BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028L06

Length=325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988  62.4    8e-09   Nicotiana sylvestris
ref|XP_009600209.1|  PREDICTED: uncharacterized protein LOC104095723  62.4    9e-09   Nicotiana tomentosiformis
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095  61.6    2e-08   
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018  60.5    3e-08   Solanum tuberosum [potatoes]
ref|XP_011078295.1|  PREDICTED: uncharacterized protein LOC105162074  58.2    2e-07   Sesamum indicum [beniseed]
gb|EYU32954.1|  hypothetical protein MIMGU_mgv1a002908mg              57.4    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_011078293.1|  PREDICTED: uncharacterized protein LOC105162073  57.0    6e-07   Sesamum indicum [beniseed]
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                55.8    1e-06   Citrus sinensis [apfelsine]
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg           55.8    1e-06   
emb|CDP03295.1|  unnamed protein product                              55.5    2e-06   Coffea canephora [robusta coffee]
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                54.3    4e-06   Nicotiana tomentosiformis
gb|AET97563.1|  galactose oxidase                                     53.5    8e-06   Ziziphus jujuba [Chinese jujube]
ref|XP_010674901.1|  PREDICTED: galactose oxidase                     53.5    8e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002510488.1|  Galactose oxidase precursor, putative            53.5    8e-06   
gb|KJB29631.1|  hypothetical protein B456_005G111300                  53.1    1e-05   Gossypium raimondii
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g           53.1    1e-05   
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                53.1    1e-05   Populus euphratica
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                52.4    2e-05   Cucumis melo [Oriental melon]
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211  52.4    2e-05   Setaria italica
ref|XP_007017716.1|  Glyoxal oxidase-related protein                  52.0    2e-05   
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                52.0    2e-05   Citrus sinensis [apfelsine]
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                 52.0    2e-05   Citrus sinensis [apfelsine]
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813  52.0    2e-05   Nicotiana tomentosiformis
emb|CBI19807.3|  unnamed protein product                              52.0    3e-05   Vitis vinifera
gb|EPS57727.1|  hypothetical protein M569_17089                       51.2    3e-05   Genlisea aurea
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                52.0    3e-05   Nicotiana sylvestris
ref|XP_002280559.1|  PREDICTED: galactose oxidase                     51.6    3e-05   Vitis vinifera
ref|XP_009801814.1|  PREDICTED: galactose oxidase                     51.6    3e-05   Nicotiana sylvestris
gb|KJB38605.1|  hypothetical protein B456_006G262900                  51.6    3e-05   Gossypium raimondii
ref|XP_010111102.1|  hypothetical protein L484_008478                 51.6    4e-05   Morus notabilis
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                51.2    4e-05   Nelumbo nucifera [Indian lotus]
gb|KJB38604.1|  hypothetical protein B456_006G262800                  51.2    4e-05   Gossypium raimondii
ref|XP_006387029.1|  hypothetical protein POPTR_2128s00200g           50.4    4e-05   
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg           51.2    4e-05   Prunus persica
ref|XP_006838081.1|  hypothetical protein AMTR_s00225p00021580        51.2    5e-05   
ref|XP_007030653.1|  Glyoxal oxidase-related protein                  51.2    5e-05   
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                51.2    5e-05   Prunus mume [ume]
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                51.2    5e-05   
ref|XP_011457694.1|  PREDICTED: galactose oxidase-like                51.2    5e-05   Fragaria vesca subsp. vesca
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                50.8    5e-05   
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254  50.8    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                50.8    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                50.8    5e-05   Eucalyptus grandis [rose gum]
ref|XP_009606830.1|  PREDICTED: galactose oxidase                     50.8    6e-05   Nicotiana tomentosiformis
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                50.8    6e-05   Prunus mume [ume]
gb|KJB50703.1|  hypothetical protein B456_008G183000                  50.8    6e-05   Gossypium raimondii
ref|XP_010105252.1|  hypothetical protein L484_019394                 50.8    7e-05   Morus notabilis
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg              50.8    7e-05   Erythranthe guttata [common monkey flower]
ref|XP_010660091.1|  PREDICTED: galactose oxidase                     50.4    7e-05   Vitis vinifera
ref|XP_010105253.1|  hypothetical protein L484_019396                 50.4    8e-05   Morus notabilis
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2          50.4    8e-05   Brassica rapa
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                50.4    8e-05   Sesamum indicum [beniseed]
emb|CDY47509.1|  BnaAnng09070D                                        50.4    8e-05   Brassica napus [oilseed rape]
gb|KJB14442.1|  hypothetical protein B456_002G125000                  50.1    9e-05   Gossypium raimondii
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                50.4    9e-05   Cucumis melo [Oriental melon]
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg           50.1    9e-05   
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                50.1    9e-05   Fragaria vesca subsp. vesca
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                50.1    1e-04   Fragaria vesca subsp. vesca
gb|KJB38606.1|  hypothetical protein B456_006G263000                  50.1    1e-04   Gossypium raimondii
gb|KJB58134.1|  hypothetical protein B456_009G196400                  50.1    1e-04   Gossypium raimondii
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                50.1    1e-04   
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                50.1    1e-04   Fragaria vesca subsp. vesca
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                50.1    1e-04   Prunus mume [ume]
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                50.1    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008357159.1|  PREDICTED: galactose oxidase-like                49.7    1e-04   
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                49.7    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2     49.7    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1     49.7    1e-04   
ref|XP_006382737.1|  glyoxal oxidase-related family protein           49.7    1e-04   Populus trichocarpa [western balsam poplar]
gb|KJB38607.1|  hypothetical protein B456_006G263100                  49.7    1e-04   Gossypium raimondii
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                49.7    2e-04   
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1          49.7    2e-04   Brassica rapa
ref|XP_010256224.1|  PREDICTED: galactose oxidase                     49.7    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_011010793.1|  PREDICTED: galactose oxidase                     49.3    2e-04   Populus euphratica
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                49.3    2e-04   Pyrus x bretschneideri [bai li]
gb|KJB45029.1|  hypothetical protein B456_007G286100                  49.3    2e-04   Gossypium raimondii
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  49.3    2e-04   Nicotiana tomentosiformis
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                49.3    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g           49.3    2e-04   
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                49.3    2e-04   Elaeis guineensis
ref|XP_006378160.1|  glyoxal oxidase-related family protein           49.3    2e-04   
emb|CDX73183.1|  BnaC06g36310D                                        49.3    2e-04   
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                49.3    2e-04   
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                48.9    2e-04   Sesamum indicum [beniseed]
emb|CDP08591.1|  unnamed protein product                              48.9    2e-04   Coffea canephora [robusta coffee]
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                48.9    2e-04   Sesamum indicum [beniseed]
ref|XP_002512263.1|  Galactose oxidase precursor, putative            48.9    3e-04   
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg           48.9    3e-04   Eutrema salsugineum [saltwater cress]
gb|KJB59770.1|  hypothetical protein B456_009G270800                  48.9    3e-04   Gossypium raimondii
ref|XP_008367798.1|  PREDICTED: uncharacterized protein LOC103431420  47.0    3e-04   
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                48.9    3e-04   Setaria italica
ref|XP_006828863.1|  hypothetical protein AMTR_s00001p00165980        48.9    3e-04   Amborella trichopoda
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                48.5    3e-04   Nicotiana sylvestris
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                48.5    3e-04   Populus euphratica
ref|NP_173419.1|  glyoxal oxidase-related protein                     48.5    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                48.5    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002520142.1|  conserved hypothetical protein                   48.5    3e-04   
emb|CDY01391.1|  BnaA07g11640D                                        48.5    3e-04   
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                48.5    3e-04   Solanum tuberosum [potatoes]
gb|EMT01589.1|  hypothetical protein F775_04099                       48.5    3e-04   
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                48.5    3e-04   Brassica rapa
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215           48.5    3e-04   
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                48.5    4e-04   Solanum lycopersicum
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                48.1    4e-04   Solanum tuberosum [potatoes]
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                48.1    4e-04   Sesamum indicum [beniseed]
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520        48.1    4e-04   Sorghum bicolor [broomcorn]
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                  48.1    5e-04   Arabis alpina [alpine rockcress]
gb|KDP38596.1|  hypothetical protein JCGZ_04521                       48.1    5e-04   Jatropha curcas
ref|XP_010498415.1|  PREDICTED: galactose oxidase                     48.1    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                48.1    5e-04   Solanum lycopersicum
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                48.1    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006849170.1|  hypothetical protein AMTR_s00027p00175370        47.8    5e-04   
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                47.8    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg           47.8    6e-04   Capsella rubella
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                47.8    6e-04   
ref|NP_001043851.1|  Os01g0677000                                     47.8    6e-04   
gb|EEC71262.1|  hypothetical protein OsI_03252                        47.8    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004147869.1|  PREDICTED: galactose oxidase-like                47.8    6e-04   Cucumis sativus [cucumbers]
gb|KGN60011.1|  hypothetical protein Csa_3G866440                     47.8    6e-04   Cucumis sativus [cucumbers]
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                47.4    7e-04   
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                47.4    7e-04   Tarenaya hassleriana [spider flower]
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                47.4    7e-04   Solanum tuberosum [potatoes]
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg           47.4    8e-04   Capsella rubella
ref|XP_008367686.1|  PREDICTED: uncharacterized protein LOC103431...  45.4    8e-04   
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                47.4    8e-04   Solanum lycopersicum
ref|NP_001170492.1|  hypothetical protein precursor                   47.4    8e-04   Zea mays [maize]
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg              47.4    9e-04   Erythranthe guttata [common monkey flower]
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                47.4    9e-04   Solanum lycopersicum
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                47.4    9e-04   Nicotiana sylvestris
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                47.4    9e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                47.4    0.001   Nicotiana sylvestris
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2     47.0    0.001   Camelina sativa [gold-of-pleasure]
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                47.0    0.001   Camelina sativa [gold-of-pleasure]
ref|XP_007017717.1|  Glyoxal oxidase-related protein                  47.0    0.001   



