 7-l...  60.8    6e-08   
ref|XP_003604178.1|  UBX domain-containing protein                    60.5    9e-08   Medicago truncatula
emb|CDY68911.1|  BnaAnng28760D                                        60.5    1e-07   Brassica napus [oilseed rape]
ref|XP_010436606.1|  PREDICTED: UBX domain-containing protein 2-like  59.7    2e-07   
ref|XP_010445452.1|  PREDICTED: UBX domain-containing protein 7       59.3    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006285935.1|  hypothetical protein CARUB_v10007447mg           57.4    1e-06   
ref|XP_010450078.1|  PREDICTED: UBX domain-containing protein 2-like  57.0    2e-06   Camelina sativa [gold-of-pleasure]
gb|KFK22146.1|  hypothetical protein AALP_AAs62910U000300             57.0    2e-06   Arabis alpina [alpine rockcress]
ref|NP_001054216.1|  Os04g0670800                                     55.5    6e-06   
emb|CDY12746.1|  BnaC04g28950D                                        55.5    6e-06   Brassica napus [oilseed rape]
gb|KGN50782.1|  hypothetical protein Csa_5G259720                     53.5    7e-06   Cucumis sativus [cucumbers]
ref|XP_006414754.1|  hypothetical protein EUTSA_v10027144mg           55.1    8e-06   
ref|XP_002868299.1|  predicted protein                                55.1    1e-05   
ref|XP_006414759.1|  hypothetical protein EUTSA_v10027233mg           54.7    1e-05   
ref|XP_002886675.1|  predicted protein                                53.9    2e-05   
ref|NP_193161.3|  UBX domain-containing pseudogene                    54.3    2e-05   
ref|NP_001190727.1|  UBX domain-containing pseudogene                 54.3    2e-05   
emb|CAB10204.1|  hypothetical protein                                 53.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139540.1|  PREDICTED: UBX domain-containing protein 7-like  52.4    8e-05   Brassica rapa
ref|XP_010519525.1|  PREDICTED: UBX domain-containing protein 2-like  51.6    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010490003.1|  PREDICTED: UBX domain-containing protein 2-like  51.6    1e-04   
emb|CDY01206.1|  BnaA04g06130D                                        51.2    2e-04   
ref|XP_009139539.1|  PREDICTED: UBX domain-containing protein 2-like  50.8    2e-04   Brassica rapa
gb|AGH62811.1|  UBX1                                                  50.1    4e-04   Brassica napus [oilseed rape]
emb|CDY12747.1|  BnaC04g28940D                                        50.1    4e-04   Brassica napus [oilseed rape]
gb|KEH28763.1|  structural constituent of ribosome protein            48.9    0.001   Medicago truncatula



>emb|CDP07923.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 8/176 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG LS ++QQ+LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+GG AA S+
Sbjct  1    MDGVLSPADQQSLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEGGAAASSA  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP LE+  P      S  SG+     D++ +QGD D+VRPPLPVIRDVLYD  ++ G  
Sbjct  61   QSPQLESDLP--LDDPSLRSGTRTDLEDQNIRQGDGDDVRPPLPVIRDVLYDNTMLFGAS  118

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
             MGGS+HEAR+VVPFRNFE+E+K PGVWET+  S      S  NLASLYRPPFALM
Sbjct  119  RMGGSSHEARAVVPFRNFEEELKRPGVWETENGSASTVDKSQYNLASLYRPPFALM  174



>ref|XP_010654914.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Vitis 
vinifera]
Length=453

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+ 
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDXASNSADNLASLYRPPFALM  609
              G  +HEA S+V FRNF+ EMK PG+WE     T  A NS DNLASLYRPPFALM
Sbjct  117  RGGYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALM  172



>ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Vitis 
vinifera]
 emb|CBI27509.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+ 
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDXASNSADNLASLYRPPFALM  609
              G  +HEA S+V FRNF+ EMK PG+WE     T  A NS DNLASLYRPPFALM
Sbjct  117  RGGYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALM  172



>ref|XP_011070500.1| PREDICTED: UBX domain-containing protein 2 [Sesamum indicum]
Length=453

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 128/177 (72%), Gaps = 11/177 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS ++QQ LV+SFLEIAVG++A+TARQFLQAT WKLEEA+QLFYVGN+G +A PS 
Sbjct  3    MEGVLSPTDQQKLVSSFLEIAVGETAETARQFLQATGWKLEEAIQLFYVGNEGRIATPSV  62

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            YS P E+  P       S    +     + + + D ++VRPPLPV RDVLYD  ++ G  
Sbjct  63   YSPPTESDLP----LNDSNLSELGKELVDKDVRQDGEDVRPPLPVKRDVLYDNRMLYGGA  118

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
             +GGS++ + +VVPFRNFE+EMKHPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  119  RLGGSSYASHTVVPFRNFEEEMKHPGVWEAEEGSSSSVADKTQDNLASLYRPPFALM  175



>ref|XP_004236895.1| PREDICTED: UBX domain-containing protein 2 [Solanum lycopersicum]
Length=466

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 129/175 (74%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+GG AA  +
Sbjct  1    MDGVMSASDQQMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNEGGAAASFN  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
               L N A        S+SG    S D +  QGD D+VRPPLPV R+VLYD AV+ G   
Sbjct  61   SPQLGNDA---LLGDPSLSGVGNDSADTNLLQGDGDDVRPPLPVKREVLYDNAVLYGSSG  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MGGS+ E R VVPFRNFE+EMKHPGVWE +  S S      DNLASLYRPPFALM
Sbjct  118  MGGSSREPRLVVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALM  172



>ref|XP_010654910.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Vitis 
vinifera]
Length=454

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 131/178 (74%), Gaps = 16/178 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVI--RG  450
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++  RG
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLVSRG  116

Query  451  LPAMGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDXASNSADNLASLYRPPFALM  609
                G  +HEA S+V FRNF+ EMK PG+WE     T  A NS DNLASLYRPPFALM
Sbjct  117  ----GYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALM  170



>gb|EYU30238.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 10/177 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G+ 
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGVQ  119

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
             +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  120  RVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALM  176



>ref|XP_006355016.1| PREDICTED: UBX domain-containing protein 2-like [Solanum tuberosum]
Length=462

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 129/175 (74%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+ G AA  +
Sbjct  1    MDGVMSASDQQMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNESGAAAFFN  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
               L N A        S+SG +  S D +  QGD D+VRPPLPV R+VLYD AV+ G   
Sbjct  61   SPQLGNDA---LLGDPSLSGVVNDSVDTNLVQGDGDDVRPPLPVKREVLYDNAVLYGSSG  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MGGS+ E R VVPFRNFE+EMKHPGVWE +  S S      DNLASLYRPPFALM
Sbjct  118  MGGSSREPRLVVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALM  172



>ref|XP_008220982.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Prunus 
mume]
Length=456

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SA++QQ LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++
Sbjct  1    MDGVISANDQQRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AA  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P 
Sbjct  60   QPPTENIDHLADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPR  119

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDXASNSADNLASLYRPPFALM  609
               S HE+ SV+ FRNFE+EMKHPGVWE     T  A  + DNLASLYRPPF L+
Sbjct  120  ARFSQHESGSVIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLL  174



>ref|XP_008220984.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Prunus 
mume]
Length=454

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SA++QQ LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++
Sbjct  1    MDGVISANDQQRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AA  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P 
Sbjct  60   QPPTENIDHLADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPR  119

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDXASNSADNLASLYRPPFALM  609
               S HE+ SV+ FRNFE+EMKHPGVWE     T  A  + DNLASLYRPPF L+
Sbjct  120  ARFSQHESGSVIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLL  174



>ref|XP_009587838.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana tomentosiformis]
Length=453

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SA++QQ LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  +
Sbjct  1    MDGVMSATDQQILVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFN  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             S L N A       SS+SG++K S D S  QGD D++RPPLPV R+VLYD AV+ G   
Sbjct  61   SSQLGNDA---LLGGSSLSGAVKESADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSG  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            +GGS+ E R VVPFRNFE+EMK PGVWE +  S S      DNLASLYRPPFALM
Sbjct  118  VGGSSREPRLVVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALM  172



>gb|EYU30240.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=437

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  453
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALM  177



>ref|XP_002311564.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
 gb|EEE88931.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
Length=455

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 124/175 (71%), Gaps = 11/175 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S
Sbjct  3    MEGMLSANDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASAS  62

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            + P   T              +K  G+E+   G  +EVR PLPV+RD LYD A++ G   
Sbjct  63   HPPQTET------RTDVHESGLKDFGNENVGPGGGEEVRAPLPVVRDTLYDDAMLYGASR  116

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MG   HEA S++ FRNF++EMKH GVWE+D  S S      DNLASLYRPPF LM
Sbjct  117  MGHPPHEASSLIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLM  171



>gb|EYU30239.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  453
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALM  177



>gb|EYU30237.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=459

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  453
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALM  177



>ref|XP_002315828.1| UBX domain-containing family protein [Populus trichocarpa]
 gb|EEF01999.1| UBX domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 18/175 (10%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S
Sbjct  1    MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            + P   T P             +   +E     D +EVR PLPV+RD LYD A++ G   
Sbjct  61   HPPPTETWP-------------EDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASR  107

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
             G   HEA S++ FRNF++EMKHPGVWE+D  S     NS DNLASLYRPPF LM
Sbjct  108  TGYPPHEASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLM  162



>ref|XP_006378421.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
 gb|ERP56218.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
Length=451

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 11/175 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S
Sbjct  1    MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            + P   T P        +   +K   +E     D +EVR PLPV+RD LYD A++ G   
Sbjct  61   HPPPTETWP------EVLESGLKDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASR  114

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
             G   HEA S++ FRNF++EMKHPGVWE+D  S     NS DNLASLYRPPF LM
Sbjct  115  TGYPPHEASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLM  169



>ref|XP_010043889.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85907.1| hypothetical protein EUGRSUZ_B02622 [Eucalyptus grandis]
Length=453

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS +E+Q++++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S
Sbjct  1    MESLLSPTEKQSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P  +       +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA
Sbjct  61   NPPPVDGG-NAACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPA  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
            +G  +HE+ S++ FRNF++EMK PGVWE+D  S     N+ DNLASLYRPPF LM
Sbjct  118  LGMGSHESSSLIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLM  172



>ref|XP_010043888.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Eucalyptus 
grandis]
Length=459

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS +E+Q++++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S
Sbjct  1    MESLLSPTEKQSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P  +       +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA
Sbjct  61   NPPPVDGG-NAACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPA  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
            +G  +HE+ S++ FRNF++EMK PGVWE+D  S     N+ DNLASLYRPPF LM
Sbjct  118  LGMGSHESSSLIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLM  172



