BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028K15

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622651.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  79.3    1e-14   Nicotiana tomentosiformis
ref|XP_006437610.1|  hypothetical protein CICLE_v10032094mg           77.0    6e-14   
ref|XP_011022026.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  77.4    7e-14   Populus euphratica
ref|XP_006382945.1|  hypothetical protein POPTR_0005s09300g           77.4    7e-14   
ref|XP_011022025.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  77.4    7e-14   Populus euphratica
ref|XP_006382946.1|  hypothetical protein POPTR_0005s09300g           77.4    8e-14   
ref|XP_006437609.1|  hypothetical protein CICLE_v10032094mg           77.0    1e-13   Citrus clementina [clementine]
gb|KJB12379.1|  hypothetical protein B456_002G015500                  74.7    2e-13   Gossypium raimondii
gb|KJB12380.1|  hypothetical protein B456_002G015500                  75.1    2e-13   Gossypium raimondii
gb|KJB12378.1|  hypothetical protein B456_002G015500                  75.1    3e-13   Gossypium raimondii
ref|XP_006365590.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  74.7    6e-13   Solanum tuberosum [potatoes]
ref|XP_004231468.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  74.3    8e-13   Solanum lycopersicum
gb|ACU14657.1|  unknown                                               72.8    2e-12   Glycine max [soybeans]
gb|KHN23096.1|  E3 ubiquitin ligase BIG BROTHER-related               73.6    2e-12   Glycine soja [wild soybean]
ref|XP_003555845.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  73.2    2e-12   Glycine max [soybeans]
ref|XP_003555846.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  73.2    3e-12   Glycine max [soybeans]
gb|KFK39312.1|  hypothetical protein AALP_AA3G228600                  72.8    3e-12   Arabis alpina [alpine rockcress]
ref|XP_003536731.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  73.2    3e-12   Glycine max [soybeans]
gb|AFK47989.1|  unknown                                               71.6    4e-12   Lotus japonicus
gb|KDP37529.1|  hypothetical protein JCGZ_05968                       72.4    4e-12   Jatropha curcas
ref|XP_003592713.1|  RING finger protein                              72.8    4e-12   Medicago truncatula
gb|ACJ86011.1|  unknown                                               72.8    4e-12   Medicago truncatula
ref|XP_003592714.1|  RING finger protein                              72.8    4e-12   Medicago truncatula
ref|XP_007043263.1|  RING/U-box superfamily protein                   73.2    5e-12   
ref|XP_009145730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  72.0    6e-12   Brassica rapa
ref|XP_006406443.1|  hypothetical protein EUTSA_v10021098mg           72.0    8e-12   Eutrema salsugineum [saltwater cress]
ref|XP_011002252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    1e-11   Populus euphratica
ref|XP_011002253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    1e-11   Populus euphratica
ref|XP_002310069.1|  zinc finger family protein                       71.2    1e-11   
ref|XP_011002254.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    1e-11   Populus euphratica
ref|XP_010688664.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688665.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    1e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY25357.1|  BnaA05g19270D                                        71.2    1e-11   Brassica napus [oilseed rape]
ref|NP_566651.1|  E3 ubiquitin ligase BIG BROTHER-like protein        71.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61025.1|  unknown                                               71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142774.1|  hypothetical protein PHAVU_007G015800g           71.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_002883210.1|  zinc finger family protein                       70.9    2e-11   
ref|XP_004497226.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  70.9    2e-11   Cicer arietinum [garbanzo]
ref|XP_004497227.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  70.9    2e-11   Cicer arietinum [garbanzo]
gb|ACJ85919.1|  unknown                                               70.9    2e-11   Medicago truncatula
ref|XP_006851962.1|  hypothetical protein AMTR_s00041p00192380        70.1    2e-11   Amborella trichopoda
gb|EPS70975.1|  hypothetical protein M569_03787                       68.2    2e-11   Genlisea aurea
gb|KJB31862.1|  hypothetical protein B456_005G211500                  69.3    3e-11   Gossypium raimondii
ref|XP_006298094.1|  hypothetical protein CARUB_v10014137mg           70.1    3e-11   Capsella rubella
gb|KJB31861.1|  hypothetical protein B456_005G211500                  69.7    4e-11   Gossypium raimondii
gb|KJB31859.1|  hypothetical protein B456_005G211500                  69.7    5e-11   Gossypium raimondii
ref|XP_010466157.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  69.7    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010487949.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  69.7    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010487948.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  69.3    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010655908.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.9    6e-11   Vitis vinifera
ref|XP_008789252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.9    7e-11   
emb|CDY24595.1|  BnaC05g32790D                                        68.9    7e-11   Brassica napus [oilseed rape]
ref|XP_010655907.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.9    7e-11   Vitis vinifera
ref|XP_008789253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.6    8e-11   Phoenix dactylifera
ref|XP_002521533.1|  ring finger protein, putative                    68.6    9e-11   Ricinus communis
gb|KDO52708.1|  hypothetical protein CISIN_1g019980mg                 67.4    1e-10   Citrus sinensis [apfelsine]
ref|XP_010261280.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.2    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009392890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.2    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO52707.1|  hypothetical protein CISIN_1g019980mg                 67.4    1e-10   Citrus sinensis [apfelsine]
gb|KDO52709.1|  hypothetical protein CISIN_1g019980mg                 67.4    1e-10   Citrus sinensis [apfelsine]
ref|XP_004287200.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.2    1e-10   Fragaria vesca subsp. vesca
ref|XP_010112544.1|  E3 ubiquitin ligase BIG BROTHER-related protein  68.2    2e-10   
ref|XP_009111410.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.2    2e-10   Brassica rapa
emb|CDY42218.1|  BnaA01g25770D                                        68.2    2e-10   Brassica napus [oilseed rape]
emb|CDY33429.1|  BnaC01g32960D                                        67.8    2e-10   Brassica napus [oilseed rape]