>ref|XP_009766667.1| PREDICTED: uncharacterized protein LOC104217988 [Nicotiana sylvestris]
Length=624

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            W   + NVGV+AMH+QLM NN+ VW+D  NLG SA+  NP +C+
Sbjct  112  WMVHSPNVGVAAMHIQLMPNNKAVWFDTTNLGPSAIQHNPPFCK  155



>ref|XP_009600209.1| PREDICTED: uncharacterized protein LOC104095723 [Nicotiana tomentosiformis]
Length=619

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            W   + NVGV+AMH+QLM NN+ VW+D  NLG SA+  NP +C+
Sbjct  106  WMVHSPNVGVAAMHIQLMPNNKAVWFDTTNLGPSAIQHNPPFCK  149



>ref|XP_004242940.2| PREDICTED: uncharacterized protein LOC101252095 [Solanum lycopersicum]
Length=558

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +W   + N GV+AMH+QLM NN+ VWYD  NLG SA+  NP +C+
Sbjct  45   TWMIHSPNAGVAAMHIQLMPNNKAVWYDTTNLGPSAIQNNPPFCK  89



>ref|XP_006341271.1| PREDICTED: uncharacterized protein LOC102605018 [Solanum tuberosum]
Length=547

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +W   + N GV+AMH+QLM NN+ VWYD  NLG SA+  NP +C+
Sbjct  34   AWMLHSPNSGVAAMHIQLMPNNKAVWYDTTNLGPSAIQNNPPFCK  78



>ref|XP_011078295.1| PREDICTED: uncharacterized protein LOC105162074 [Sesamum indicum]
Length=630

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            SW+  +EN GVSAMH+QLM NN+ VW+D+ + G S +  NP +C+
Sbjct  104  SWKIDSENAGVSAMHVQLMPNNKAVWFDSTSNGLSEIQNNPPFCK  148



>gb|EYU32954.1| hypothetical protein MIMGU_mgv1a002908mg [Erythranthe guttata]
Length=626

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLM-TNNRVVWYDAINLGRSALMQNPKWCRK  317
            SW+  +EN GVSAMH+QLM  NN+ VWYD+   G S +  NP  CRK
Sbjct  94   SWKIHSENAGVSAMHIQLMPNNNKAVWYDSTGNGLSEIESNPPVCRK  140



>ref|XP_011078293.1| PREDICTED: uncharacterized protein LOC105162073 [Sesamum indicum]
Length=630

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            SW+  +EN GVSAMH+QLM NN+ VW+D+ + G S +  NP  C+
Sbjct  104  SWKIDSENAGVSAMHVQLMPNNKAVWFDSTSNGLSEIQNNPPLCK  148