>ref|XP_009351643.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=454

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S H   SV+ FRNFE+EMKHPGVWE+D  + S+     DNLASLYRPPF L+
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLL  173



>ref|XP_010270775.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MG  +HE  S++ FRNF++EMK PGVWE+D ++ S      DNLASLYRPPFALM
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALM  172



>ref|XP_011025166.1| PREDICTED: UBX domain-containing protein 7-like [Populus euphratica]
Length=455

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 120/175 (69%), Gaps = 11/175 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S
Sbjct  3    MEGMLSANDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASAS  62

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            + P   T      S     G+              +EVR PLPV+RD LYD A++ G   
Sbjct  63   HPPQTETRTDVHESGLKDFGNENVGPSGG------EEVRAPLPVVRDTLYDDAMLYGASR  116

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MG   HEA S++ FRNF++EMKH GVWE+D  S S      DNLASLYRPPF LM
Sbjct  117  MGHPPHEASSLIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLM  171



>ref|XP_009351644.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Pyrus 
x bretschneideri]
Length=452

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S H   SV+ FRNFE+EMKHPGVWE+D  + S+     DNLASLYRPPF L+
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLL  173



>ref|XP_009351642.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=457

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S H   SV+ FRNFE+EMKHPGVWE+D  + S+     DNLASLYRPPF L+
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLL  173



>ref|XP_010270774.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MG  +HE  S++ FRNF++EMK PGVWE+D ++ S      DNLASLYRPPFALM
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALM  172



>ref|XP_010270773.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            MG  +HE  S++ FRNF++EMK PGVWE+D ++ S      DNLASLYRPPFALM
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALM  172



>ref|XP_009775836.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana sylvestris]
Length=454

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG  SA++QQ LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  +
Sbjct  1    MDGVRSATDQQMLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFN  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
               L N A        S+SG++K   D S  QGD D++RPPLPV R+VLYD AV+ G   
Sbjct  61   SPELGNDA---LLGDPSLSGAVKDLADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSG  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            +GGS+ E R VVPFRNFE+EMK PGVWE +  S S      DNLASLYRPPFALM
Sbjct  118  VGGSSREPRLVVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALM  172



>gb|AFK39103.1| unknown [Lotus japonicus]
Length=195

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 123/177 (69%), Gaps = 9/177 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPS  276
            M+G LSA EQQ++V+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +GN+ G V  PS
Sbjct  1    MEGVLSAIEQQSMVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGNEAGAVPPPS  60

Query  277  SYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  453
            S++ PLEN          + S   K + +ES    D ++VRPPLPVIR+ LYD A++ G 
Sbjct  61   SHTPPLENA--DSWTDHQTSSEPRKDAANESSGHNDGEDVRPPLPVIRETLYDDAMLFGA  118

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
               G    E  ++V FRNFE+EM+ PGVWE+D  +     +S DNLASLYRPPF LM
Sbjct  119  SRFGQRPQEPNALVAFRNFEEEMRRPGVWESDQGAASTPESSRDNLASLYRPPFHLM  175



>ref|XP_004509607.1| PREDICTED: UBX domain-containing protein 7-like [Cicer arietinum]
Length=460

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 9/177 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPS  276
            M+G LS+++QQ+LV+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +G++ G V AP+
Sbjct  1    MEGMLSSNDQQSLVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGSETGAVPAPA  60

Query  277  SYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  453
            S++ PLEN     D SL S      G+       G  DEVRPP+PVIR+ LYD A++ G 
Sbjct  61   SFTPPLENVDAWTDQSLLSEPRKDTGNQSGGVNDG--DEVRPPIPVIRETLYDDAMLYGG  118

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            P +G  + E  S++ FRNFEQE + PGVWE++      A +S DNLASLYRPPF LM
Sbjct  119  PRLGHLSQEPSSLIAFRNFEQETRRPGVWESEQGAASTAESSRDNLASLYRPPFHLM  175



>ref|XP_011021683.1| PREDICTED: UBX domain-containing protein 2-like [Populus euphratica]
Length=457

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = +1

Query  112  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL  291
            LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFY+GN+GG    +S+   
Sbjct  2    LSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYLGNEGGAVESASHPLP  61

Query  292  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  471
              T P        +   +K   +E     D DEVR PLPV+RD LYD A++ G    G  
Sbjct  62   AETWP------EVLESGLKDLENEKVGHSDGDEVRAPLPVVRDTLYDDAMLYGASRTGYP  115

Query  472  AHEARSVVPFRNFEQEMKHPGVWETDXAS-----NSADNLASLYRPPFALM  609
              EA S++ FRNF++EMKHPGVWE+D  S     NS DNLASLYRPPF LM
Sbjct  116  PREASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLM  166



>ref|XP_010680042.1| PREDICTED: UBX domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=454

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS +++Q++V SFLEIAVGQ+ DTA QFLQAT WKLEEA+QLFYVG++GG  A SS
Sbjct  1    MEDILSPTDKQSMVTSFLEIAVGQTVDTAHQFLQATGWKLEEAIQLFYVGHEGGEMASSS  60

Query  280  Y-SPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            Y  P+EN  PL D S S     I     E       D+VRPPLPVIR+ LYD  ++ G  
Sbjct  61   YFPPVENATPLADKSSSGSDEGIAKELSEL---NGGDDVRPPLPVIREALYDDTMLYGAT  117

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G  +H   SVV FRNFE+EMKHP VWE++   +S      DNLA+LYRPPFA+M
Sbjct  118  RVGYPSHGPSSVVAFRNFEEEMKHPAVWESEQGGSSTTESSRDNLAALYRPPFAIM  173



>gb|KJB30688.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=408

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    ++ S++ FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>ref|XP_010088526.1| UBX domain-containing protein 2 [Morus notabilis]
 gb|EXB36443.1| UBX domain-containing protein 2 [Morus notabilis]
Length=486

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 120/177 (68%), Gaps = 8/177 (5%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPS  276
            M+G LSAS+QQ++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVG +GG V  PS
Sbjct  24   MEGMLSASDQQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGGEGGAVVEPS  83

Query  277  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            S+SP          + +      +   +      D DEVR PLPVIR+ LYD   I+   
Sbjct  84   SHSPPRENLDAFAENAAREEAERENRNENLGLD-DVDEVRAPLPVIREALYDDPSIQAAS  142

Query  457  AM-GGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
             M G  +HE+ SV+ FRNF +E++ PGVWE+D      A NS DNLASLYRPPF LM
Sbjct  143  RMLGYPSHESNSVIAFRNFGEEIRRPGVWESDQGAASTADNSRDNLASLYRPPFHLM  199



>ref|XP_007045357.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY01189.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
Length=454

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  1    MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  61   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    +  S V FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>gb|KJB30689.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=430

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    ++ S++ FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>ref|XP_007045358.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY01190.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
Length=451

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  1    MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  61   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    +  S V FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>ref|XP_007045356.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY01188.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
Length=479

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  26   MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  85

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  86   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  141

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    +  S V FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  142  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  197



>gb|KJB30687.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
 gb|KJB30691.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=453

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    ++ S++ FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>gb|KHG06883.1| UBX domain-containing 7 [Gossypium arboreum]
Length=453

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    ++ S++ FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>gb|KDO53548.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=238

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>gb|KJB30690.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=450

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  280  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
             +G    ++ S++ FRNF++EMK PGVWE+D  ++S      DNLASLYRPPF LM
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLM  172



>gb|EPS73806.1| hypothetical protein M569_00949, partial [Genlisea aurea]
Length=451

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 122/180 (68%), Gaps = 21/180 (12%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS+++QQ +V SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+ N+GG AA SS
Sbjct  2    MEAVLSSTDQQRMVTSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIENEGGSAAASS  61

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIR  447
            +S P EN  P  D S S +              G  D   +VRPPLP  RDVLYD  +  
Sbjct  62   FSFPPENDPPFKDLSRSELDKDF----------GSHDGGEDVRPPLPAKRDVLYDGLLPH  111

Query  448  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------DNLASLYRPPFALM  609
                M G+ + A SVVPFRNF++EM+HPGVWE +  S+S+      DNLASLYRPPFALM
Sbjct  112  NGERM-GTPYGAPSVVPFRNFQEEMRHPGVWEPERGSSSSMPTKPQDNLASLYRPPFALM  170



>gb|KDO53547.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=320

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
 gb|KHN44547.1| UBX domain-containing protein 7 [Glycine soja]
Length=467

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 117/182 (64%), Gaps = 12/182 (7%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG      
Sbjct  1    MEGVLSANEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPV  60

Query  280  YSPL-------ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTA  438
              P        EN     D    S       +  ES    D +EVRPPLPVIR+ LYD A
Sbjct  61   PPPPLLHTPPLENVDSWTDQQPLSEPRKDAAAASESIGLNDAEEVRPPLPVIRETLYDDA  120

Query  439  VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFA  603
            ++ G    G  +HE  S+V FRNFE+EM+ PGVWE++      A  S DNLASLYRPPF 
Sbjct  121  MLYGASRAGHRSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAEASRDNLASLYRPPFH  180

Query  604  LM  609
            LM
Sbjct  181  LM  182



>gb|KDP38216.1| hypothetical protein JCGZ_04859 [Jatropha curcas]
Length=454

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LSA+++Q +V+SFLEIAVGQ+A+TARQFLQATSWKLEEALQLFYVGND G  A +S
Sbjct  1    MEAMLSANDEQNMVSSFLEIAVGQTAETARQFLQATSWKLEEALQLFYVGNDVGPVASAS  60

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            +S P EN  P         +G +K   +++  Q   +EVR PLPV+RD LYD A+     
Sbjct  61   HSPPTENANP----WADENAGGVKDDENKNVGQDGGEEVRAPLPVVRDTLYDDAMFYRAY  116

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
              G    E+ S++ FRNFE+EMK PGVWE+D      A N  DNLASLY PPF LM
Sbjct  117  RTGYPPQESGSLIAFRNFEEEMKRPGVWESDQGATSTAENPRDNLASLYSPPFRLM  172



>ref|XP_006420698.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
 gb|ESR33938.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
Length=361

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPHHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis]
 gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis]
Length=452

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 115/176 (65%), Gaps = 19/176 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPS  276
            M+G LS +EQ ++VA FLEIA GQ+ADTA QFLQATSWKLEEALQLFYVGN+ G VA+ S
Sbjct  1    MEGILSDNEQ-SMVACFLEIAAGQTADTAIQFLQATSWKLEEALQLFYVGNETGQVASAS  59

Query  277  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
               PLEN               +K + +E   Q   D+VRPPLPV+RD LYD A+     
Sbjct  60   QSPPLENAG------------GLKDNENEKIGQNSADDVRPPLPVVRDTLYDDAMFYRTS  107