gb|EYU35575.1|  hypothetical protein MIMGU_mgv1a010240mg              67.8    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_010541856.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.2    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010508204.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  67.8    2e-10   Camelina sativa [gold-of-pleasure]
gb|KDO52706.1|  hypothetical protein CISIN_1g019980mg                 67.4    3e-10   Citrus sinensis [apfelsine]
ref|XP_007202272.1|  hypothetical protein PRUPE_ppa008876mg           67.4    3e-10   Prunus persica
ref|XP_008243095.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  67.4    3e-10   Prunus mume [ume]
gb|KDO52705.1|  hypothetical protein CISIN_1g019980mg                 67.4    3e-10   Citrus sinensis [apfelsine]
ref|XP_008371199.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  65.9    3e-10   
ref|XP_009775151.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  67.4    3e-10   Nicotiana sylvestris
ref|XP_010932524.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    5e-10   Elaeis guineensis
ref|XP_008383707.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    6e-10   
ref|XP_008383698.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    6e-10   
ref|XP_008383690.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    6e-10   
ref|XP_009366271.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    7e-10   Pyrus x bretschneideri [bai li]
ref|XP_009366273.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.2    7e-10   Pyrus x bretschneideri [bai li]
ref|XP_008394237.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  65.9    9e-10   
ref|XP_011070448.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  65.1    2e-09   Sesamum indicum [beniseed]
emb|CDP14406.1|  unnamed protein product                              64.3    3e-09   Coffea canephora [robusta coffee]
ref|XP_009395284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  63.9    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445883.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  63.9    5e-09   Cucumis melo [Oriental melon]
ref|XP_004143619.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  63.9    5e-09   Cucumis sativus [cucumbers]
ref|XP_010067008.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  62.8    1e-08   Eucalyptus grandis [rose gum]
gb|EEC84951.1|  hypothetical protein OsI_32172                        62.4    1e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001063778.1|  Os09g0535100                                     62.4    1e-08   
ref|XP_006661480.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  61.6    2e-08   Oryza brachyantha
ref|XP_003578515.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  62.0    2e-08   Brachypodium distachyon [annual false brome]
gb|KCW65072.1|  hypothetical protein EUGRSUZ_G02582                   61.6    3e-08   Eucalyptus grandis [rose gum]
gb|KCW65071.1|  hypothetical protein EUGRSUZ_G02582                   61.6    3e-08   Eucalyptus grandis [rose gum]
dbj|BAJ88925.1|  predicted protein                                    62.0    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795341.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  60.5    6e-08   Phoenix dactylifera
ref|XP_010906327.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  58.5    3e-07   Elaeis guineensis
tpg|DAA40635.1|  TPA: putative RING zinc finger domain superfamil...  57.8    4e-07   
tpg|DAA40634.1|  TPA: putative RING zinc finger domain superfamil...  58.2    4e-07   
ref|NP_001149296.1|  LOC100282919                                     58.2    5e-07   Zea mays [maize]
ref|XP_009395387.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  57.8    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008679088.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  55.1    8e-07   
ref|XP_004974139.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  56.6    1e-06   Setaria italica
dbj|BAK04753.1|  predicted protein                                    56.2    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659662.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  56.2    2e-06   Oryza brachyantha
gb|ABK26080.1|  unknown                                               56.2    2e-06   Picea sitchensis
gb|EMT04037.1|  RING-H2 finger protein ATL3F                          55.8    2e-06   
ref|NP_001150748.1|  protein binding protein                          55.8    3e-06   Zea mays [maize]
tpg|DAA62493.1|  TPA: putative RING zinc finger domain superfamil...  55.8    3e-06   
gb|AFW65659.1|  putative RING zinc finger domain superfamily protein  55.5    3e-06   
gb|ACG31571.1|  hypothetical protein                                  55.5    3e-06   Zea mays [maize]
ref|XP_004957470.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  55.5    3e-06   Setaria italica
ref|NP_001131853.1|  uncharacterized LOC100193231                     55.5    4e-06   Zea mays [maize]
ref|XP_008651502.1|  PREDICTED: protein binding protein isoform X2    55.5    4e-06   
ref|XP_002460573.1|  hypothetical protein SORBIDRAFT_02g031050        55.5    4e-06   Sorghum bicolor [broomcorn]
ref|XP_002445744.1|  hypothetical protein SORBIDRAFT_07g024950        55.5    4e-06   Sorghum bicolor [broomcorn]
ref|XP_009376874.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  54.3    4e-06   Pyrus x bretschneideri [bai li]
ref|XP_008651501.1|  PREDICTED: protein binding protein isoform X1    55.5    4e-06   Zea mays [maize]
ref|XP_001769627.1|  predicted protein                                55.1    5e-06   
gb|KHG07975.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  53.5    6e-06   Gossypium arboreum [tree cotton]
ref|XP_008674938.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.8    6e-06   
ref|XP_008673640.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.8    6e-06   
ref|XP_006859208.1|  hypothetical protein AMTR_s00070p00189230        53.9    1e-05   
ref|XP_010235389.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.8    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_003574899.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.8    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_009418697.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.4    3e-05   
ref|XP_007019133.1|  RING/U-box superfamily protein, putative         51.6    3e-05   
gb|KHG29072.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  52.0    4e-05   Gossypium arboreum [tree cotton]
gb|EAZ07897.1|  hypothetical protein OsI_30152                        52.4    4e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001062434.1|  Os08g0548300                                     52.4    4e-05   
ref|XP_008666504.1|  PREDICTED: uncharacterized protein LOC103645175  51.2    5e-05   
ref|XP_008646568.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.0    6e-05   
gb|ADE77661.1|  unknown                                               51.6    7e-05   Picea sitchensis
ref|XP_007226705.1|  hypothetical protein PRUPE_ppa020151mg           50.4    1e-04   
ref|XP_008219608.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  50.1    1e-04   Prunus mume [ume]
ref|XP_008338661.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  49.7    2e-04   Malus domestica [apple tree]