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = +3

Query  93   ITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAIN  272
            + ++++++ V  + S    P  G   S   W  + E++G+SAMHMQL+ +NRV+ +D  +
Sbjct  13   LQLSFHFIFVPLIPSQVLPPYAG---SQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTD  69

Query  273  LGRSALMQNPKWCRKD  320
             G+S L  +   CR D
Sbjct  70   FGQSNLSLSSGRCRFD  85



>ref|XP_006433075.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
 gb|ESR46315.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
Length=546

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = +3

Query  93   ITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAIN  272
            + ++++++ V  + S    P  G   S   W  + E++G+SAMHMQL+ +NRV+ +D  +
Sbjct  13   LQLSFHFIFVPLIPSQVLPPYAG---SQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTD  69

Query  273  LGRSALMQNPKWCRKD  320
             G+S L  +   CR D
Sbjct  70   FGQSNLSLSSGRCRFD  85



>emb|CDP03295.1| unnamed protein product [Coffea canephora]
Length=897

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+  +EN GVSAM  QL+ NN+ VW+D  NLG S L  +P +C  +
Sbjct  83   WEIHSENAGVSAMQFQLLPNNKAVWFDTTNLGPSGLQFDPPYCHPN  128



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +3

Query  90   SITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAI  269
            S ++ ++ +L LFV  +  +P    + +   W  +  N+G+SAMHMQL+ N++VV +D  
Sbjct  6    STSILFFILLHLFVLLSCHRPNFA-SAAGGKWNILMSNIGISAMHMQLLNNDKVVIFDRT  64

Query  270  NLGRSALMQNPKWCRKD  320
            + G S +      CR D
Sbjct  65   DFGHSNISLPDGKCRND  81



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +3

Query  90   SITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAI  269
            ++ +++ ++L  F    +  P L  + +   WQ + +++G+SAMHMQL+ N+RVV +D  
Sbjct  4    ALILSFLFLLPHF----FAGPPLFADAAGGQWQLLQKSIGISAMHMQLLNNDRVVIFDRT  59

Query  270  NLGRSALMQNPKWCRKD  320
            + G S L      CR D
Sbjct  60   DFGPSNLSLPAGKCRND  76



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
             WQ + EN+G+SAMHMQLM NN+V+ +D  + G S L      CR D
Sbjct  32   EWQVLQENIGISAMHMQLMQNNKVIMFDRTDFGPSNLSLPFGRCRND  78



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ + EN+G++AMHMQL+ N+RVV +D  + G S L      CRKD
Sbjct  29   AGGRWQLLQENIGITAMHMQLLNNDRVVIFDRTDFGLSNLSLPNGKCRKD  78



>gb|KJB29631.1| hypothetical protein B456_005G111300 [Gossypium raimondii]
Length=548

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYG-KPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWY  260
            M+S+T     +L   +C+++  +  L    +   WQ + +++G+SAMHMQL++N+RVV +
Sbjct  1    MSSLTFILSVLLFQLLCTSHPCQRILTSAAAGGRWQLLQKSIGISAMHMQLLSNDRVVAF  60

Query  261  DAINLGRSALMQNPKWCRKD  320
            D  + G S L      CR D
Sbjct  61   DRTDFGPSNLPLPKGKCRFD  80



>ref|XP_006383732.1| hypothetical protein POPTR_0005s25680g [Populus trichocarpa]
 gb|ERP61529.1| hypothetical protein POPTR_0005s25680g [Populus trichocarpa]
Length=487

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +N+G+ AMHMQL+ N+RVV YD  + GRS L      CR D
Sbjct  33   WQLLQKNIGIVAMHMQLLNNDRVVIYDRTDFGRSNLSLPGGKCRDD  78



>ref|XP_011028961.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=598

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
               WQ +  ++G++AMHMQL++N+RVV YD  + GRS L      CR D
Sbjct  78   GGQWQLLQNSIGITAMHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRND  126



>ref|XP_008466509.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=555

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +3

Query  159  GMNPSAS---SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            G+ P+A+   SW+ +  NVG+SAMHMQL+ N+RVV YD  + G S L      C +D
Sbjct  32   GLPPTAAAGGSWRLLQRNVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGGKCLRD  88



>ref|XP_004969528.1| PREDICTED: uncharacterized protein LOC101774211 [Setaria italica]
Length=624

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKW-CRKD  320
            A +W T+TEN GVSAMHM +M N+R + +D +  G S L++ PK  CR D
Sbjct  104  AGAWSTITENAGVSAMHMVIMRNDRAIMFDTVTTGPS-LLRLPKGNCRLD  152



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +3

Query  93   ITVAYYYVLVLFVCSAYGKP--XLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDA  266
            +T  + + ++LF      +P   + ++ +   WQ + +++GVSAMHMQL+ N+RVV +D 
Sbjct  1    MTPTFIFSILLFQLLFASQPYHLILISAADGRWQLLQKSIGVSAMHMQLLRNDRVVMFDR  60

Query  267  INLGRSALMQNPKWCRKD  320
             + G+S L      CR D
Sbjct  61   TDFGKSNLPLPNGKCRTD  78



>ref|XP_006473606.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +3

Query  105  YYYVLVLF---VCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINL  275
            Y ++++LF   +CS      +  + +   WQ + +++G+S+MHMQL+ N+RVV +D  + 
Sbjct  4    YSFIVLLFQLILCSH----RIVTDAAGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDF  59

Query  276  GRSALMQNPKWCRKDD  323
            G S L   P  C K D
Sbjct  60   GPSNLSLPPGKCLKTD  75



>gb|KDO84767.1| hypothetical protein CISIN_1g009420mg [Citrus sinensis]
Length=535

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +3

Query  105  YYYVLVLF---VCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINL  275
            Y ++++LF   +CS      +  + +   WQ + +++G+S+MHMQL+ N+RVV +D  + 
Sbjct  4    YSFIVLLFQLILCSH----RIVTDAAGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDF  59

Query  276  GRSALMQNPKWCRKDD  323
            G S L   P  C K D
Sbjct  60   GPSNLSLPPGKCLKTD  75



>ref|XP_009594288.1| PREDICTED: uncharacterized protein LOC104090813 [Nicotiana tomentosiformis]
Length=581