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
              G   HE+ S+V FRNF++EMK PGVWE+D  + S      DNLASLYRPP  LM
Sbjct  108  RTGYPPHESSSLVAFRNFDEEMKRPGVWESDQGATSTADTARDNLASLYRPPLHLM  163



>ref|XP_006470883.1| PREDICTED: UBX domain-containing protein 2-like [Citrus sinensis]
Length=444

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>gb|KDO53543.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=444

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>gb|KDO53544.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=445

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                 HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164



>ref|XP_008456878.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456880.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456881.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
Length=450

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 114/175 (65%), Gaps = 6/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+ GVA P S
Sbjct  1    MEGVLSATDKQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEAGVAGPPS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
                  T    + S    S                DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   VPSPPRTNEQINSSTDHTSNVSGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-T  119

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWET-----DXASNSADNLASLYRPPFALM  609
            MG   +E+ S + FRN + E+KH  VWE+       + NS DNLASLYRPP+ LM
Sbjct  120  MGYLPNESGSSIGFRNLQNEVKHHDVWESGDGAASTSGNSRDNLASLYRPPYHLM  174



>ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
Length=468

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 114/183 (62%), Gaps = 13/183 (7%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG      
Sbjct  1    MEGVLSANEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPV  60

Query  280  YSPL-------ENTAPlpdpslssisgsikgsgdesekQ-GDRDEVRPPLPVIRDVLYDT  435
              P        EN     D    S       +         D +EVRPPLPVIR+ LYD 
Sbjct  61   PPPPLLHTPPLENVDSWTDQQPLSEPRKDAAAAASESIDLNDAEEVRPPLPVIRETLYDD  120

Query  436  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPF  600
            A++ G       +HE  S+V FRNFE+EM+ PGVWE++      A  S DNLASLYRPPF
Sbjct  121  AMLYGASRASHRSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAETSRDNLASLYRPPF  180

Query  601  ALM  609
             LM
Sbjct  181  HLM  183



>ref|XP_007156392.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
 gb|ESW28386.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
Length=461

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS +EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++ G   P +
Sbjct  1    MEGVLSTNEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSESGAVPPPT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
                                    +  ES    + DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   LHTPPLENVDSWTDQPPSEPRKDATASESVGLNEADEVRPPLPVIRETLYDDAMLYGASR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            +G  + E  ++V FRNFE+EM++PGVWE +      A  S DNLASLYRPPF LM
Sbjct  121  VGHRSQEPSTLVAFRNFEEEMRNPGVWEPEQGAASTAETSRDNLASLYRPPFHLM  175



>ref|XP_010554359.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 117/181 (65%), Gaps = 14/181 (8%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG LSAS+QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFYVG++GG+   ++
Sbjct  1    MDGRLSASDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYVGSEGGMLPSAT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            +S  E+             G      +E+  Q + DEVRPPLPV+R+ LY   +  G   
Sbjct  61   HSQPESN---EHVVTDQSRGGASNPVNENLTQNEADEVRPPLPVVRETLYGEPMYYGAVR  117

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----------DNLASLYRPPFAL  606
             G S HE   +V FR+F +E K PGVWE D  ++SA           D+LASLYRPPF L
Sbjct  118  AGNSRHEPNPLVAFRDFSEEAKRPGVWEPDQGASSASASGSEVAAPRDSLASLYRPPFHL  177

Query  607  M  609
            M
Sbjct  178  M  178



>ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula]
 ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula]
 gb|AET03452.1| structural constituent of ribosome protein, putative [Medicago 
truncatula]
Length=461

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 118/179 (66%), Gaps = 11/179 (6%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAA  270
            M+G +S ++QQTLV SFLE+A GQ+A TARQFLQATSWKLEEALQLF +G++ G   V A
Sbjct  1    MEGMVSPTDQQTLVTSFLEVAQGQTAATARQFLQATSWKLEEALQLFLIGSETGAVPVPA  60

Query  271  PSSYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIR  447
            P+S++ PLEN     D S  S + +   +      +G  DEVR PLPVIR+ LYD  ++ 
Sbjct  61   PASFTPPLENADGWIDQSHLSETRTDTANQSGVVNEG--DEVRAPLPVIRETLYDNVLLY  118

Query  448  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            G   +G    E  S++ FRNFEQE + PGVWE +      A +S D LASLYRPPF LM
Sbjct  119  GGSRLGHLPQEPNSLIAFRNFEQETRRPGVWEPEQGAASTAESSQDTLASLYRPPFHLM  177



>ref|XP_004160516.1| PREDICTED: uncharacterized protein LOC101223406 [Cucumis sativus]
Length=192

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P  
Sbjct  1    MEGVLSATDKQSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPP  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
                 +T    + S   IS                DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   VPSPPSTNEQINSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYG-TT  119

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWET-----DXASNSADNLASLYRPPFALM  609
            MG   +E+ S + FRN + E+KH  VW++       + NS DNLASLYRPP+ LM
Sbjct  120  MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLM  174



>ref|XP_010527851.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=459

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 112/182 (62%), Gaps = 19/182 (10%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFYVG++GG+  PS 
Sbjct  1    MEGMLSASDQQRLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYVGSEGGM-LPSQ  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLYDTAVIRGLP  456
               + N                    DE+  Q D  DEVRPPLPV+R+ LY  ++  G  
Sbjct  60   PQSIANPV------ADQSWWGASNIADENIPQNDASDEVRPPLPVVRETLYGDSMYYGAV  113

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDX-----------ASNSADNLASLYRPPFA  603
              G S  E+ S+V FRNF  E K PGVWE D             +   D+LASLYRPPF 
Sbjct  114  RPGNSGQESNSLVAFRNFGDEAKRPGVWEPDQGASSASASGSEVATPRDSLASLYRPPFH  173

Query  604  LM  609
            LM
Sbjct  174  LM  175



>ref|XP_010496241.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010496249.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=463

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 114/182 (63%), Gaps = 17/182 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            +     T P  +  ++S S            Q D DEVR PLPV+R+ LY   V  G   
Sbjct  61   H-----TLPESNDPMASQSWGATTDTGNQRVQNDVDEVRAPLPVVRETLYGETVYYGAMR  115

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------------DNLASLYRPPFA  603
             G S  E  S++ FRNF +E K PG+WE D  ++SA            D+LASLYRPPF 
Sbjct  116  AGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASASESASAPRDSLASLYRPPFH  175

Query  604  LM  609
            LM
Sbjct  176  LM  177



>ref|XP_010476513.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=464

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 120/182 (66%), Gaps = 16/182 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ ++Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDEQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            ++  E+  P      S   G+   +G++   Q D DEVR PLPV+R+ LY  +V  G   
Sbjct  61   HTLPESNDP----MASQSWGATTDTGNQRMVQNDVDEVRAPLPVVRETLYGESVYYGAMR  116

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA------------DNLASLYRPPFA  603
            +G S  E  S++ FRNF +E K PGVWE D  ++SA            D+LASLYRPPF 
Sbjct  117  VGNSQPEPASLIAFRNFSEEPKSPGVWEPDEGASSASASASESASAPRDSLASLYRPPFH  176

Query  604  LM  609
            LM
Sbjct  177  LM  178



>ref|XP_010458959.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458960.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458961.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=457

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 14/180 (8%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ ++Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDEQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            ++  E+  P      S   G+   +G +   Q D DEVR PLPV+R+ LY  +V  G   
Sbjct  61   HTLPESNDP----MASQSWGATTDTGTQRMVQNDVDEVRAPLPVVRETLYGESVYYGAVR  116

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------DNLASLYRPPFALM  609
             G S  E  S++ FRNF +E K PG+WE D  ++SA          D+LASLYRPPF LM
Sbjct  117  GGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASESASVPRDSLASLYRPPFHLM  176



>ref|XP_010935375.1| PREDICTED: UBX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 113/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+ ALS  E+Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS
Sbjct  1    MENALSPEEKQRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGL  453
              P  N +P    ++       +G+       GD DEVR PLPV RD LY   ++ IR  
Sbjct  61   LPPPVNESPSERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLH  112

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            P+         SVV FRNFE+E K P VWE+D      A+ S DNLASLYRPPFALM
Sbjct  113  PS---------SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALM  160



>emb|CDY69105.1| BnaCnng61890D [Brassica napus]
Length=454

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 110/172 (64%), Gaps = 7/172 (4%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLGATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             +  + T         +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GTHTQPTV----DDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGATR  115

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA--DNLASLYRPPFALM  609
            +G S  E  S++ FRNF +E K PG+WE D  + SA  D+LASLYRPPF LM
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEEAASAPRDSLASLYRPPFHLM  167



>ref|XP_010935374.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 113/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+ ALS  E+Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS
Sbjct  1    MENALSPEEKQRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGL  453
              P  N +P    ++       +G+       GD DEVR PLPV RD LY   ++ IR  
Sbjct  61   LPPPVNESPSERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLH  112

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            P+         SVV FRNFE+E K P VWE+D      A+ S DNLASLYRPPFALM
Sbjct  113  PS---------SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALM  160



>ref|XP_002890064.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66323.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 26/191 (14%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLPSGT  60

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            ++ P  N     D   +   G+  G+G+E   Q D DEVR PLPV+R+ LY  +V  G  
Sbjct  61   HTQPASN-----DHVAAQSWGAATGTGNERILQNDVDEVRAPLPVVRETLYGESVYYGTM  115

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA--------------------DNL  576
             +G S  E  S++ FRNF +E K PG+WE D   +SA                    D+L
Sbjct  116  RVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASASASESASAPRDSL  175

Query  577  ASLYRPPFALM  609
            ASLYRPPF LM
Sbjct  176  ASLYRPPFHLM  186



>ref|XP_008389122.1| PREDICTED: UBX domain-containing protein 2-like isoform X3 [Malus 
domestica]
Length=440

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 110/175 (63%), Gaps = 19/175 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S HE              + PGVWE+D  + S+     +NLASLYRPPF ++
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKIL  161



>ref|XP_008389121.1| PREDICTED: UBX domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=442

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 110/175 (63%), Gaps = 19/175 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S HE              + PGVWE+D  + S+     +NLASLYRPPF ++
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKIL  161



>ref|XP_008389120.1| PREDICTED: UBX domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=445

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 110/175 (63%), Gaps = 19/175 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
               S HE              + PGVWE+D  + S+     +NLASLYRPPF ++
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKIL  161



>ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus]
Length=450

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P  
Sbjct  1    MEGVLSATDKQSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPP  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
                 +T    + S   IS                DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   VPSPPSTNEQINSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-T  119

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWET-----DXASNSADNLASLYRPPFALM  609
            MG   +E+ S + FRN + E+KH  VW++       + NS DNLASLYRPP+ LM
Sbjct  120  MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLM  174



>ref|XP_006307428.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
 gb|EOA40326.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
Length=468