>ref|XP_009622651.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
tomentosiformis]
Length=331

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = +1

Query  217  NLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALART  396
            N P  ++S+    V E +  GE G S  V+  + GG   SRRTPFT+LSQ DADLALART
Sbjct  41   NWPYGDSSS---QVVEINANGESGVSAAVD--SNGG--ASRRTPFTNLSQEDADLALART  93

Query  397  LQEQERAYMMLTMNGDA  447
            LQEQERAYMML+MNGD 
Sbjct  94   LQEQERAYMMLSMNGDG  110



>ref|XP_006437610.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 gb|ESR50850.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=242

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q   G RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQHGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_011022026.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Populus euphratica]
Length=309

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  54   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  94



>ref|XP_006382945.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60742.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=314

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  56   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  96



>ref|XP_011022025.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Populus euphratica]
Length=311

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  54   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  94



>ref|XP_006382946.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60743.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=316

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  56   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  96



>ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 ref|XP_006484518.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus 
sinensis]
 gb|ESR50849.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=328

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q   G RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQHGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KJB12379.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=172

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDG  69



>gb|KJB12380.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
 gb|KJB12381.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=240

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDG  69



>gb|KJB12378.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=287

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDG  69



>ref|XP_006365590.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=313

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (5%)
 Frame = +1

Query  325  RQP--SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
             QP  SRRTPFTDLSQ+DADLALARTLQ+QERAYMML+MN D 
Sbjct  53   HQPGASRRTPFTDLSQVDADLALARTLQDQERAYMMLSMNDDG  95



>ref|XP_004231468.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum lycopersicum]
Length=314

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            SRRTPFTDLSQ+DADLALARTLQ+QERAYMML+MN D 
Sbjct  59   SRRTPFTDLSQVDADLALARTLQDQERAYMMLSMNDDG  96



>gb|ACU14657.1| unknown [Glycine max]
Length=222

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  80   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  119



>gb|KHN23096.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=335

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +1

Query  319  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMN  107



>ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
1 [Glycine max]
Length=335

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +1

Query  319  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMN  107



>ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
2 [Glycine max]
Length=341

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +1

Query  319  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMN  107



>gb|KFK39312.1| hypothetical protein AALP_AA3G228600 [Arabis alpina]
Length=316

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD  444
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN D
Sbjct  64   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSD  103



>ref|XP_003536731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform 1 
[Glycine max]
Length=344

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  80   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  119



>gb|AFK47989.1| unknown [Lotus japonicus]
Length=206

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQPSR TPF++LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  83   RQPSR-TPFSNLSQVDADLALARTLQEQERAYMMLRMNNDG  122



>gb|KDP37529.1| hypothetical protein JCGZ_05968 [Jatropha curcas]
Length=314

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  307  QGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  429
            Q AQ  RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML
Sbjct  49   QEAQPPRQSSRRTPFTNLSQVDADLALARTLQEQERAYMML  89



>ref|XP_003592713.1| RING finger protein [Medicago truncatula]
 gb|AES62964.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=333