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            S   W T+ E++GVSAMHMQL+ NN+VV +D  + G S L      CR +D
Sbjct  58   SGGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPDGKCRYND  108



>emb|CBI19807.3| unnamed protein product [Vitis vinifera]
Length=486

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ + +N+G++AMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  36   AGGEWQLLLKNIGITAMHMQLLHNDRVVIFDRTDFGKSNLSLPDGKCRND  85



>gb|EPS57727.1| hypothetical protein M569_17089, partial [Genlisea aurea]
Length=347

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLM-TNNRVVWYDAINLGRSALMQNPKWCR  314
            W   +EN GVSAMH+QLM  NN+ VW+D+ + G S +  NP  CR
Sbjct  26   WILHSENAGVSAMHIQLMPNNNKAVWFDSTSNGLSEIRNNPPLCR  70



>ref|XP_009782130.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=588

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            S   W T+ E++GVSAMHMQL+ NN+VV +D  + G S L      CR +D
Sbjct  63   SGGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPDGKCRYND  113



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ + +N+G++AMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  36   AGGEWQLLLKNIGITAMHMQLLHNDRVVIFDRTDFGKSNLSLPDGKCRND  85



>ref|XP_009801814.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=560

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
             W+ + E++GVSAMHMQL+ NN+VV +D  + GRS L      CR D
Sbjct  35   EWRLLHESIGVSAMHMQLLRNNKVVIFDRTDFGRSNLSLPGGRCRYD  81



>gb|KJB38605.1| hypothetical protein B456_006G262900 [Gossypium raimondii]
Length=548

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            SWQ + ++VG+SAMHMQL+ N+RV+ +D  + G S L+     CR D
Sbjct  33   SWQLLQKSVGISAMHMQLLRNDRVIMFDRTDFGPSNLLLPNGKCRND  79



>ref|XP_010111102.1| hypothetical protein L484_008478 [Morus notabilis]
 gb|EXC30148.1| hypothetical protein L484_008478 [Morus notabilis]
Length=544

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ + +++G++AMHMQL+ N+RVV +D  + GRS L      CR D
Sbjct  25   AGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRND  74



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            SW+ + +++G+SAMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  34   SWELLQKSIGISAMHMQLLYNDRVVIFDRTDFGKSELALPQGKCRTD  80



>gb|KJB38604.1| hypothetical protein B456_006G262800 [Gossypium raimondii]
Length=459

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  +WQ + +++G+SAMHMQL+ N+RV+ +D  + G S L  + + CR D
Sbjct  29   AGGTWQLLQKSIGISAMHMQLLRNDRVIMFDRTDFGPSNLSLSNRKCRND  78



>ref|XP_006387029.1| hypothetical protein POPTR_2128s00200g, partial [Populus trichocarpa]
 gb|ERP45943.1| hypothetical protein POPTR_2128s00200g, partial [Populus trichocarpa]
Length=304

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            S   W  ++E+VG+SAMHMQLM +N+VV YD  + G S +      CR D
Sbjct  34   SHGRWDLLSESVGISAMHMQLMHDNKVVIYDRTDFGPSNISLPGGLCRAD  83



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  + +N+G+SAMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  28   AGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPEGQCRND  77



>ref|XP_006838081.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
 gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 6/69 (9%)
 Frame = +3

Query  114  VLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALM  293
            +L L VC       LG      SW+ + EN G+SAMHM L++N +VV +D  + G+S L 
Sbjct  13   LLPLLVCMFGAIAQLG------SWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLS  66

Query  294  QNPKWCRKD  320
                 CR D
Sbjct  67   LPAGRCRSD  75



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYGKPXLGMNPSA--SSWQTVTENVGVSAMHMQLMTNNRVVW  257
            + S++ +Y + LV           L +NP+    +WQ +  +VG+SAMHMQL+ NN+V+ 
Sbjct  6    LCSLSFSYLFSLVT-------SQVLPLNPAGRQGAWQLLHASVGISAMHMQLLHNNKVII  58

Query  258  YDAINLGRSALMQNPKWCRKD  320
            +D  + G S L      CR D
Sbjct  59   FDRTDFGPSNLSLPSGLCRID  79



>ref|XP_008221409.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=540

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + +N+G+SAMHMQL+ N+RVV +D  N G S L      C  +D
Sbjct  30   AGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTNFGNSNLSLPDGKCVGND  80



>ref|XP_008338258.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + +NVG+SAMHMQL+ N+RV+ +D  + G+S L      C ++D
Sbjct  30   AGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLPNGTCVRND  80



>ref|XP_011457694.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ + +NVG+SAMHMQL+ N+RVV +D  N G S L      CRK+
Sbjct  32   WELLLKNVGISAMHMQLLHNDRVVMFDRTNFGPSNLSLPNGVCRKN  77



>ref|XP_008367966.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + +NVG+SAMHMQL+ N+RV+ +D  + G+S L      C ++D
Sbjct  30   AGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLPNGTCVRND  80



>ref|XP_010688268.1| PREDICTED: uncharacterized protein LOC104902254 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            A  W+ V+ N GVSAMH+QLM  N++V +DA +LG+S++      CR
Sbjct  35   AGKWEIVSPNSGVSAMHLQLMPTNKLVMFDATSLGKSSIELPKGRCR  81



>ref|XP_010271447.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=553

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
               W  +  ++G+SAMHMQL+ N+RVV +D  + GRS L      CR D
Sbjct  36   GGKWDLLKHSIGISAMHMQLLHNDRVVIFDRTDFGRSMLALPHGKCRHD  84



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ +  N+G+ AMHMQL+ N+RVV YD  + G+S L      CR D
Sbjct  47   WQLLQSNIGIVAMHMQLLHNDRVVIYDRTDFGKSNLSLPDGKCRHD  92



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ + E++GVSAMHMQL+ NN+VV +D  + GRS L      CR D
Sbjct  36   WRLLHESIGVSAMHMQLLRNNKVVIFDRTDFGRSNLSLPGGRCRYD  81



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  + +N+G+SAMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  28   AGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPKGKCRND  77



>gb|KJB50703.1| hypothetical protein B456_008G183000 [Gossypium raimondii]
Length=559