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 119/186 (64%), Gaps = 20/186 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G +S+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMVSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            ++  E+     D   +   G+   +G++   Q D DEVR PLPV+R+ LY  AV  G   
Sbjct  61   HTQPESN----DHMATQSWGAGTDTGNQGIVQSDVDEVRAPLPVVRETLYGDAVYYGAMR  116

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------------DNLASLYR  591
             G S  E  S++ FRNF +E K PG+WE D  ++SA                D+LASLYR
Sbjct  117  GGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASASASASESSSAPRDSLASLYR  176

Query  592  PPFALM  609
            PPF LM
Sbjct  177  PPFHLM  182



>ref|NP_563954.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_973827.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AAK43884.1|AF370507_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL47388.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19997.1| AT1G14570 [Arabidopsis thaliana]
 gb|AEE29182.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29183.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=468

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 120/187 (64%), Gaps = 22/187 (12%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGT  60

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            ++ P  N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G  
Sbjct  61   HTQPASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGAM  115

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------------DNLASLY  588
             +G S  E  S++ FRNF +E K PG+WE D   +SA                D+LASLY
Sbjct  116  RVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLY  175

Query  589  RPPFALM  609
            RPPF LM
Sbjct  176  RPPFHLM  182



>ref|XP_006416998.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
 gb|ESQ35351.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
Length=462

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 117/184 (64%), Gaps = 22/184 (12%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+S+QQ LV+SFLEIAVGQ++DTARQFL+ATSWKLEEA+QLFYVG +GG+    +
Sbjct  1    MEGMLSSSDQQRLVSSFLEIAVGQTSDTARQFLEATSWKLEEAIQLFYVGGEGGMLPSGT  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            +     T P         + S   +G+E  +Q D DEVRPPLPV+R+ LY      G   
Sbjct  61   H-----TQP--ASDDHMAAQSWGAAGNERIQQNDVDEVRPPLPVVRETLYGGDYY-GAMR  112

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA--------------DNLASLYRPP  597
            +G S  E  S++ FRNF +E K PGVWE D  ++SA              D+LASLYRPP
Sbjct  113  LGNSQPEPTSLIAFRNFNEEPKSPGVWEPDEGASSASASASVSETASAPRDSLASLYRPP  172

Query  598  FALM  609
            F LM
Sbjct  173  FHLM  176



>emb|CDY45269.1| BnaA06g09390D [Brassica napus]
Length=467

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 113/185 (61%), Gaps = 20/185 (11%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             +   NT P       +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GT---NTRP-TVDDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTR  115

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA---------------DNLASLYRP  594
            +G S  E  S++ FRNF +E K PG+WE D  ++SA               D+LASLYRP
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASSAPRDSLASLYRP  175

Query  595  PFALM  609
            PF LM
Sbjct  176  PFHLM  180



>ref|XP_009148836.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=466

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 112/184 (61%), Gaps = 19/184 (10%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             +  + T         +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GTHTQPTV----DDPMAAHSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTR  115

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA--------------DNLASLYRPP  597
            +G S  E  S++ FRNF +E K PG+WE D  ++SA              D+LASLYRPP
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASAPRDSLASLYRPP  175

Query  598  FALM  609
            F LM
Sbjct  176  FHLM  179



>ref|XP_008804300.1| PREDICTED: UBX domain-containing protein 7 [Phoenix dactylifera]
Length=443

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 107/176 (61%), Gaps = 23/176 (13%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  L   E+Q L++SFLEIA GQ+AD A QFL+ATSWKLEEA+QLFY GN+ G    SS
Sbjct  1    MESVLLPEEKQRLISSFLEIAAGQTADIAAQFLEATSWKLEEAIQLFYAGNEFGAVPSSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLP  456
              P  N  P    ++       +G+       GD DEVR PLPV RD LY D + IR  P
Sbjct  61   LPPPVNEIPSERENVEVNENVGQGA-------GD-DEVRAPLPVKRDTLYGDPSFIRLHP  112

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            +         SVV FRNFE+E K P VWE+D      ++ S DNLASLYRPPFALM
Sbjct  113  S---------SVVAFRNFEEESKRPAVWESDQKAASTSNGSRDNLASLYRPPFALM  159



>ref|XP_009401234.1| PREDICTED: UBX domain-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 110/177 (62%), Gaps = 25/177 (14%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+   +A+++Q LV+SFLEIA+GQ+ +TA QFLQAT WKLEEALQLFYVGN+GG  A SS
Sbjct  1    METLPTAADKQQLVSSFLEIALGQTPETATQFLQATGWKLEEALQLFYVGNEGGGLATSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLY-DTAVIRGL  453
            + P    +P         S         S  QG   DEVRPPLPV R+ LY DT + R  
Sbjct  61   FPPPPTGSP---------SEQENVMSSGSLVQGALEDEVRPPLPVKRETLYGDTPLFR--  109

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
                   H++ ++V FRNF++E K   VWE++      A+ S DNLASLY PPFALM
Sbjct  110  -------HQSSAMVAFRNFDEESKRSAVWESNESSASTANGSRDNLASLYSPPFALM  159



>ref|XP_004297788.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 107/182 (59%), Gaps = 20/182 (11%)
 Frame = +1

Query  100  MDGALSASEQQ-TLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  276
            M+ A SA EQQ + VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G     
Sbjct  32   MEAASSAEEQQQSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG-----  86

Query  277  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
               P+    P P    +S         +E+  Q   DEVR P+PVIRDVLYD   +    
Sbjct  87   ---PVAQPQPQPPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAG  143

Query  457  AMGGSAHEAR------SVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFA  603
             +  ++   R       V+ FRNF +E+KHPGVWE++  + S      DNLASLYRPPF 
Sbjct  144  LLASTSPMTRLPVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFK  203

Query  604  LM  609
            LM
Sbjct  204  LM  205



>ref|XP_011463491.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 107/182 (59%), Gaps = 20/182 (11%)
 Frame = +1

Query  100  MDGALSASEQQ-TLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  276
            M+ A SA EQQ + VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G     
Sbjct  32   MEAASSAEEQQQSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG-----  86

Query  277  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
               P+    P P    +S         +E+  Q   DEVR P+PVIRDVLYD   +    
Sbjct  87   ---PVAQPQPQPPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAG  143

Query  457  AMGGSAHEAR------SVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFA  603
             +  ++   R       V+ FRNF +E+KHPGVWE++  + S      DNLASLYRPPF 
Sbjct  144  LLASTSPMTRLPVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFK  203

Query  604  LM  609
            LM
Sbjct  204  LM  205



>ref|XP_007052064.1| UBX domain-containing protein [Theobroma cacao]
 gb|EOX96221.1| UBX domain-containing protein [Theobroma cacao]
Length=431

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 114/175 (65%), Gaps = 16/175 (9%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV   SS
Sbjct  1    MEGILSATDEQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVGSSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             S     A   D      SG++    +     G  D VRPPLPV+R+ L+D A++ G   
Sbjct  61   VS---RQAENMDSWAYQNSGALNEHDNVGSTGG--DAVRPPLPVVRETLHDDAMLHGASR  115

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-----DNLASLYRPPFALM  609
            +G    E      FRNF++E   PGVW++D  ++S      DNLASLYRPPF LM
Sbjct  116  LGYPPQE------FRNFDEETIRPGVWQSDEGASSTVDAPRDNLASLYRPPFHLM  164



>ref|XP_009398016.1| PREDICTED: UBX domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 97/175 (55%), Gaps = 25/175 (14%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+   +A+EQQ LV SFLEIAVGQ+A TA QFLQAT W+L+EA+QLFYVGN+ G  A SS
Sbjct  1    METVPTAAEQQQLVLSFLEIAVGQTAATATQFLQATRWRLDEAVQLFYVGNEDGGVASSS  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
              P  N  P                   S  +   DEVRPPLPV R+ LY          
Sbjct  61   LPPPINERP--------SGQVNFFGTTSSVPRPPEDEVRPPLPVKRETLY----------  102

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
              G     R V  FRNF++  K   VWE+D      ++ S DNLASLY PPFALM
Sbjct  103  --GDMPLFRPVDAFRNFDEGSKRSAVWESDESAPSTSNGSRDNLASLYSPPFALM  155



>ref|XP_007045359.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
 gb|EOY01191.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
Length=429

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 91/147 (62%), Gaps = 10/147 (7%)
 Frame = +1

Query  187  RQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAPlpdpslssisgsikgsgde  363
            R  + ATSWKL+EA+QLFYVGN+GGV A SS SP LEN       +   ++     +   
Sbjct  5    RHAVFATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDSWASQNSGELNEPANDNVGS  64

Query  364  sekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWE  543
            +      D+VRPPLPV+R+ LYD  ++ G   +G    +  S V FRNF++EMK PGVWE
Sbjct  65   TGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLSSSVAFRNFDEEMKRPGVWE  120

Query  544  TDXASNSA-----DNLASLYRPPFALM  609
            +D  ++S      DNLASLYRPPF LM
Sbjct  121  SDEGASSTVDAPRDNLASLYRPPFHLM  147



>gb|KHN06997.1| UBX domain-containing protein 7 [Glycine soja]
Length=494

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 88/155 (57%), Gaps = 13/155 (8%)
 Frame = +1

Query  184  ARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL-------ENTAPlpdpslssisgs  342
            ARQFLQATSWKLEEALQLF +G++GG        P        EN     D    S    
Sbjct  55   ARQFLQATSWKLEEALQLFLIGSEGGAVPLPVPPPPLLHTPPLENVDSWTDQQPLSEPRK  114

Query  343  ikgsgdesekQ-GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQE  519
               +         D +EVRPPLPVIR+ LYD A++ G       +HE  S+V FRNFE+E
Sbjct  115  DAAAAASESIDLNDAEEVRPPLPVIRETLYDDAMLYGASRASHRSHEPSSLVAFRNFEEE  174

Query  520  MKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            M+ PGVWE++      A  S DNLASLYRPPF LM
Sbjct  175  MRQPGVWESEQGAASTAETSRDNLASLYRPPFHLM  209



>ref|NP_001077535.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_001077536.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29184.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29185.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=447

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 109/187 (58%), Gaps = 43/187 (23%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGT  60

Query  280  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            ++ P  N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G  
Sbjct  61   HTQPASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYG--  113

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------------DNLASLY  588
                               +E K PG+WE D   +SA                D+LASLY
Sbjct  114  -------------------EEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLY  154

Query  589  RPPFALM  609
            RPPF LM
Sbjct  155  RPPFHLM  161



>ref|XP_009773267.1| PREDICTED: uncharacterized protein LOC104223510 [Nicotiana sylvestris]
Length=178

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 92/175 (53%), Gaps = 46/175 (26%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SA +QQ LV+SFLEI VGQ+ADTARQFLQ TSW LEEA+QL Y+GN+GG AA  +
Sbjct  1    MDGVISAMDQQMLVSSFLEITVGQTADTARQFLQVTSWNLEEAIQLSYIGNEGGAAASVN  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
             S L N A                        GDR                         
Sbjct  61   SSQLGNDA----------------------LLGDRSLSS-------------------SG  79