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  205  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  384
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  385  LARTLQEQERAYMMLTMNGDA  447
            LARTLQEQERAYMML MN D 
Sbjct  87   LARTLQEQERAYMMLRMNNDG  107



>gb|ACJ86011.1| unknown [Medicago truncatula]
Length=332

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  205  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  384
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  38   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  85

Query  385  LARTLQEQERAYMMLTMNGDA  447
            LARTLQEQERAYMML MN D 
Sbjct  86   LARTLQEQERAYMMLRMNNDG  106



>ref|XP_003592714.1| RING finger protein [Medicago truncatula]
 gb|AES62965.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=339

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  205  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  384
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  385  LARTLQEQERAYMMLTMNGDA  447
            LARTLQEQERAYMML MN D 
Sbjct  87   LARTLQEQERAYMMLRMNNDG  107



>ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX99094.1| RING/U-box superfamily protein [Theobroma cacao]
Length=392

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  129  RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  169



>ref|XP_009145730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=324

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 16/85 (19%)
 Frame = +1

Query  217  NLPTNNTS-----------AIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLS  363
            NLPT   S           A+   VAE+  E   G++T   +G    R  S R PFT+LS
Sbjct  33   NLPTGVVSESGGGSEKGEEAVETAVAEDVDES--GSNT---EGELPPRSSSARVPFTNLS  87

Query  364  QIDADLALARTLQEQERAYMMLTMN  438
            QIDADLALARTLQEQERAYMMLTMN
Sbjct  88   QIDADLALARTLQEQERAYMMLTMN  112



>ref|XP_006406443.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
 gb|ESQ47896.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
Length=335

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 12/85 (14%)
 Frame = +1

Query  220  LPTNNTSAIPAPVAEESREGEFGASTNVNQ------------GAQGGRQPSRRTPFTDLS  363
            LP N  S + +     S +GE G  T V              G    R  S R PFT+LS
Sbjct  30   LPENRPSGVVSDTGSGSEKGEEGVETAVAVAVAADESGSNSVGELPPRSSSARVPFTNLS  89

Query  364  QIDADLALARTLQEQERAYMMLTMN  438
            Q+DADLALARTLQEQERAYMMLTMN
Sbjct  90   QMDADLALARTLQEQERAYMMLTMN  114



>ref|XP_011002252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Populus euphratica]
Length=329

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  103



>ref|XP_011002253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Populus euphratica]
Length=327

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  103



>ref|XP_002310069.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE90519.1| zinc finger family protein [Populus trichocarpa]
Length=320

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  60   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  99



>ref|XP_011002254.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X3 
[Populus euphratica]
Length=326

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  103



>ref|XP_010688664.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=336

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +1

Query  175  AKTTADDHQE---NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRT  345
            AKTTA+D      NP +++ T+N++++    A  +       +T     A    + S RT
Sbjct  14   AKTTAEDSATTNPNPNSDVATSNSNSVVDAAAAANLA----VATEAGSDADSRSRNSSRT  69

Query  346  PFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            PFT+LSQ+DADLALARTLQEQERAYMML++NG
Sbjct  70   PFTNLSQVDADLALARTLQEQERAYMMLSING  101



>ref|XP_010688665.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=333

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +1

Query  175  AKTTADDHQE---NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRT  345
            AKTTA+D      NP +++ T+N++++    A  +       +T     A    + S RT
Sbjct  14   AKTTAEDSATTNPNPNSDVATSNSNSVVDAAAAANLA----VATEAGSDADSRSRNSSRT  69

Query  346  PFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            PFT+LSQ+DADLALARTLQEQERAYMML++NG
Sbjct  70   PFTNLSQVDADLALARTLQEQERAYMMLSING  101



>emb|CDY25357.1| BnaA05g19270D [Brassica napus]
Length=320

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN
Sbjct  75   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMN  112



>ref|NP_566651.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
 sp|Q9LT17.1|BBR_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER-related; Short=AtBBR 
[Arabidopsis thaliana]
 dbj|BAB01306.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK73948.1| AT3g19910/MPN9_15 [Arabidopsis thaliana]
 gb|AAK76658.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85084.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76307.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
Length=340

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN
Sbjct  80   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMN  117



>gb|AAM61025.1| unknown [Arabidopsis thaliana]
Length=340

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN
Sbjct  80   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMN  117



>ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
 gb|AGV54364.1| RING-finger protein [Phaseolus vulgaris]
 gb|ESW14768.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
Length=347

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 1/38 (3%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  82   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMN  118



>ref|XP_002883210.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59469.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN
Sbjct  77   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMN  114



>ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
Length=342

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
             QPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  74   HQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  113



>ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
Length=336

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
             QPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  74   HQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  113



>gb|ACJ85919.1| unknown [Medicago truncatula]
 gb|AFK45820.1| unknown [Medicago truncatula]
Length=339

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  205  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  384
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  385  LARTLQEQERAYMMLTMNGDA  447
            LARTLQE+ERAYMML MN D 
Sbjct  87   LARTLQERERAYMMLRMNNDG  107