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +3

Query  165  NPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNP-KWCRKDD  323
            N S  +WQ +  +VGVSAMH+QL+ NN+VV +D  + G S +   P  +C K+D
Sbjct  41   NVSGGNWQLLQSSVGVSAMHLQLLPNNKVVIFDRTDFGSSNISLPPGSFCPKND  94



>ref|XP_010105252.1| hypothetical protein L484_019394 [Morus notabilis]
 gb|EXC04187.1| hypothetical protein L484_019394 [Morus notabilis]
Length=544

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ + +++G+ AMHMQL+ N+RVV +D  + GRS L      CR D
Sbjct  25   AGGRWQLLQKSIGIPAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRND  74



>gb|EYU22441.1| hypothetical protein MIMGU_mgv1a024085mg [Erythranthe guttata]
Length=596

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  PSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            P    W  + E+VGVSAMHMQL+ NN++V +D  + G S L      CR D
Sbjct  75   PGVGEWSLLQESVGVSAMHMQLLHNNKIVIFDRADFGSSNLSLPAGKCRFD  125



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +3

Query  111  YVLVLFVCSAYGKPXLGMNPSAS----SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLG  278
            ++L+    + +  P       A+     W  +  ++G+SAMHMQL+ NN+VV +D  + G
Sbjct  5    FILLSIFFTVFSAPDFSQTLPATVNQGEWHLLHASIGISAMHMQLLWNNKVVIFDRTDFG  64

Query  279  RSALMQNPKWCRKD  320
             S L   P  CR D
Sbjct  65   PSNLSLPPHLCRHD  78



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQT+  ++GVSAMHMQL+  +RVV +D  + G+S L      CR D
Sbjct  30   WQTLQTSIGVSAMHMQLLNTDRVVIFDRTDFGKSNLSLPDGKCRND  75



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYD  263
            ++ I    Y+ L+LF+  ++       + +  +W+ +  NVG+SAMH QL+ N+RV+ YD
Sbjct  10   LSDINHLLYFALILFLSLSFHV----ASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  264  AINLGRSALMQNPKWCR  314
              N G S +      CR
Sbjct  66   RSNFGPSKISLPNGTCR  82



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  PSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            P    W  V  N+GVSAMHMQL+  +RVV +D  + G S +      CR D
Sbjct  35   PGGGKWNLVLSNIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNQCRND  85



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYD  263
            ++ I    Y+ L+LF+  ++       + +  +W+ +  NVG+SAMH QL+ N+RV+ YD
Sbjct  10   LSDINHLLYFALILFLSLSFHV----ASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  264  AINLGRSALMQNPKWCR  314
              N G S +      CR
Sbjct  66   RSNFGPSKISLPNGTCR  82



>gb|KJB14442.1| hypothetical protein B456_002G125000 [Gossypium raimondii]
Length=485

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (52%), Gaps = 4/77 (5%)
 Frame = +3

Query  90   SITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAI  269
            S    + + L+LF      +P +    +   WQ + +++G+S+MHMQL+ N+RVV YD  
Sbjct  5    STLCTFLFSLLLFAS----QPLILPTAADGRWQLLQKSIGISSMHMQLLKNDRVVMYDRT  60

Query  270  NLGRSALMQNPKWCRKD  320
            + G S L      C  D
Sbjct  61   DFGPSTLPLASGKCHND  77



>ref|XP_008444780.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=563

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 39/82 (48%), Gaps = 6/82 (7%)
 Frame = +3

Query  93   ITVAYYYVLVLFVCSAYGKPXLGMNP------SASSWQTVTENVGVSAMHMQLMTNNRVV  254
            +   Y+YV +L     + +    ++P          W  + EN+GV  MHMQL+ N+RVV
Sbjct  11   VRATYFYVTMLLRTLLFAEFLFPVSPWPSQPIDGGGWHLLQENIGVLPMHMQLLHNDRVV  70

Query  255  WYDAINLGRSALMQNPKWCRKD  320
             +D  + G S L      CR D
Sbjct  71   IFDRTDFGASNLSFPDGKCRTD  92



>ref|XP_006435123.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
 gb|ESR48363.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
Length=521

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + +++G+S+MHMQL+ N+RVV +D  + G S L   P  C K D
Sbjct  11   AGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDFGPSNLSLPPGKCLKTD  61



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ +  NVG+SAMHMQL+ N+RVV +D  + G+S L      CR +
Sbjct  35   AGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLSLPNGVCRNN  84



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ +  NVG+SAMHMQL+ N+RVV +D  + G+S L      CR +
Sbjct  35   AGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLPLPNGRCRNN  84



>gb|KJB38606.1| hypothetical protein B456_006G263000 [Gossypium raimondii]
Length=549

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            SWQ + +++G+SAMHMQL+ N+RV+ +D  + G S L      CR D
Sbjct  34   SWQLLQKSIGISAMHMQLLRNDRVIMFDRTDFGPSNLPLPTGKCRND  80



>gb|KJB58134.1| hypothetical protein B456_009G196400 [Gossypium raimondii]
Length=549

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ +  ++G+SAMHMQL+ N+RVV +D  + G+S L      CR D
Sbjct  34   WQLLQTSIGISAMHMQLLRNDRVVIFDRTDFGKSNLSLPNGKCRND  79



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  + +N+G++AMHMQL+ N+RVV YD  + G S L      CR+D
Sbjct  29   ATGKWVLLQQNIGITAMHMQLLHNDRVVIYDRTDFGMSNLSLPDGKCRED  78



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ +T+NVG+SAMHMQL+ N+RVV +D  + G S L      CR +
Sbjct  32   WELLTKNVGISAMHMQLLHNDRVVMFDRTDFGASNLSLPNGVCRNN  77



>ref|XP_008221311.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=535

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + +N+G+SAMHMQL+ N+RVV +D  + G+S L      C  +D
Sbjct  25   AGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPDGKCVGND  75



>ref|XP_010670864.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=617

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +++GVSAMHMQL+ N+RV+  D  + G S +  +   CRKD
Sbjct  97   WQLLQKSIGVSAMHMQLLNNDRVIILDRTDFGPSNISLSNGKCRKD  142



>ref|XP_008357159.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=401

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + ++VG+SAMHMQL+ N+RV+ +D  + G+S L      C ++D
Sbjct  23   AGGKWQLLQQSVGISAMHMQLLRNDRVIMFDRTDFGKSNLALPNGECVRND  73