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASN-----SADNLASLYRPPFALM  609
            +GGS+ E R V P  NFE+EMK PGV E +  S      + DNLASL  PPFALM
Sbjct  80   VGGSSREPRLVAPSCNFEEEMKCPGVLEAEKRSTPTTDAAQDNLASLCHPPFALM  134



>ref|XP_009110537.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=443

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 101/178 (57%), Gaps = 23/178 (13%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG--VAAP  273
            M+  LS+ +QQ+LV+SFL+IAVGQ+A TARQFLQATSW L EA+QLFY G +GG  +A+ 
Sbjct  1    MERMLSSRDQQSLVSSFLDIAVGQTAKTARQFLQATSWNLNEAVQLFYAGGEGGSMLASG  60

Query  274  SSYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  453
            +   P+              S           K+ D D VR PLPV+ + LY  ++    
Sbjct  61   THTHPM-----------GRRSRRAAARARRERKRNDADGVRAPLPVVTETLYRDSMYYE-  108

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSAD------NLASLYRPPFALM  609
               G    E  S++ F +F +E K  GVWE D  ++SA       +LASLYRPPF LM
Sbjct  109  ---GNYERELASLIDFLDFSEEPKRSGVWEPDEVASSASTSGPRHSLASLYRPPFHLM  163



>gb|AFW59833.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=193

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 99/178 (56%), Gaps = 21/178 (12%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPL  291
            +A+E++TLV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S     
Sbjct  7    TAAEKETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSP  66

Query  292  ENTAPlpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAV  441
               AP    + + +  +++ +   +   GD           D+VR PLPV R+ LY   +
Sbjct  67   AAAAPSALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGI  126

Query  442  IRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFALM  609
            +        S     +   FRNFEQE +   VW  E + AS+S DNLASLYRPPF LM
Sbjct  127  V--------SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLM  176



>gb|AEV41029.1| putative UBX domain-containing protein [Oryza minuta]
Length=463

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 27/181 (15%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYS  285
            +A+E+++LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +
Sbjct  7    TAAEKESLVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAA  66

Query  286  PLENTAPlpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA-  438
                 A +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A 
Sbjct  67   AAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAP  126

Query  439  --VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFAL  606
              V+R             S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPFAL
Sbjct  127  MVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFAL  175

Query  607  M  609
            M
Sbjct  176  M  176



>gb|AEV40978.1| putative UBX domain-containing protein [Oryza punctata]
Length=463

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 27/181 (15%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYS  285
            +A+E+++LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +
Sbjct  7    TAAEKESLVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAA  66

Query  286  PLENTAPlpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA-  438
                 A +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A 
Sbjct  67   AAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAP  126

Query  439  --VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFAL  606
              V+R             S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPFAL
Sbjct  127  MVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFAL  175

Query  607  M  609
            M
Sbjct  176  M  176



>tpg|DAA35439.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=461

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 33/184 (18%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            +A+E++TLV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P  
Sbjct  7    TAAEKETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAH  60

Query  295  NTAPlpdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDV  423
              AP P  + +S   +  G+ +                      G+ D+VR PLPV R+ 
Sbjct  61   PVAPPPTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRET  120

Query  424  LYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETD--XASNSADNLASLYRPP  597
            LY   ++        S     +   FRNFEQE +   VW++D    S+S DNLASLYRPP
Sbjct  121  LYGEGIV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPP  172

Query  598  FALM  609
            F+LM
Sbjct  173  FSLM  176



>ref|XP_002447303.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
 gb|EES11631.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
Length=463

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 100/180 (56%), Gaps = 23/180 (13%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            +A+E++TLV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  + A     P  
Sbjct  7    TAAEKETLVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALGAAHPAVPPP  66

Query  295  NTAPlpdpslssisgsikg-------------sgdesekQGDRDEVRPPLPVIRDVLYDT  435
              A     +L++ +G  +              +       G+ D+VR PLPV R+ LY  
Sbjct  67   AAAAASASALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVGEDDDVRAPLPVKRETLYGE  126

Query  436  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDX--ASNSADNLASLYRPPFALM  609
             ++        S     +   FRNFEQE +   VW++D    S+S DNLASLYRPPF+LM
Sbjct  127  GIV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLM  178



>gb|KGN50781.1| hypothetical protein Csa_5G259710 [Cucumis sativus]
Length=174

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+G LSA+++Q++V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P  
Sbjct  1    MEGVLSATDKQSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPP  60

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG  450
                 +T    + S   IS                DEVRPPLPVIR+ LYD A++ G
Sbjct  61   VPSPPSTNEQINSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYG  117



>ref|XP_008668717.1| PREDICTED: UBX domain-containing protein 2-like [Zea mays]
Length=542

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 102/184 (55%), Gaps = 33/184 (18%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            +A+E++TLV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P  
Sbjct  88   TAAEKETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAH  141

Query  295  NTAPlpdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDV  423
              AP P  + +S   +  G+ +                      G+ D+VR PLPV R+ 
Sbjct  142  PVAPPPTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRET  201

Query  424  LYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDX--ASNSADNLASLYRPP  597
            LY   ++  +     +A        FRNFEQE +   VW++D    S+S DNLASLYRPP
Sbjct  202  LYGEGIVSVMRPNASAA--------FRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPP  253

Query  598  FALM  609
            F+LM
Sbjct  254  FSLM  257



>ref|NP_001170636.1| uncharacterized protein LOC100384688 [Zea mays]
 gb|ACR34298.1| unknown [Zea mays]
 gb|AFW59832.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=459

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 99/178 (56%), Gaps = 21/178 (12%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPL  291
            +A+E++TLV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S     
Sbjct  7    TAAEKETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSP  66

Query  292  ENTAPlpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAV  441
               AP    + + +  +++ +   +   GD           D+VR PLPV R+ LY   +
Sbjct  67   AAAAPSALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGI  126

Query  442  IRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFALM  609
            +        S     +   FRNFEQE +   VW  E + AS+S DNLASLYRPPF LM
Sbjct  127  V--------SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLM  176



>ref|XP_004960126.1| PREDICTED: UBX domain-containing protein 2-like [Setaria italica]
Length=456

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 16/173 (9%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            +A+E++ LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  +AA  +     
Sbjct  7    TAAEKEALVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALAARPAAPSAA  66

Query  295  NTAPlpdpslssi------sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
                       ++      + ++     +    G+ D+VR PLPV R+ LY    +    
Sbjct  67   AAMAAAAGVEEALRFAPPPAAALGDPMLQGLGVGEDDDVRAPLPVKRETLYGDGPV----  122

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETD--XASNSADNLASLYRPPFALM  609
                S     + V FRNFEQE +   VW++D    S+S DNLASLYRPPF+LM
Sbjct  123  ----SVLRPSTTVAFRNFEQEARQSAVWDSDQNATSSSRDNLASLYRPPFSLM  171



>ref|XP_010240593.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Brachypodium 
distachyon]
Length=318

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 99/183 (54%), Gaps = 26/183 (14%)
 Frame = +1

Query  106  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  285
             A +A+E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +
Sbjct  4    AAPTAAEKDALVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSA  61

Query  286  PLENTAPlpdpslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY  429
                ++     + +  +             +        ++QGD +EVR PLPV R+ LY
Sbjct  62   AAPASSAAALEAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLY  121

Query  430  -DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPF  600
             D  ++   P          S V FRNFE+E +   VW  E +  S+S DNLASLYRPPF
Sbjct  122  GDVPMVVARP---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPF  172

Query  601  ALM  609
             LM
Sbjct  173  DLM  175



>ref|XP_006855568.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
 gb|ERN17035.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
Length=442

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 20/169 (12%)
 Frame = +1

Query  118  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGV----AAPSSYS  285
            + ++Q LVASF+E+A G+S   A QFLQAT+W+LE+A+QLF+VGNDG      A  SS+S
Sbjct  5    SDDKQILVASFMEVAGGESTKIALQFLQATNWQLEDAIQLFFVGNDGNNTNTNAESSSFS  64

Query  286  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  465
            P + T   P         +              + VRPPLPV R+ LY  + + G   + 
Sbjct  65   PPKETNHSPLHESEQEKDAKW-----------EEYVRPPLPVKREALYADSFMYGQRTL-  112

Query  466  GSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA-DNLASLYRPPFALM  609
               H     V FR+FE+E K+P VW ++  ++ A DNLA+LYRPPF+LM
Sbjct  113  ---HPPHQPVAFRDFEEEAKNPSVWGSEQGTSGARDNLAALYRPPFSLM  158



>ref|XP_003580790.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 99/183 (54%), Gaps = 26/183 (14%)
 Frame = +1

Query  106  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  285
             A +A+E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +
Sbjct  4    AAPTAAEKDALVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSA  61

Query  286  PLENTAPlpdpslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY  429
                ++     + +  +             +        ++QGD +EVR PLPV R+ LY
Sbjct  62   AAPASSAAALEAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLY  121

Query  430  -DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPF  600
             D  ++   P          S V FRNFE+E +   VW  E +  S+S DNLASLYRPPF
Sbjct  122  GDVPMVVARP---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPF  172

Query  601  ALM  609
             LM
Sbjct  173  DLM  175



>gb|AEV41122.1| putative UBX domain-containing protein [Oryza officinalis]
Length=464

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 102/183 (56%), Gaps = 29/183 (16%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            +A+E+++LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  +AA  + SP  
Sbjct  7    TAAEKESLVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSPAA  66

Query  295  NTAPlpdpslssisgsikgsgde-----------sekQG--DRDEVRPPLPVIRDVLYDT  435
              A     +++  + +                     QG  + D+VR PLP  R+ LY  
Sbjct  67   AAAAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEDDVRAPLPTKRETLYGD  126

Query  436  A---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPF  600
            A   V+R             S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPF
Sbjct  127  APMVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPF  175

Query  601  ALM  609
            ALM
Sbjct  176  ALM  178



>gb|EEE61882.1| hypothetical protein OsJ_16574 [Oryza sativa Japonica Group]
Length=421

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 100/182 (55%), Gaps = 30/182 (16%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            + +E+++LV SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  DG  A  +  +P  
Sbjct  7    TEAEKESLVTSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYI--DGEAALAAHPAPSP  64

Query  295  NTAPlpdpslssisgsikgsgd------------esekQGDRDEVRPPLPVIRDVLYDTA  438
              A     +  + +  ++ +                +  G+ ++VR PLP  R+ LY  A
Sbjct  65   AAAAEAAAAAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEEDVRAPLPTKRETLYGDA  124

Query  439  ---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFA  603
               V+R             S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPFA
Sbjct  125  PMVVVR-----------PNSTVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFA  173