>ref|XP_006851962.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
 gb|ERN13429.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
Length=279

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = +1

Query  277  GEFGASTN--VNQGAQGGR--QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD  444
            GE GA     ++ G    R  QPSR TPFT LSQ+DADLALARTLQEQERAYM+L MNG+
Sbjct  10   GEKGADETPVMDDGGSNSRPSQPSR-TPFTSLSQVDADLALARTLQEQERAYMVLRMNGE  68



>gb|EPS70975.1| hypothetical protein M569_03787, partial [Genlisea aurea]
Length=136

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  337  RRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RRTPFTDLSQ+DADL LARTLQEQERAYMML M+
Sbjct  1    RRTPFTDLSQVDADLVLARTLQEQERAYMMLRMD  34



>gb|KJB31862.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=256

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>ref|XP_006298094.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
 gb|EOA30992.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
Length=335

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD  444
            R  S R PF++LSQIDADLALARTLQEQERAYMMLTMN +
Sbjct  78   RSSSARVPFSNLSQIDADLALARTLQEQERAYMMLTMNSE  117



>gb|KJB31861.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=326

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>gb|KJB31859.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=332

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>ref|XP_010466157.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Camelina 
sativa]
Length=336

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMN  118



>ref|XP_010487949.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Camelina sativa]
Length=338

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMN  118



>ref|XP_010487948.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Camelina sativa]
Length=339

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMN  118



>ref|XP_010655908.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
 emb|CBI29028.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +NG+ 
Sbjct  52   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRINGEG  89



>ref|XP_008789252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Phoenix dactylifera]
Length=300

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +1

Query  247  PAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMM  426
            P+P      EGE G +  V   A     P  R PFT LSQ+DADLALAR LQEQERAYMM
Sbjct  18   PSPNPPLPAEGEAGPAVGV---APPPAMPPSRMPFTSLSQVDADLALARALQEQERAYMM  74

Query  427  LTMNG  441
            L MNG
Sbjct  75   LRMNG  79



>emb|CDY24595.1| BnaC05g32790D [Brassica napus]
Length=315

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQIDADLALARTLQEQERAYMML MN
Sbjct  75   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLAMN  112



>ref|XP_010655907.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=314

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +NG+ 
Sbjct  52   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRINGEG  89



>ref|XP_008789253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Phoenix dactylifera]
Length=285

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +1

Query  247  PAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMM  426
            P+P      EGE G +  V   A     P  R PFT LSQ+DADLALAR LQEQERAYMM
Sbjct  18   PSPNPPLPAEGEAGPAVGV---APPPAMPPSRMPFTSLSQVDADLALARALQEQERAYMM  74

Query  427  LTMNG  441
            L MNG
Sbjct  75   LRMNG  79



>ref|XP_002521533.1| ring finger protein, putative [Ricinus communis]
 gb|EEF40804.1| ring finger protein, putative [Ricinus communis]
Length=316

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            SRRTPFT+LSQ+DADLALARTLQEQERAYMML  N
Sbjct  57   SRRTPFTNLSQVDADLALARTLQEQERAYMMLRFN  91



>gb|KDO52708.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=233

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_010261280.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nelumbo nucifera]
Length=278

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 44/70 (63%), Gaps = 12/70 (17%)
 Frame = +1

Query  262  EESREGEFGASTN------VNQGA-----QGGRQPSRRTPFTDLSQIDADLALARTLQEQ  408
            E SREG  GA  N      V +          RQ SR TPFT LSQ+DADLALARTLQEQ
Sbjct  2    ENSREGCDGAKKNEESPNSVTEAEPESNLAASRQTSR-TPFTSLSQVDADLALARTLQEQ  60

Query  409  ERAYMMLTMN  438
            ERAYMML MN
Sbjct  61   ERAYMMLRMN  70



>ref|XP_009392890.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=292

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  331  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            PS RTPFT LSQ+DADLALAR LQEQERAY ML MNG
Sbjct  44   PSARTPFTSLSQVDADLALARALQEQERAYAMLRMNG  80



>gb|KDO52707.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=257

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KDO52709.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
 gb|KDO52710.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=242

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Fragaria 
vesca subsp. vesca]
Length=306

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  51   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  85



>ref|XP_010112544.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
 gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
Length=342

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +N D 
Sbjct  62   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRLNNDG  99



>ref|XP_009111410.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=333

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            S R PFT+LSQID+DLALARTLQEQERAYMMLTMN
Sbjct  83   SARVPFTNLSQIDSDLALARTLQEQERAYMMLTMN  117



>emb|CDY42218.1| BnaA01g25770D [Brassica napus]
Length=334

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            S R PFT+LSQID+DLALARTLQEQERAYMMLTMN
Sbjct  83   SARVPFTNLSQIDSDLALARTLQEQERAYMMLTMN  117