>ref|XP_009337676.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + ++VG+SAMHMQL+ N+RVV +D  + G+S L      C ++D
Sbjct  23   AGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLSLPNGECVRND  73



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 10/73 (14%)
 Frame = +3

Query  99   VAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLG  278
            +A++++L   + S  G           +W+ +  NVG+SAMH QL+ N+RV+ YD  N G
Sbjct  19   LAFFFLLSCHLTSGAG----------GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFG  68

Query  279  RSALMQNPKWCRK  317
             S +      CRK
Sbjct  69   PSNISLPNGACRK  81



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 10/73 (14%)
 Frame = +3

Query  99   VAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLG  278
            +A++++L   + S  G           +W+ +  NVG+SAMH QL+ N+RV+ YD  N G
Sbjct  19   LAFFFLLSCHLTSGAG----------GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFG  68

Query  279  RSALMQNPKWCRK  317
             S +      CRK
Sbjct  69   PSNISLPNGACRK  81



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            S   W  ++E+VG+SAMHMQLM +N+VV YD  + G S +      CR D
Sbjct  34   SHGRWDLLSESVGISAMHMQLMHDNKVVIYDRTDFGPSNISLPGGLCRAD  83



>gb|KJB38607.1| hypothetical protein B456_006G263100 [Gossypium raimondii]
Length=549

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            SWQ + +++G+SAMHMQL+ N+RV+ +D  + G S L      CR D
Sbjct  34   SWQILQKSIGISAMHMQLLRNDRVIMFDRTDFGPSNLSLPNGKCRND  80



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + ++VG+SAMHMQL+ N+RV+ +D  + G+S L      C ++D
Sbjct  23   AGGKWQLLQQSVGISAMHMQLLRNDRVIMFDRTDFGKSNLALPNGECVRND  73



>ref|XP_009106212.1| PREDICTED: galactose oxidase isoform X1 [Brassica rapa]
Length=560

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYD  263
            ++ I    Y+ L+LF+  ++       + +  +W+ +  NVG+SAMH QL+ N+RV+ YD
Sbjct  10   LSDINHLLYFALILFLSLSFHVA----SGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  264  AINLGRSALMQNPKWCR  314
              N G S +      CR
Sbjct  66   RSNFGPSKISLPNGTCR  82



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ +  N+G+SAMHMQL+ NN+VV +D  + G S L   P  CR D
Sbjct  38   WRLLHTNIGLSAMHMQLLHNNKVVMFDRTDFGPSNLSLPPGRCRFD  83



>ref|XP_011010793.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=544

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +  +W  + E++G+SAMHMQ++ NN+V+ +D  + GRS L      CR  D
Sbjct  18   TGGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGECRYKD  68



>ref|XP_009337669.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + ++VG+SAMHMQL+ N+RVV +D  + G+S L      C ++D
Sbjct  23   AGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLPLPNGECVRND  73



>gb|KJB45029.1| hypothetical protein B456_007G286100 [Gossypium raimondii]
Length=547

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
             WQ + E+VG+SAMHMQL+ NN+V+ +D  + G S L      CR D
Sbjct  32   EWQLLHESVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPNGICRVD  78



>ref|XP_009625411.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Nicotiana 
tomentosiformis]
Length=550

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +3

Query  165  NPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            N +   WQ +  N+G+SAMHMQL+ N+RV+ YD  + G S +      CR +
Sbjct  30   NAAGGQWQLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNN  81



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  LVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQ  296
            L+ F+C       L        W+ +  ++GVSAMHMQL++N+RV+ +D  + G S L  
Sbjct  10   LLFFLC-------LATASGGGQWELLQPSIGVSAMHMQLLSNDRVIVFDRTDFGPSNLSL  62

Query  297  NPKWCRKD  320
                CR D
Sbjct  63   PGGRCRND  70



>ref|XP_006383733.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
 gb|ERP61530.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
Length=557

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +N+G+ AMHMQL+ N+RVV YD  + G+S +      CR D
Sbjct  35   WQLLQKNIGIVAMHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRND  80



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W  +  ++GVSAMHMQL+ N+RV+ +D  + GRS L      CR D
Sbjct  29   WDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPDGKCRND  74



>ref|XP_006378160.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP55957.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=544

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +  +W  + E++G+SAMHMQ++ NN+V+ +D  + GRS L      CR  D
Sbjct  18   TGGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGKCRYKD  68



>emb|CDX73183.1| BnaC06g36310D [Brassica napus]
Length=552

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 39/77 (51%), Gaps = 6/77 (8%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYD  263
            ++ I    Y+ L+LF+         G      +W+ +  NVG+SAMH QL+ N+RV+ YD
Sbjct  10   LSDINHLLYFALILFLSFHVASGAGG------TWKLLLNNVGISAMHSQLLINDRVIMYD  63

Query  264  AINLGRSALMQNPKWCR  314
              N G S +      CR
Sbjct  64   RSNFGPSKISLPNGTCR  80



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  + +N+G++AMH+QL+ N+RVV YD  + G S L      CR+D
Sbjct  29   AGGKWVLLQQNIGITAMHLQLLHNDRVVIYDRTDFGMSNLSLPDGKCRED  78



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  PSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            P    W  +  N+GVSAMHMQL+  +RV+ +D  + G S +      CR D
Sbjct  35   PGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRND  85



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
             W+ + E +G+SAMHMQL+ NNRV+ +D  + G S +      CR+D
Sbjct  38   EWRLLQECIGISAMHMQLLHNNRVIMFDRTDFGNSNISLPGGRCRRD  84



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  PSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            P    W  +  N+GVSAMHMQL+  +RV+ +D  + G S +      CR D
Sbjct  35   PGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRND  85



>ref|XP_002512263.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF49715.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=533

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W  +  N+G++AMHMQL+ +N+V+ YD  + GRS +    + CR D
Sbjct  36   WNQLQSNIGITAMHMQLLHDNKVIIYDRTDFGRSNVSLPHRRCRHD  81



>ref|XP_006417012.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
 gb|ESQ35365.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
Length=564

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +   W  +  +VG+SAMHMQL+ NN+VV +D  + G S L   P+ CR
Sbjct  39   AGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLPLPPQMCR  86



>gb|KJB59770.1| hypothetical protein B456_009G270800 [Gossypium raimondii]
Length=547