Query  604  LM  609
            LM
Sbjct  174  LM  175



>dbj|BAK05667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 99/177 (56%), Gaps = 26/177 (15%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  300
            +E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEALQLFY+  DG  A   ++ P+++ 
Sbjct  9    AERDALVSSFLEIAAGQTPHTAAQFLQMTSWHLEEALQLFYI--DGEAALAGAHPPVQSA  66

Query  301  APlpdpslssisg-----------sikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVI  444
            A     + ++ +            +        +  GD D+VR PLPV R+ LY DT  I
Sbjct  67   AEAALAAAAAAAEVEEGFRYHPPPAAALEDGMLQGLGDDDDVRAPLPVRRETLYGDTPTI  126

Query  445  RGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFALM  609
               P    +A +A     FRNFE+E +    W  E +  S+S+D LASLYRPPF LM
Sbjct  127  IARP----NATDA-----FRNFEEEARQ-SAWDSEQNATSSSSDKLASLYRPPFDLM  173



>emb|CAE02831.2| OSJNBa0043A12.36 [Oryza sativa Japonica Group]
 emb|CAH67698.1| H0624F09.6 [Oryza sativa Indica Group]
 dbj|BAG93324.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78226.1| hypothetical protein OsI_17866 [Oryza sativa Indica Group]
Length=459

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 100/182 (55%), Gaps = 30/182 (16%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            + +E+++LV SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  DG  A  +  +P  
Sbjct  7    TEAEKESLVTSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYI--DGEAALAAHPAPSP  64

Query  295  NTAPlpdpslssisgsikgsgd------------esekQGDRDEVRPPLPVIRDVLYDTA  438
              A     +  + +  ++ +                +  G+ ++VR PLP  R+ LY  A
Sbjct  65   AAAAEAAAAAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEEDVRAPLPTKRETLYGDA  124

Query  439  ---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFA  603
               V+R             S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPFA
Sbjct  125  PMVVVR-----------PNSTVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFA  173

Query  604  LM  609
            LM
Sbjct  174  LM  175



>gb|AAF63167.1|AC010657_3 T5E21.7 [Arabidopsis thaliana]
Length=514

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 6/115 (5%)
 Frame = +1

Query  112  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-P  288
            LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P
Sbjct  2    LSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGTHTQP  61

Query  289  LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  453
              N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  GL
Sbjct  62   ASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGL  111


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 16/66 (24%)
 Frame = +1

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------------DNLASLYR  591
            +G S  E  S++ FRNF +E K PG+WE D   +SA                D+LASLYR
Sbjct  168  VGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLYR  227

Query  592  PPFALM  609
            PPF LM
Sbjct  228  PPFHLM  233



>gb|EYU24728.1| hypothetical protein MIMGU_mgv1a025994mg, partial [Erythranthe 
guttata]
Length=320

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 7/85 (8%)
 Frame = +1

Query  376  GDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDX  552
             D  +VR PLPV RDVLYD++++ G +  +G S H   SVVPFRNF++EMKHPGVWE + 
Sbjct  8    NDGSDVRAPLPVRRDVLYDSSMLYGRVQRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEA  67

Query  553  ASNSA------DNLASLYRPPFALM  609
             S+S+      DNLASLYRPPFALM
Sbjct  68   GSSSSVADKTQDNLASLYRPPFALM  92



>ref|XP_009601783.1| PREDICTED: uncharacterized protein LOC104097000 isoform X1 [Nicotiana 
tomentosiformis]
Length=369

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            MDG +SA++QQ LV+SFLEIAVGQ+A+TARQFLQATSW LEEA+QL Y+GN+GG AA  +
Sbjct  1    MDGVISATDQQMLVSSFLEIAVGQNANTARQFLQATSWNLEEAIQLSYIGNEGGAAASVN  60

Query  280  YSPLENTA  303
               L N A
Sbjct  61   SPQLGNDA  68


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 30/49 (61%), Gaps = 5/49 (10%)
 Frame = +1

Query  478  EARSVVPFRNFEQEMKHPGVWETDXASN-----SADNLASLYRPPFALM  609
            E R V P  NFE+EMK PGV E +  S      + DNLASL  PPFALM
Sbjct  86   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALM  134



>ref|XP_001758899.1| predicted protein [Physcomitrella patens]
 gb|EDQ76405.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 97/180 (54%), Gaps = 13/180 (7%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  LS  E+Q ++  F++I VG+SAD ARQFLQAT W L EA+QL++  N+    A + 
Sbjct  1    METTLSDWEEQLVMLEFMDI-VGESADRARQFLQATGWLLNEAVQLYFAENNEVGGANND  59

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLY-DTAVIRGL  453
             +    +AP+     +  S    GS   +++ GD +  VRPPLPV R+ LY D    R  
Sbjct  60   LAAPVVSAPVLPEQATLGSSLDPGSSTVNDRNGDNENYVRPPLPVKREALYEDMLQARVH  119

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS--------NSADNLASLYRPPFALM  609
             A+   +H    V PFRNFE E      W    AS        +S D+LA+LYRPPF  M
Sbjct  120  QAVQYPSHSF--VDPFRNFEDEANQQSSWGAGEASTHVGSAGGSSRDSLAALYRPPFVFM  177



>ref|XP_009759130.1| PREDICTED: UBX domain-containing protein 7-like [Nicotiana sylvestris]
Length=377

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 86/168 (51%), Gaps = 44/168 (26%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  300
            S QQ L++SFLEIA+ Q+ADTARQFLQ T W LEEA+QLFY  N+  V  PS        
Sbjct  3    SYQQMLISSFLEIAIDQTADTARQFLQTTKWNLEEAIQLFY--NNELVDNPS--------  52

Query  301  APlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY---DTAVIRGLPAMGGS  471
                               D+ +   D D+VRPPL V R+V+Y   +T    G      S
Sbjct  53   -------------LNGDDDDDDDDDDDDDDVRPPLHVEREVIYGHNNTVQYNG----NSS  95

Query  472  AHEARSVVPFRNFEQEM--KHPGVWETDXASNSADNLASLYRPPFALM  609
            +H         NF+ E+  +   VW  +      DNLAS+YRPPFAL+
Sbjct  96   SH---------NFDDEILSRLGDVWRVEERD---DNLASMYRPPFALI  131



>ref|XP_008342902.1| PREDICTED: LOW QUALITY PROTEIN: membrane-associated progesterone 
receptor component 1-like [Malus domestica]
Length=249

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  385  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNS  564
            DEVR P+PVIRDVL+D   + G P    S  +  SV+ FRNFE+EMKHPGV E+D    S
Sbjct  41   DEVRXPMPVIRDVLFDDMSLYGAPRARFS--QQGSVIAFRNFEEEMKHPGVXESDQGDTS  98

Query  565  A-----DNLASLYRPPFAL  606
            +     DNLASLYRPP  L
Sbjct  99   SANAVQDNLASLYRPPVQL  117



>ref|XP_006343881.1| PREDICTED: UBX domain-containing protein 7-like [Solanum tuberosum]
Length=424

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 77/166 (46%), Gaps = 43/166 (26%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAAPSSYSPL  291
            S Q  L++SFL+IAV Q+ DTAR+FLQAT W LEEA+Q F+ GN+ G    A   +YSPL
Sbjct  34   SSQDMLISSFLDIAVDQTVDTAREFLQATKWNLEEAIQRFFSGNNNGGAEAAESFNYSPL  93

Query  292  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  471
                P    S                   D D+VR PLPV R+VLY            G 
Sbjct  94   IEDNPTLWESE------------------DDDDVRLPLPVRREVLYGEN--------SGL  127

Query  472  AHEARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
              + R  +    F+              S   + L+ L+RPP+ L+
Sbjct  128  YEDEREQISSSTFD--------------SYDNNTLSVLFRPPYELL  159



>ref|XP_009601784.1| PREDICTED: uncharacterized protein LOC104097000 isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  136  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            LV+SFLEIAVGQ+ADT RQFLQATSW LEEA+QL Y+GN+GG AA  +   L N A
Sbjct  2    LVSSFLEIAVGQTADTVRQFLQATSWNLEEAIQLSYIGNEGGAAASVNSPQLGNDA  57


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 30/49 (61%), Gaps = 5/49 (10%)
 Frame = +1

Query  478  EARSVVPFRNFEQEMKHPGVWETDXASN-----SADNLASLYRPPFALM  609
            E R V P  NFE+EMK PGV E +  S      + DNLASL  PPFALM
Sbjct  75   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALM  123



>ref|XP_010527852.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=405

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 50/86 (58%), Gaps = 11/86 (13%)
 Frame = +1

Query  385  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDX----  552
            DEVRPPLPV+R+ LY  ++  G    G S  E+ S+V FRNF  E K PGVWE D     
Sbjct  36   DEVRPPLPVVRETLYGDSMYYGAVRPGNSGQESNSLVAFRNFGDEAKRPGVWEPDQGASS  95

Query  553  -------ASNSADNLASLYRPPFALM  609
                    +   D+LASLYRPPF LM
Sbjct  96   ASASGSEVATPRDSLASLYRPPFHLM  121



>ref|XP_008801336.1| PREDICTED: UBX domain-containing protein 2-like [Phoenix dactylifera]
Length=340

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 79/165 (48%), Gaps = 50/165 (30%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  294
            S+SE+Q L++SFLEIA G S+D A ++LQAT+W+LE+A +LF+ G + G A         
Sbjct  6    SSSEKQVLISSFLEIATGFSSDAAIKYLQATNWRLEDAFELFFAGGEPGTAFSDD-----  60

Query  295  NTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSA  474
                                      +   D V+PP+P+ R+VLY  A     P++    
Sbjct  61   --------------------------RARDDGVQPPIPLKREVLYGPA-----PSLPSQC  89

Query  475  HEARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
             +A S               VW+++   ++   LASL+RPP  L+
Sbjct  90   FDAES--------------SVWKSEGGESNCSILASLFRPPSCLI  120



>ref|XP_010325366.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7-like [Solanum lycopersicum]
Length=375

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 76/161 (47%), Gaps = 42/161 (26%)
 Frame = +1

Query  136  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS---SYSPLENTAP  306
            L++SFL+IAV Q+ DTAR+FLQAT+W LEEA+Q F+ GN+ G  A +   +YSPL    P
Sbjct  4    LISSFLDIAVDQTVDTAREFLQATNWNLEEAIQRFFSGNNNGATAAAESFNYSPLIENTP  63

Query  307  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  486
                                E + D D+V  P PV R+V Y            G   + R
Sbjct  64   -----------------TLREWEDDDDDVHLPSPVRREVFYGET--------SGLYEDER  98

Query  487  SVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
              +    F            D  SN+A  L+ L+RPP+  +
Sbjct  99   DQISSSTF------------DSYSNNA--LSDLFRPPYEFL  125