>emb|CDY33429.1| BnaC01g32960D [Brassica napus]
Length=330

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PFT+LSQI++DLALARTLQEQERAYMMLTMN
Sbjct  75   RSSSARVPFTNLSQIESDLALARTLQEQERAYMMLTMN  112



>gb|EYU35575.1| hypothetical protein MIMGU_mgv1a010240mg [Erythranthe guttata]
Length=318

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  337  RRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RRTPFT+LSQ+DADLALARTLQEQERAYMML M+
Sbjct  47   RRTPFTNLSQVDADLALARTLQEQERAYMMLRMD  80



>ref|XP_010541856.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
Length=352

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  292  STNVNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            S +V +  Q  +  S R PFT+LSQIDADLALARTLQEQERAYMML+MN
Sbjct  77   SNSVAEQEQPRQAASARVPFTNLSQIDADLALARTLQEQERAYMMLSMN  125



>ref|XP_010508204.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=337

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R  S R PF +L+QIDADLALARTLQEQERAYMMLTMN
Sbjct  82   RSSSARVPFINLNQIDADLALARTLQEQERAYMMLTMN  119



>gb|KDO52706.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=328

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
 gb|EMJ03471.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
Length=316

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  61   RTPFTNLSQVDADLALARTLQEQERAYMMLRMN  93



>ref|XP_008243095.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=316

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  61   RTPFTNLSQVDADLALARTLQEQERAYMMLRMN  93



>gb|KDO52705.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=333

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_008371199.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Malus domestica]
Length=218

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  96



>ref|XP_009775151.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
sylvestris]
Length=319

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RTPFT+LSQ DADLALARTLQEQERAYMML+MN D 
Sbjct  67   RTPFTNLSQEDADLALARTLQEQERAYMMLSMNSDG  102



>ref|XP_010932524.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=285

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PSR  PFT LSQ+DADLALAR LQEQERAYMML MNG
Sbjct  42   RLPSR-MPFTSLSQVDADLALARALQEQERAYMMLRMNG  79



>ref|XP_008383707.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Malus domestica]
Length=302

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  96



>ref|XP_008383698.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Malus domestica]
Length=312

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  96



>ref|XP_008383690.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Malus domestica]
Length=315

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  96



>ref|XP_009366271.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Pyrus x bretschneideri]
Length=320

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  97



>ref|XP_009366273.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Pyrus x bretschneideri]
Length=317

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  97



>ref|XP_008394237.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=319

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            RTPF++LSQ+DADLALARTLQEQERAYMML MN
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMN  97



>ref|XP_011070448.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Sesamum indicum]
Length=303

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 54/104 (52%), Gaps = 27/104 (26%)
 Frame = +1

Query  127  MENAKAnngtnnggEVAKTTADDHQENPINNLPTNNTSAIPAPVAEESREGEFGASTNVN  306
            MEN+ A    +N      TTA D Q+NP +N                          N  
Sbjct  1    MENSNAKADADNTTTTTTTTAADAQQNPTDN------------------------PQNAG  36

Query  307  QGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
             GA   RQ   RTPFTDLSQ+DADLALARTLQEQERAYMML M+
Sbjct  37   DGAGNRRQ---RTPFTDLSQVDADLALARTLQEQERAYMMLRMD  77



>emb|CDP14406.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  343  TPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            TPFTDLSQ DADLALARTLQEQERAYMML MN
Sbjct  45   TPFTDLSQEDADLALARTLQEQERAYMMLRMN  76



>ref|XP_009395284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  331  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            PS R PFT LSQ+DADLALAR LQEQERAY +L MNG
Sbjct  40   PSARRPFTSLSQVDADLALARALQEQERAYALLRMNG  76



>ref|XP_008445883.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Cucumis melo]
Length=328

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 3/38 (8%)
 Frame = +1

Query  331  PSR---RTPFTDLSQIDADLALARTLQEQERAYMMLTM  435
            PSR   RTPFT+L+Q+DADLALARTLQEQERAY+ML M
Sbjct  66   PSRHSSRTPFTNLTQVDADLALARTLQEQERAYLMLRM  103



>ref|XP_004143619.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 ref|XP_004165268.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 gb|KGN50445.1| hypothetical protein Csa_5G175690 [Cucumis sativus]
Length=323

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 3/38 (8%)
 Frame = +1

Query  331  PSR---RTPFTDLSQIDADLALARTLQEQERAYMMLTM  435
            PSR   RTPFT+L+Q+DADLALARTLQEQERAY+ML M
Sbjct  62   PSRHSSRTPFTNLTQVDADLALARTLQEQERAYLMLRM  99



>ref|XP_010067008.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Eucalyptus 
grandis]
Length=357

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  328  QPS-RRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            QPS  RTPFT LSQ+DAD ALAR LQEQERAYMML  N D 
Sbjct  91   QPSASRTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDG  131



>gb|EEC84951.1| hypothetical protein OsI_32172 [Oryza sativa Indica Group]
Length=325