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +++GVSAMHMQL+ N+RVV +D  + G S L      CR D
Sbjct  34   WQLLQKSIGVSAMHMQLLRNDRVVVFDRTDFGPSKLPLPNGKCRND  79



>ref|XP_008367798.1| PREDICTED: uncharacterized protein LOC103431420 [Malus domestica]
Length=183

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTN-NRVVWYDAINLGRSALMQNPKWCRK  317
            W+ V+EN GVSAMHM +M N N+ + +DA   G+S +   P  CR+
Sbjct  61   WEXVSENSGVSAMHMTIMPNSNKAIMFDAAGFGQSEISLPPGDCRR  106



>ref|XP_004984953.1| PREDICTED: galactose oxidase-like [Setaria italica]
Length=575

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +3

Query  159  GMNPSASS---WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            G+ P++ S   W  +  ++GVSAMHMQL+ N+RV+ +D  + GRS L      CR
Sbjct  29   GIAPASGSGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPGGRCR  83



>ref|XP_006828863.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
 gb|ERM96279.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
Length=546

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +W+ + +++G+SAMHMQLM N++VV +D  + G S +      CR D
Sbjct  32   AWEVLQQSIGISAMHMQLMPNDKVVMFDRTDFGSSNISLPSGQCRTD  78



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ +  N+G+SAMHMQL+ N+RV+ YD  + G S +      CR +
Sbjct  27   AGGKWQLLKSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGRCRNN  76



>ref|XP_011045139.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=549

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +++G+ AMHMQL+ N+ VV YD  + GRS L      CR D
Sbjct  33   WQLLQKSIGIVAMHMQLLNNDHVVIYDRTDFGRSNLSLPGGKCRDD  78



>ref|NP_173419.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAL24259.1| At1g19900/F6F9_4 [Arabidopsis thaliana]
 gb|AEE29911.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=548

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ +  NVG+SAMHMQL+ N+RVV YD  N G S +      CR +
Sbjct  33   WKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDN  78



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W  + +++G+SAMHMQL+ N+RVV +D  + G S L      CR D
Sbjct  36   WDLLQQSIGISAMHMQLLNNDRVVIFDRTDFGESKLPLPDGKCRND  81



>ref|XP_002520142.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42197.1| conserved hypothetical protein [Ricinus communis]
Length=567

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 6/85 (7%)
 Frame = +3

Query  84   MASITVAYYYVLVLFVCSA-----YGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNR  248
            + SI + +   L  F  S      Y +P   M  +   W  + E++G+SAMH+Q++ NN+
Sbjct  7    IPSILIIFPLALTFFTLSTSQNLPYMQPYFSMI-TGGRWVLLQESIGISAMHIQVLKNNK  65

Query  249  VVWYDAINLGRSALMQNPKWCRKDD  323
            V+ +D  + G S L      CR +D
Sbjct  66   VIMFDRTDFGHSNLSLPYGKCRFND  90



>emb|CDY01391.1| BnaA07g11640D [Brassica napus]
Length=556

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  +  NVG+SAMHMQL++N+RVV +D  N G S +      CR++
Sbjct  28   AGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRN  77



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
              SW  +  N+G+SAMHMQL+ N+RVV +D  + G S +      CR D
Sbjct  44   GGSWNLLLSNIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYD  92



>gb|EMT01589.1| hypothetical protein F775_04099 [Aegilops tauschii]
Length=566

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +3

Query  114  VLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALM  293
            VLVL +  A   P  G       W  +  ++GVSAMHMQL+ N+RV+ +D  + G+S L 
Sbjct  12   VLVLALACAGIAPASGGG--GGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLS  69

Query  294  QNPKWCRKD  320
                 CR++
Sbjct  70   LPDGRCRRN  78



>ref|XP_009103376.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   W  +  NVG+SAMHMQL++N+RVV +D  N G S +      CR++
Sbjct  28   AGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRN  77



>ref|XP_002893079.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69338.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ +  NVG+SAMHMQL+ N+RVV YD  N G S +      CR +
Sbjct  33   WKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDN  78



>ref|XP_004237211.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=572

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            W  + E++GVSAMHMQL+ NN+V+ +D  + G S L      CR DD
Sbjct  58   WVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFDD  104



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            W  + E++GVSAMHMQL+ NN+V+ +D  + G S L      CR DD
Sbjct  58   WVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFDD  104



>ref|XP_011071032.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=607

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
               W  + E +GVSAMHMQL+ NN+V+ +D  + G S L      CR  D
Sbjct  82   GGEWSLLQETIGVSAMHMQLLYNNKVLIFDRTDFGPSNLTLPSGKCRHSD  131



>ref|XP_002446737.1| hypothetical protein SORBIDRAFT_06g021520 [Sorghum bicolor]
 gb|EES11065.1| hypothetical protein SORBIDRAFT_06g021520 [Sorghum bicolor]
Length=563

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKW-CR  314
            +  SW+ +  +VGVS MHMQL+ N+RV+ +D  N G+S L   P   CR
Sbjct  29   AGGSWKLLQSSVGVSGMHMQLLHNDRVILFDRTNFGQSNLTFPPGHPCR  77



>gb|KFK43688.1| hypothetical protein AALP_AA1G160100 [Arabis alpina]
Length=560

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +   W  +  +VG+SAMHMQL+ NN+VV +D  + G S L+  P+ C+
Sbjct  39   TGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLLLPPQTCQ  86



>gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            WQ + +++G++AMHMQL+ N+RVV +D  + G S L      CR D
Sbjct  35   WQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGISNLSLPEGQCRDD  80



>ref|XP_010498415.1| PREDICTED: galactose oxidase [Camelina sativa]
Length=549

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  NVG+SAMHMQL+ N+RVV +D  N G S +      CR +
Sbjct  29   AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDN  78



>ref|XP_004238325.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=547

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +3

Query  165  NPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            N +   W  +  N+G+SAMHMQL+ N+RV+ YD  + G S +      CR +
Sbjct  27   NAAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNN  78



>ref|XP_010459669.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  NVG+SAMHMQL+ N+RVV +D  N G S +      CR +
Sbjct  29   AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDN  78



>ref|XP_006849170.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
 gb|ERN10751.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
Length=560

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  156  LGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            L +      W+ +  ++G+SAMHM L+ NNRV+ +D  + G S +      CRKD
Sbjct  34   LALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLPNGRCRKD  88