>ref|XP_006414812.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
 gb|ESQ56265.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
Length=394

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 79/171 (46%), Gaps = 34/171 (20%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPS  276
            M  A S   QQ L++SF+EIAVGQ+ +TA QFL+ATSW LE+A+ LF V G +  ++ P 
Sbjct  2    MATATSDDHQQRLISSFIEIAVGQTIETALQFLKATSWNLEDAINLFLVHGQNQTLSYPQ  61

Query  277  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  456
            + S                               + +++ PPLP IRD LYD++ +    
Sbjct  62   NSSE-----------------------QYWSDNQEEEQIHPPLPSIRDTLYDSSSMHHQT  98

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
             +     E        + +QE    G        +    L++LYRPP  L+
Sbjct  99   TVQVGPEE------IWDLKQEPSDSG----SVVGSEGSRLSTLYRPPLKLL  139



>ref|XP_010253434.1| PREDICTED: UBX domain-containing protein 7-like [Nelumbo nucifera]
Length=361

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 76/170 (45%), Gaps = 67/170 (39%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+  + + E+ TLV+SFL I VGQSA TA QFL+AT W LEEA++LFY G          
Sbjct  1    MENTVVSGEKDTLVSSFLGIVVGQSAQTAIQFLEATGWNLEEAIRLFYAGL---------  51

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
                                              +D VRPPLPV R+ L D         
Sbjct  52   ----------------------------------QDNVRPPLPVKREKLCD---------  68

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
                  E+   +P RN      H  VWE+  + +S  +LASLYRPP  L+
Sbjct  69   ------ESDHPMP-RN------HSNVWESGRSHSS--DLASLYRPPVELL  103



>tpg|DAA35438.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=426

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 76/154 (49%), Gaps = 33/154 (21%)
 Frame = +1

Query  205  TSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsikgsgdesekQ---  375
            TSW LEEALQLFY+  +      S+ +P    AP P  + +S   +  G+ +        
Sbjct  2    TSWHLEEALQLFYIDGE------SALTPAHPVAPPPTSAAASALAAAAGAEEAMRFAPPP  55

Query  376  --------------GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFE  513
                          G+ D+VR PLPV R+ LY   ++        S     +   FRNFE
Sbjct  56   AAALGDAMLHGFGVGEDDDVRAPLPVKRETLYGEGIV--------SVMRPNASAAFRNFE  107

Query  514  QEMKHPGVWETD--XASNSADNLASLYRPPFALM  609
            QE +   VW++D    S+S DNLASLYRPPF+LM
Sbjct  108  QEARQSAVWDSDQNATSSSGDNLASLYRPPFSLM  141



>ref|XP_009599661.1| PREDICTED: UBX domain-containing protein 7 homolog [Nicotiana 
tomentosiformis]
Length=367

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 79/167 (47%), Gaps = 52/167 (31%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  300
            S QQ LV+SFLEIAV Q+ADTAR+FLQ TSW LEEA+QLFY  N+  V  PS     +N 
Sbjct  3    SYQQMLVSSFLEIAVDQTADTARRFLQTTSWNLEEAIQLFY--NNELVHNPSLNGAADNW  60

Query  301  APlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG-GSAH  477
                  ++                                  ++ AV    P +G GS+H
Sbjct  61   GQYDGDNVDDDD------------------------------HNIAV----PYIGNGSSH  86

Query  478  EARSVVPFRNFEQEM--KHPG-VWETDXASNSADNLASLYRPPFALM  609
                     N E ++    PG VW  +      DNL+S+YRPPFAL+
Sbjct  87   ---------NLENKILSSRPGDVWRVEERD---DNLSSMYRPPFALL  121



>emb|CDX84023.1| BnaC08g16220D [Brassica napus]
Length=458

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 88/182 (48%), Gaps = 21/182 (12%)
 Frame = +1

Query  112  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL  291
            LS+ +QQ LV+SFL+IAVGQ+A+TARQFLQ+  ++ +E  Q   + N    +      P 
Sbjct  2    LSSRDQQRLVSSFLDIAVGQTAETARQFLQSRRYERKEFFQTDLLKNRSMRSKNRRRLPH  61

Query  292  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDT------AVIRGL  453
            +  + +        +                + V+  L  +R+ LY        ++  G 
Sbjct  62   KEKSSIRYCLEIFRTLKTTNIATSWNLN---EAVQ--LFYVRETLYGDPMYYGDSMYFGY  116

Query  454  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSA----------DNLASLYRPPFA  603
              +G    E  S++ F +F +E K PGVWE D  ++SA           +LASLYRPPF 
Sbjct  117  TMLGNYERELVSLIDFLDFSEEPKRPGVWEPDEVASSASASASTSGPRHSLASLYRPPFH  176

Query  604  LM  609
            LM
Sbjct  177  LM  178



>ref|XP_009139538.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=427

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 76/169 (45%), Gaps = 39/169 (23%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            +QQ L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +       + + L  + 
Sbjct  4    DQQKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHRENQPQRQQNATELHRS-  62

Query  304  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  483
                                     + + + PPLP IRD LYD++ +   P         
Sbjct  63   ----------------------DYQEEEHIPPPLPSIRDTLYDSSYMYQTPVQ-------  93

Query  484  RSVVPFRNFEQEMKHPGVWETDXASNSA-------DNLASLYRPPFALM  609
              V P   ++ E +     +TD   +S          L+SLYR P  L+
Sbjct  94   --VCPEEIWDAESEPSEDSDTDVGPDSKPEPSEEPRRLSSLYRAPLKLL  140



>ref|XP_006653862.1| PREDICTED: UBX domain-containing protein 2-like [Oryza brachyantha]
Length=380

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +1

Query  379  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ETDX  552
            + ++VR PLPV R+ LY  A     PA+    H   S V FRNFE+E +   VW  E + 
Sbjct  24   EEEDVRAPLPVKRETLYGDA-----PAV---VHRPNSTVAFRNFEEEARQSAVWDSEQNA  75

Query  553  ASNSADNLASLYRPPFALM  609
            AS+S DNLA+LYRPPFALM
Sbjct  76   ASSSRDNLAALYRPPFALM  94



>emb|CDY01207.1| BnaA04g06120D [Brassica napus]
Length=789

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 72/163 (44%), Gaps = 53/163 (33%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            +QQ L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +                
Sbjct  4    DQQKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHREN---------------  48

Query  304  PlpdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLYDTAVIRGLPAMGGSAHE  480
                                   Q  ++E + PPLP IRD LYD++ +   P        
Sbjct  49   -----------------------QPQQEEHIPPPLPSIRDTLYDSSYMYQTPV-------  78

Query  481  ARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
               V P   ++ E +      ++ +      L+SLYR P  L+
Sbjct  79   --QVCPEEIWDAESE-----PSEDSDTDPRRLSSLYRAPLKLL  114


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  127  QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  246
            QQ L++SF E+AVGQ+ +T  QFL+  +W LEEA+  F+V
Sbjct  449  QQNLISSFTEVAVGQTMETVIQFLETANWNLEEAINHFFV  488



>gb|AIE88273.1| hypothetical protein OG_BBa0063K01.4 [Oryza glaberrima]
Length=540

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 16/83 (19%)
 Frame = +1

Query  376  GDRDEVRPPLPVIRDVLYDTA---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--  540
            G+ ++VR PLP  R+ LY  A   V+R             S V FRNFE+E +   VW  
Sbjct  185  GEEEDVRAPLPTKRETLYGDAPMVVVR-----------PNSTVAFRNFEEESRQSAVWDS  233

Query  541  ETDXASNSADNLASLYRPPFALM  609
            E + AS+S DNLA+LYRPPFALM
Sbjct  234  EQNAASSSRDNLAALYRPPFALM  256



>gb|KDO53545.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=342

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 5/50 (10%)
 Frame = +1

Query  475  HEARSVVPFRNFEQEMKHPGVWETD-----XASNSADNLASLYRPPFALM  609
            HE  S++ FRNF++EMK PGVWE++      A +S DNLASLYRPPF LM
Sbjct  13   HEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  62



>ref|XP_010519462.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=357

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +1

Query  112  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN------DGGVAAP  273
            +S +EQ+ LV+SFLEI VG++  TAR+FLQATSW L EA+ LFY GN      +  V AP
Sbjct  2    MSENEQRRLVSSFLEITVGETVTTARRFLQATSWNLGEAVLLFYSGNQKDHVEEDEVNAP  61

Query  274  SSYSPL  291
              + P+
Sbjct  62   LMHDPM  67



>gb|AEV41076.1| putative UBX domain-containing protein [Oryza minuta]
Length=402

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  115  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  246
            +A+E+++LV+SFLEIA GQ+ +TA QFLQ TSW LEE LQLFY+
Sbjct  7    TAAEKESLVSSFLEIAAGQTPETATQFLQMTSWHLEEPLQLFYI  50



>ref|XP_006414811.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
 gb|ESQ56264.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
Length=448

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 35/171 (20%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+   S   QQ L+++F+EIAVGQ+ +TA+ FL+ T+W LEEA+ LF +        P S
Sbjct  1    METTTSDLHQQKLISTFMEIAVGQTKETAQLFLKTTNWNLEEAINLFLIDRKN---KPLS  57

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  459
            Y                       S     ++ + +++  PL   RD LY ++ IR  P 
Sbjct  58   Y---------------------HNSYLSDYQEEEEEQIPLPLSSTRDTLYGSSSIRRTPV  96

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADN-LASLYRPPFALM  609
                      V P   +  + + P   ++D    S ++ L+SLYRPP  L+
Sbjct  97   Q---------VRPEEIWNSKTE-PSDSDSDSVVGSKESKLSSLYRPPLKLL  137



>gb|EMT10976.1| hypothetical protein F775_30110 [Aegilops tauschii]
Length=396

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 13/81 (16%)
 Frame = +1

Query  376  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ET  546
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W  E 
Sbjct  43   GDDDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  92

Query  547  DXASNSADNLASLYRPPFALM  609
            +  S+S DNLASLYRPPF LM
Sbjct  93   NATSSSRDNLASLYRPPFDLM  113



>gb|EMS63720.1| UBX domain-containing protein 7 [Triticum urartu]
Length=454

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 13/81 (16%)
 Frame = +1

Query  376  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVW--ET  546
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W  E 
Sbjct  101  GDEDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  150

Query  547  DXASNSADNLASLYRPPFALM  609
            +  S+S DNLASLYRPPF LM
Sbjct  151  NATSSSRDNLASLYRPPFDLM  171



>gb|KFK22408.1| hypothetical protein AALP_AAs65522U000100 [Arabis alpina]
Length=377

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 74/164 (45%), Gaps = 37/164 (23%)
 Frame = +1