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ+DADLALAR LQEQERAYMML M G
Sbjct  54   RRPFTALSQVDADLALARVLQEQERAYMMLRMGG  87



>ref|NP_001063778.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAD34213.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25692.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAG91659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=325

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ+DADLALAR LQEQERAYMML M G
Sbjct  54   RRPFTALSQVDADLALARVLQEQERAYMMLRMGG  87



>ref|XP_006661480.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Oryza brachyantha]
Length=269

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  346  PFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            PFT+LSQ+DADLALAR LQEQERAYMML M G
Sbjct  1    PFTELSQVDADLALARVLQEQERAYMMLRMGG  32



>ref|XP_003578515.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brachypodium 
distachyon]
Length=337

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ+DADLALAR LQEQERAYMML MN
Sbjct  55   RRPFTALSQVDADLALARVLQEQERAYMMLRMN  87



>gb|KCW65072.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=296

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RTPFT LSQ+DAD ALAR LQEQERAYMML  N D 
Sbjct  49   RTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDG  84



>gb|KCW65071.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=310

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            RTPFT LSQ+DAD ALAR LQEQERAYMML  N D 
Sbjct  49   RTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDG  84



>dbj|BAJ88925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ+DADLALAR LQEQERAYMML MN
Sbjct  55   RRPFTALSQVDADLALARVLQEQERAYMMLRMN  87



>ref|XP_008795341.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Phoenix 
dactylifera]
Length=285

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  349  FTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            FT LSQ+DADLALAR LQEQERAYMML MNG
Sbjct  49   FTGLSQVDADLALARALQEQERAYMMLRMNG  79



>ref|XP_010906327.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=280

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  349  FTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            FT LSQ++ADLALAR LQEQERAYMML MNG
Sbjct  45   FTSLSQVEADLALARALQEQERAYMMLRMNG  75



>tpg|DAA40635.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=244

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>tpg|DAA40634.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=323

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>ref|NP_001149296.1| LOC100282919 [Zea mays]
 gb|ACG34901.1| protein binding protein [Zea mays]
Length=323

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>ref|XP_009395387.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  349  FTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            FT LSQ+DADLALAR LQEQERAY ML MNG
Sbjct  55   FTSLSQVDADLALARALQEQERAYAMLRMNG  85



>ref|XP_008679088.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=144

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  55   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  87



>ref|XP_004974139.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=301

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            R PFT LSQ +ADLALAR LQEQERAYMMLT + D+
Sbjct  54   RRPFTSLSQEEADLALARVLQEQERAYMMLTAHHDS  89



>dbj|BAK04753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQERAYMML+ +G
Sbjct  43   RRPFTALSQEEADLALARVLQEQERAYMMLSAHG  76



>ref|XP_006659662.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Oryza 
brachyantha]
Length=301

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  331  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            P+ R PFT L+Q +ADLALAR LQEQERAYMMLT
Sbjct  31   PTGRRPFTSLTQEEADLALARLLQEQERAYMMLT  64



>gb|ABK26080.1| unknown [Picea sitchensis]
Length=282

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            + S R PFT LSQ D+DLALAR LQEQERAYMML  N ++
Sbjct  41   EQSSRQPFTALSQEDSDLALARALQEQERAYMMLRRNAES  80



>gb|EMT04037.1| RING-H2 finger protein ATL3F [Aegilops tauschii]
Length=285

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQERAYMML+ +G
Sbjct  42   RRPFTALSQEEADLALARVLQEQERAYMMLSAHG  75



>ref|NP_001150748.1| protein binding protein [Zea mays]
 gb|ACG40201.1| protein binding protein [Zea mays]
Length=322

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>tpg|DAA62493.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=322

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>gb|AFW65659.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=271

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>gb|ACG31571.1| hypothetical protein [Zea mays]
Length=288

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>ref|XP_004957470.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=323

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  52   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  84



>ref|NP_001131853.1| uncharacterized LOC100193231 [Zea mays]
 gb|ACF80448.1| unknown [Zea mays]
 gb|AFW65658.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=287

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>ref|XP_008651502.1| PREDICTED: protein binding protein isoform X2 [Zea mays]
Length=307

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>ref|XP_002460573.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
 gb|EER97094.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
Length=324

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  55   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  87



>ref|XP_002445744.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
 gb|EES15239.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
Length=314

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  58   RRPFTSLSQEEADLALARVLQEQERAYMMLT  88



>ref|XP_009376874.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
Length=215

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  322  GRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML-TMNGDA  447
            G+Q SRRTPFT+L+Q+ AD  LA  +QEQE+AY ML T+  D+
Sbjct  8    GKQSSRRTPFTELNQVSADFILAMAMQEQEQAYTMLETIESDS  50



>ref|XP_008651501.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 tpg|DAA62491.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62492.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=322

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>ref|XP_001769627.1| predicted protein [Physcomitrella patens]
 gb|EDQ65620.1| predicted protein [Physcomitrella patens]
Length=306