>ref|XP_010477216.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  NVG+SAMHMQL+ N+RVV +D  N G S +      CR +
Sbjct  29   AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDN  78



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  NVG+SAMHMQL+ N+RVV +D  N G S +      CR +
Sbjct  29   AGGSWNVLLPNVGISAMHMQLLHNDRVVMFDRTNFGPSNISLPNGNCRNN  78



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
               W+ +  ++GVSAMHMQL+ N+RVV +D  + G S L      CR D
Sbjct  30   GGEWKLLQHSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPDGRCRND  78



>ref|NP_001043851.1| Os01g0677000 [Oryza sativa Japonica Group]
 dbj|BAB90014.1| glyoxal oxidase precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05765.1| Os01g0677000 [Oryza sativa Japonica Group]
 dbj|BAG97907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55169.1| hypothetical protein OsJ_02994 [Oryza sativa Japonica Group]
Length=624

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            A  W  V+EN GVSAMH+ +M + + + +D    GRS +   P  CR D
Sbjct  105  AGGWNLVSENSGVSAMHLVVMQHGKAIMFDTCTTGRSLMRLPPGRCRPD  153



>gb|EEC71262.1| hypothetical protein OsI_03252 [Oryza sativa Indica Group]
Length=624

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            A  W  V+EN GVSAMH+ +M + + + +D    GRS +   P  CR D
Sbjct  105  AGGWNLVSENSGVSAMHLVVMQHGKAIMFDTCTTGRSLMRLPPGRCRPD  153



>ref|XP_004147869.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004170844.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=548

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  +VG+SAMHMQL+ N+RVV YD  + G S L      C +D
Sbjct  28   AGGSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGGKCLRD  77



>gb|KGN60011.1| hypothetical protein Csa_3G866440 [Cucumis sativus]
Length=560

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +  SW  +  +VG+SAMHMQL+ N+RVV YD  + G S L      C +D
Sbjct  40   AGGSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGGKCLRD  89



>ref|XP_008377171.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKDD  323
            +   WQ + + VG+SAMHMQL+ N+RV  +D  + G+S L      C ++D
Sbjct  23   AGGKWQLLQQXVGISAMHMQLLRNDRVXMFDRTDFGKSNLXLPNGECVRND  73



>ref|XP_010536368.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=557

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
              SWQ +  NVG+SAMHMQL+ N+RV+ +D  + G S +      CR +
Sbjct  37   GGSWQLLQLNVGISAMHMQLLHNDRVITFDRTDFGPSNISLPSGKCRNN  85



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +3

Query  165  NPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            N +   W  +  N+G+SAMHMQL+ N+RV+ YD  + G S +      CR +
Sbjct  31   NAAGGKWDLLMPNIGISAMHMQLLNNDRVIMYDRTDFGASNIPLPDGKCRNN  82



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +  SW+ +  NVG+SAMH QL+ N+RV+ YD  N G S +      CR
Sbjct  33   AGGSWKLLLSNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACR  80



>ref|XP_008367686.1| PREDICTED: uncharacterized protein LOC103431318 isoform X2 [Malus 
domestica]
Length=157

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTN-NRVVWYDAINLGRSALMQNPKWCRK  317
            W+ V+EN GVSAMHM +M N N+ + +DA   G S +   P  CR+
Sbjct  61   WELVSENSGVSAMHMTIMPNSNKAIMFDAAGFGPSEISLPPGDCRR  106



>ref|XP_004238324.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=545

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +3

Query  165  NPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            N +   W  +  N+G+SAMHMQL+ N+RV+ YD  + G S +      CR +
Sbjct  26   NAAGGKWDLLMSNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPNGKCRNN  77



>ref|NP_001170492.1| hypothetical protein precursor [Zea mays]
 gb|ACR33858.1| unknown [Zea mays]
 tpg|DAA58142.1| TPA: hypothetical protein ZEAMMB73_943613 [Zea mays]
Length=618

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +3

Query  72   RVSPMASITVAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRV  251
            +V P ++ T      +VL V +A G P         +W  ++EN GVSAMH+ +M +++ 
Sbjct  73   KVPPRSAPTAVAQDTVVLPVDNAAGFP--------GAWSIISENAGVSAMHLVIMRSDKA  124

Query  252  VWYDAINLGRSALMQNPKW-CRKD  320
            + +D +  G S L++ PK  CR D
Sbjct  125  IMFDTVTTGPS-LLRLPKGNCRLD  147



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            W+ + E++G+SAMHMQL+ NN++V +D  + G S L      CR D
Sbjct  6    WRLLHESIGISAMHMQLLKNNKLVIFDRTDFGPSNLSLPDGRCRSD  51



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  174  ASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
              SW  +  ++G+SAMHMQL+ N+RVV +D  + G S +      CR D
Sbjct  46   GGSWNVLLSDIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYD  94



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ +  N+G+SAMH+QL+ N+RV+ YD  + G S +      CR +
Sbjct  32   AGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNN  81



>ref|XP_010428587.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=548

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 10/73 (14%)
 Frame = +3

Query  99   VAYYYVLVLFVCSAYGKPXLGMNPSASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLG  278
            +A+++ L   + S  G           +W+ +  NVG+SAMH QL+ N+RV+ YD  N G
Sbjct  19   LAFFFFLSCHLTSGAG----------GTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFG  68

Query  279  RSALMQNPKWCRK  317
             S +      CR+
Sbjct  69   PSNISLPHGACRQ  81



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRKD  320
            +   WQ +  N+G+SAMH+QL+ N+RV+ YD  + G S +      CR +
Sbjct  32   AGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNN  81



>ref|XP_010416451.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=516

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCRK  317
            +  +W+ +  NVG+SAMH QL+ N+RV+ YD  N G S +      CR+
Sbjct  33   AGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQ  81



>ref|XP_010476497.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  171  SASSWQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSALMQNPKWCR  314
            +   W  +  +VG+SAMHMQL+ NN+VV +D  + G S L   P  C+
Sbjct  40   TGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQ  87



>ref|XP_007017717.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14942.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  183  WQTVTENVGVSAMHMQLMTNNRVVWYDAINLGRSAL  290
            WQ + +++GVSAMHMQL+ N+RVV +D  + G+S L
Sbjct  33   WQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNL  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568775281920