Query  118  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLEN  297
             S+Q  L+++F+EIAVG S +TA  FL+AT+W LE+A+ LF +      A   SY   EN
Sbjct  5    TSDQDKLISTFVEIAVGHSIETAILFLKATNWNLEDAINLFLIHRSNHQAL--SY---EN  59

Query  298  TAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAH  477
            +               +     S    D +++  PLP  RD LYD       P+M     
Sbjct  60   SL--------------EQYHYHSNNSQDEEQIPLPLPSRRDTLYDD------PSMC----  95

Query  478  EARSVVPFRNFEQEMKHPGVWETDXASNSADNLASLYRPPFALM  609
                    RN    +    +W++   S     L+SL+RPP  L+
Sbjct  96   --------RNTSVPVCPEQIWDSMTPSGPCSKLSSLFRPPIDLL  131



>gb|KDO48110.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=312

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA  66



>gb|KDO48111.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=305

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA  66



>ref|XP_006480638.1| PREDICTED: UBX domain-containing protein 7-like isoform X4 [Citrus 
sinensis]
Length=212

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85



>ref|XP_006480636.1| PREDICTED: UBX domain-containing protein 7-like isoform X2 [Citrus 
sinensis]
Length=278

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85



>ref|XP_006480637.1| PREDICTED: UBX domain-containing protein 7-like isoform X3 [Citrus 
sinensis]
Length=275

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  66



>ref|XP_006480635.1| PREDICTED: UBX domain-containing protein 7-like isoform X1 [Citrus 
sinensis]
Length=294

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  124  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  303
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85



>ref|XP_003604178.1| UBX domain-containing protein [Medicago truncatula]
 gb|ACJ84042.1| unknown [Medicago truncatula]
 gb|AES86375.1| UBX domain protein [Medicago truncatula]
Length=286

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  252
            ++++TLV+ FLEIA GQ+A TA+ FLQATSW LEEAL+LF  G 
Sbjct  10   TDEETLVSYFLEIARGQTAATAKHFLQATSWNLEEALKLFLSGT  53



>emb|CDY68911.1| BnaAnng28760D [Brassica napus]
Length=385

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = +1

Query  379  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDXAS  558
            D D VR PLPV+ + LY  ++      +G    E  S++ F +F +E K  GVWE D   
Sbjct  30   DADGVRAPLPVVTETLYRDSMYY----VGNYERELASLIDFIDFSEEPKRSGVWEPDEVG  85

Query  559  NSA------DNLASLYRPPFALM  609
            +SA      ++LASLYRPPF LM
Sbjct  86   SSASTSGPRNSLASLYRPPFHLM  108



>ref|XP_010436606.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=358

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  97   RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  276
            ++DG +   +Q  L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+     PS
Sbjct  17   QLDGTIDLCDQDQLISSFLEIAVGQTTETARGFLQTSGWNINVAIDLFLITNNTYSPPPS  76



>ref|XP_010445452.1| PREDICTED: UBX domain-containing protein 7 [Camelina sativa]
Length=430

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  261
            ++DG +   +Q  L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+  
Sbjct  17   QLDGTIDLCDQDQLISSFLEIAVGQTTETARVFLQTSGWNINVAIDLFLITNNNN  71



>ref|XP_006285935.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
 gb|EOA18833.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
Length=436

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  97   RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
            R+D A+    +   V SFLEIAVG++ +TAR+FLQ T WK++EA+ L+   N+
Sbjct  21   RIDEAIDLFRKNEQVTSFLEIAVGETRETARRFLQRTDWKIDEAINLYLTNNN  73



>ref|XP_010450078.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=432

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  97   RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  261
            ++DG +   + Q L++SFLEIAVGQ+ +TAR FLQ + W + EA+ LF + N+  
Sbjct  17   QLDGTMDLWQDQ-LISSFLEIAVGQTTETARGFLQTSGWNINEAIDLFLITNNNN  70



>gb|KFK22146.1| hypothetical protein AALP_AAs62910U000300 [Arabis alpina]
Length=408

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 10/77 (13%)
 Frame = +1

Query  79   SAFS-LPRMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
            S FS L    G ++      L++SFLE AVGQ+ +TAR FLQ T+W +EEA+ L+ + N+
Sbjct  3    STFSELSNRTGHVALPTNDQLISSFLETAVGQTVETARTFLQTTNWNIEEAINLYLMNNN  62

Query  256  ---------GGVAAPSS  279
                       VAAP S
Sbjct  63   YDSSLYHDYNQVAAPRS  79



>ref|NP_001054216.1| Os04g0670800 [Oryza sativa Japonica Group]
 dbj|BAF16130.1| Os04g0670800, partial [Oryza sativa Japonica Group]
Length=331

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = +1

Query  487  SVVPFRNFEQEMKHPGVW--ETDXASNSADNLASLYRPPFALM  609
            S V FRNFE+E +   VW  E + AS+S DNLA+LYRPPFALM
Sbjct  5    STVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFALM  47



>emb|CDY12746.1| BnaC04g28950D [Brassica napus]
Length=421

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +1

Query  94   PRMDGALSASEQQT--LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA  267
            PR     S  +Q    L++SFLE+AVGQ+ +TA++FL+ T+W +EE++ LF + N+   A
Sbjct  31   PRTLSTNSIEQQHDDQLISSFLEVAVGQTVETAKRFLETTNWNIEESINLFLLRNNYDHA  90

Query  268  APSS  279
            A  S
Sbjct  91   AEES  94



>gb|KGN50782.1| hypothetical protein Csa_5G259720 [Cucumis sativus]
Length=164

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = +1

Query  460  MGGSAHEARSVVPFRNFEQEMKHPGVWET-----DXASNSADNLASLYRPPFALM  609
            MG   +E+ S + FRN + E+KH  VW++       + NS DNLASLYRPP+ LM
Sbjct  1    MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLM  55



>ref|XP_006414754.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
 gb|ESQ56207.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
Length=388

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 64/149 (43%), Gaps = 34/149 (23%)
 Frame = +1

Query  166  GQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAPlpdpslssisgs  342
             Q+ +TA+QFL+ATSW LE+A+ LF V G +  ++ P + S                   
Sbjct  2    SQTIETAQQFLKATSWNLEDAINLFLVHGQNKTLSYPQNSS-------------------  42

Query  343  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEM  522
                        +  ++ PPLP IRD LYD++ +   P +     E        + +QE 
Sbjct  43   ----EQYWSDYQEEQQIPPPLPSIRDTLYDSSSMYHQPPVQVGPEE------IWDLKQEA  92

Query  523  KHPGVWETDXASNSADNLASLYRPPFALM  609
               G        +    L+SLYRPP  L+
Sbjct  93   SDSG----SVVGSEDSRLSSLYRPPLKLL  117



>ref|XP_002868299.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44558.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVG  249
            M+ A SA++ Q L++SFL+I VGQS + A QFL+AT+W LE+A+ LF + 
Sbjct  1    MESATSANQLQ-LISSFLDITVGQSVEIALQFLKATNWHLEDAINLFLIA  49



>ref|XP_006414759.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
 gb|ESQ56212.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
Length=418

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  109  ALSASEQ-QTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
            ALS  E+   L++SFLEIAVGQ+ +TA +FL+ T+W +EEA+ LF   N+
Sbjct  35   ALSMDERYDKLISSFLEIAVGQTVETATRFLETTNWNIEEAINLFLFDNN  84



>ref|XP_002886675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +1

Query  112  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV---GNDGGVAAPSSY  282
            + +  Q+ LV+SFLEIAV Q+ +TA + L AT+WK+EEA+ LF++    N      PS  
Sbjct  1    MESDHQRKLVSSFLEIAVDQTVETAIKCLNATNWKVEEAINLFFLIDRRNQSSTQKPSDS  60

Query  283  S  285
            S
Sbjct  61   S  61



>ref|NP_193161.3| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83401.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=821

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 55/171 (32%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  456
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADN-LASLYRPPFAL  606
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSL  118



>ref|NP_001190727.1| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83402.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=815

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 55/171 (32%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  456
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADN-LASLYRPPFAL  606
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSL  118



>emb|CAB10204.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78467.1| hypothetical protein [Arabidopsis thaliana]
Length=724

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 55/171 (32%)
 Frame = +1

Query  100  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  279
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  280  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  456
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  457  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDXASNSADN-LASLYRPPFAL  606
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSL  118



>ref|XP_009139540.1| PREDICTED: UBX domain-containing protein 7-like [Brassica rapa]
Length=412

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  136  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
            L++SFLE+AVGQ+ +TA++FL+ T+W ++E++ LF + N+
Sbjct  48   LISSFLEVAVGQTVETAKRFLETTNWNIDESINLFLLRNN  87



>ref|XP_010519525.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=324

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  109  ALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFY  243
             LS SE+  LV+SFL  A+GQ+ + AR FLQA SW L+EAL  F+
Sbjct  5    TLSESERLRLVSSFLGFAIGQTPEAARWFLQAKSWNLDEALFFFF  49



>ref|XP_010490003.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=320

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  121  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  246
            +E   L+ASF+EI+ GQ+  TA QFL+ATSW LE+A+ LF +
Sbjct  3    NETSELIASFIEISGGQTEKTAFQFLEATSWNLEDAVNLFLI  44



>emb|CDY01206.1| BnaA04g06130D [Brassica napus]
Length=412

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  252
            L++SFLE+AVGQ+ +TA+ FL+ T+W ++E++ LF + N
Sbjct  48   LISSFLEVAVGQTVETAKTFLETTNWNIDESINLFLLRN  86



>ref|XP_009139539.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=387

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  127  QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
            QQ L++SF E+AVGQ+ +T  QFL+  +W LEEA+  F+V ++
Sbjct  62   QQKLISSFTEVAVGQTMETVIQFLETANWNLEEAINHFFVESN  104



>gb|AGH62811.1| UBX1 [Brassica napus]
Length=386

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  100  MDGALSASE-QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  246
             D   +AS+ QQ L+ASF +IAVGQ+ +TA QFL+  +W LE A+  F+V
Sbjct  50   FDETQTASDYQQKLIASFTDIAVGQTMETAIQFLETANWNLEGAINHFFV  99



>emb|CDY12747.1| BnaC04g28940D [Brassica napus]
Length=385

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +1

Query  100  MDGALSASE-QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  255
             D   +AS+ QQ L+ASF +IAVGQ+ +TA QFL+  +W LE A+  F+V ++
Sbjct  49   FDETQTASDYQQKLIASFTDIAVGQTMETAIQFLETANWNLEGAINHFFVESN  101



>gb|KEH28763.1| structural constituent of ribosome protein [Medicago truncatula]
Length=321

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  252
            +S ++T V+ FLEIA G +A TA+ FL++TSW +EEAL+ +  G+
Sbjct  4    SSSEKTSVSIFLEIARGATAATAKHFLESTSWNVEEALEWYLSGD  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230