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTM  435
            R PFT LSQ+D+D+ALAR LQEQERAY +L M
Sbjct  37   RVPFTSLSQVDSDMALARALQEQERAYFLLQM  68



>gb|KHG07975.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=193

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +1

Query  304  NQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQ-----ERAYMMLTMNG  441
            ++  Q  RQ S RTPFT+LSQ+DADLALARTLQEQ     E A  +L + G
Sbjct  22   SESKQEERQSSTRTPFTNLSQVDADLALARTLQEQDAEEREVAARLLALAG  72



>ref|XP_008674938.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=142

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +ADLALAR LQEQE AYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQEWAYMLLWMN  85



>ref|XP_008673640.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=142

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTM  435
            R PFT LSQ +ADLALAR LQEQERAYM+L M
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRM  84



>ref|XP_006859208.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
 gb|ERN20675.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
Length=261

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  VNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  429
            VN  A  G   + R PFT+LSQ+++D A+A+TLQ+QERAYMM 
Sbjct  18   VNSDADFGSPINARVPFTNLSQVESDRAIAKTLQQQERAYMMF  60



>ref|XP_010235389.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Brachypodium distachyon]
Length=301

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMML  429
            R PFT LSQ +ADLALAR LQEQERAYMML
Sbjct  59   RRPFTALSQEEADLALARVLQEQERAYMML  88



>ref|XP_003574899.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMML  429
            R PFT LSQ +ADLALAR LQEQERAYMML
Sbjct  59   RRPFTALSQEEADLALARVLQEQERAYMML  88



>ref|XP_009418697.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=264

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  349  FTDLSQIDADLALARTLQEQERAYMMLTMNGD  444
            FT LSQIDADLALAR LQEQ  AY ML M+GD
Sbjct  43   FTSLSQIDADLALARILQEQGTAYAMLMMDGD  74



>ref|XP_007019133.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY16358.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=205

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  322  GRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  429
             +Q S+R PFT L Q+D+D A+A  LQEQERA+ ML
Sbjct  6    AKQSSKRVPFTQLDQVDSDFAMAMALQEQERAFSML  41



>gb|KHG29072.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=243

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  325  RQPSRRTPFTDLSQIDADLALARTLQEQE  411
            RQ S RTPFT+LSQ+DADLALARTLQEQ+
Sbjct  49   RQSSTRTPFTNLSQVDADLALARTLQEQD  77



>gb|EAZ07897.1| hypothetical protein OsI_30152 [Oryza sativa Indica Group]
Length=300

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT L+Q +ADLALAR LQEQERAYMML+
Sbjct  38   RRPFTSLTQEEADLALARVLQEQERAYMMLS  68



>ref|NP_001062434.1| Os08g0548300 [Oryza sativa Japonica Group]
 dbj|BAD10755.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAD09949.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAF24348.1| Os08g0548300 [Oryza sativa Japonica Group]
 gb|EAZ43565.1| hypothetical protein OsJ_28186 [Oryza sativa Japonica Group]
 dbj|BAG93370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLT  432
            R PFT L+Q +ADLALAR LQEQERAYMML+
Sbjct  38   RRPFTSLTQEEADLALARVLQEQERAYMMLS  68



>ref|XP_008666504.1| PREDICTED: uncharacterized protein LOC103645175 [Zea mays]
Length=208

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  438
            R PFT LSQ +A LALAR LQEQERAYM+L MN
Sbjct  113  RRPFTALSQEEAYLALARVLQEQERAYMLLRMN  145



>ref|XP_008646568.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=310

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  340  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  441
            R PFT LSQ +ADLALAR LQEQ  AYM+L MNG
Sbjct  137  RRPFTALSQEEADLALARVLQEQRDAYMLLRMNG  170



>gb|ADE77661.1| unknown [Picea sitchensis]
Length=282

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  447
            + S R PFT LSQ D+DLALAR LQEQE AYM+L  N ++
Sbjct  41   EQSSRQPFTALSQEDSDLALARALQEQEMAYMLLRRNAES  80



>ref|XP_007226705.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
 gb|EMJ27904.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
Length=211

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  VNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  429
            ++ G    +Q +RRTPFT+L+Q+ +D  LA  +QEQE+AY ML
Sbjct  1    MDGGEDQSKQSTRRTPFTELNQVSSDFILAMAMQEQEQAYTML  43



>ref|XP_008219608.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=211

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  VNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  429
            ++ G    +Q +RRTPFT+L+Q+ +D  LA  +QEQE+AY ML
Sbjct  1    MDGGEDQSKQSTRRTPFTELNQVSSDFILAMAMQEQEQAYTML  43



>ref|XP_008338661.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Malus domestica]
 ref|XP_008352622.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=217

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  322  GRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML-TMNGDA  447
             +Q S+RTPFT+L+Q+ AD  LA  +QEQE+AY ML T+  D+
Sbjct  8    AKQSSQRTPFTELNQVSADFILAMAMQEQEQAYTMLETIESDS  50



Lambda      K        H        a         alpha
   0.309    0.124    0.343    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645