BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028J20

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           232   2e-68   Ipomoea purpurea
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             197   8e-56   Nicotiana sylvestris
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       197   9e-56   Nicotiana tabacum [American tobacco]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   195   7e-55   Ipomoea nil [qian niu]
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       195   8e-55   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             195   8e-55   Nicotiana tomentosiformis
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           192   9e-54   Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            188   2e-52   Catharanthus roseus [chatas]
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       186   9e-52   Ipomoea batatas [batate]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       186   1e-51   Ipomoea batatas [batate]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             186   2e-51   Plectranthus scutellarioides
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                184   9e-51   Erythranthe guttata [common monkey flower]
gb|AIY26016.1|  PAL                                                     184   9e-51   Jasminum sambac [Arabian jasmine]
gb|AEW25915.1|  phenylalanine ammonia-lyase                             171   9e-51   Medicago falcata [sickle alfalfa]
gb|AEW25882.1|  phenylalanine ammonia-lyase                             171   9e-51   Medicago falcata [sickle alfalfa]
gb|AEW25886.1|  phenylalanine ammonia-lyase                             171   9e-51   Medicago sativa subsp. x varia
gb|AEW25884.1|  phenylalanine ammonia-lyase                             171   1e-50   Medicago sativa subsp. x varia
gb|AEW25883.1|  phenylalanine ammonia-lyase                             171   1e-50   Medicago sativa subsp. caerulea
gb|AEW25889.1|  phenylalanine ammonia-lyase                             171   1e-50   Medicago sativa subsp. x varia
gb|AEW25888.1|  phenylalanine ammonia-lyase                             170   1e-50   Medicago sativa subsp. caerulea
gb|AEW25885.1|  phenylalanine ammonia-lyase                             170   2e-50   Medicago sativa subsp. caerulea
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            182   2e-50   Lactuca sativa [cultivated lettuce]
gb|AEW25919.1|  phenylalanine ammonia-lyase                             169   3e-50   Medicago sativa subsp. caerulea
ref|XP_006424536.1|  hypothetical protein CICLE_v10029946mg             169   4e-50   
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             181   6e-50   Olea europaea
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           181   1e-49   Platycodon grandiflorus [balloon-flower]
gb|AEW25903.1|  phenylalanine ammonia-lyase                             168   1e-49   Medicago falcata [sickle alfalfa]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             181   1e-49   Sesamum indicum [beniseed]
gb|AEW25890.1|  phenylalanine ammonia-lyase                             167   1e-49   Medicago sativa subsp. caerulea
gb|AEW25906.1|  phenylalanine ammonia-lyase                             167   1e-49   Medicago falcata [sickle alfalfa]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             180   2e-49   Scutellaria viscidula [zhan mao huang qin]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           180   2e-49   Scutellaria baicalensis [Baikal skullcap]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        180   2e-49   Cicer arietinum [garbanzo]
gb|AEW25894.1|  phenylalanine ammonia-lyase                             167   2e-49   Medicago sativa subsp. x varia
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            180   2e-49   Melissa officinalis [sweet balm]
gb|ACF94719.1|  phenylalanine ammonia lyase                             170   2e-49   Robinia pseudoacacia [black locust]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             179   3e-49   Solanum lycopersicum
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   179   4e-49   Rehmannia glutinosa [Chinese foxglove]
emb|CAA33500.1|  unnamed protein product                                166   5e-49   Petroselinum crispum
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           179   6e-49   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004173742.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   8e-49   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             177   1e-48   Astragalus mongholicus
gb|ABL14039.1|  phenylalanine ammonia lyase                             170   1e-48   Astragalus mongholicus
gb|AJO53274.1|  phenylalanine ammonia-lyase                             177   1e-48   Pogostemon cablin
gb|ABD73282.1|  phenylalanine ammonia-lyase                             177   2e-48   Salvia miltiorrhiza [Chinese salvia]
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             177   2e-48   Astragalus membranaceus
gb|AEW10551.1|  phenylalanine ammonia lyase                             164   2e-48   Solanum lycopersicum
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             177   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             177   2e-48   Sesamum indicum [beniseed]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             177   2e-48   Nelumbo nucifera [Indian lotus]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           176   3e-48   Scutellaria baicalensis [Baikal skullcap]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             176   3e-48   Astragalus chrysochlorus
gb|ABE03772.1|  phenylalanine ammonia-lyase                             176   4e-48   Arnebia euchroma
gb|ABR14606.1|  phenylalanine ammonia-lyase                             176   4e-48   Salvia miltiorrhiza [Chinese salvia]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 176   5e-48   Pyrus x bretschneideri [bai li]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             176   6e-48   Pyrus x bretschneideri [bai li]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           175   9e-48   Coffea arabica [arabica coffee]
gb|AFP24940.1|  phenylalanine ammonia lyase                             175   9e-48   Prunus salicina [Japanese plum]
gb|AFR41032.1|  phenylalanine ammonia-lyase                             163   9e-48   Populus alba [abele]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             175   9e-48   Prunus persica
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     175   9e-48   Prunus avium [gean]
gb|AFK43896.1|  unknown                                                 170   1e-47   Medicago truncatula
gb|AFR41029.1|  phenylalanine ammonia-lyase                             163   1e-47   Populus alba [abele]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           174   1e-47   
gb|AGL50914.1|  phenylalanine ammonia lyase                             174   1e-47   Pyrus communis
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           174   1e-47   Coffea canephora [robusta coffee]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    174   1e-47   Lithospermum erythrorhizon
gb|AFR41033.1|  phenylalanine ammonia-lyase                             162   2e-47   Populus alba [abele]
gb|AGL81344.1|  phenylalanine ammonia lyase                             174   2e-47   Pyrus communis
gb|ABB70117.2|  phenylalanine ammonia lyase                             174   2e-47   Pyrus communis
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          167   2e-47   Cynara cardunculus var. scolymus [artichoke]
gb|AFR41030.1|  phenylalanine ammonia-lyase                             162   2e-47   Populus alba [abele]
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           174   2e-47   Platycodon grandiflorus [balloon-flower]
gb|AFF60415.1|  phenylalanine ammonia lyase                             173   2e-47   Pyrus pyrifolia [sha li]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           174   2e-47   
gb|AFG30054.1|  phenylalanine ammonialyase                              174   3e-47   Malus hybrid cultivar
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   174   3e-47   Agastache rugosa
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    173   3e-47   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      173   4e-47   
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             173   4e-47   Nicotiana sylvestris
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           173   4e-47   Prunus mume [ume]
ref|XP_004173741.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   4e-47   
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            169   5e-47   Phaseolus vulgaris [French bean]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       173   5e-47   Digitalis lanata [Grecian foxglove]
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           172   7e-47   Prunus domestica
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             172   7e-47   Nicotiana tomentosiformis
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   172   8e-47   Trifolium pratense [peavine clover]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             172   8e-47   Trifolium pratense [peavine clover]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           172   9e-47   Nicotiana attenuata
gb|AER12109.1|  PAL                                                     172   1e-46   Gossypium hirsutum [American cotton]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    172   1e-46   Gossypium raimondii
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    172   1e-46   Lithospermum erythrorhizon
gb|AEH02821.1|  phenylalanine ammonia lyase                             172   1e-46   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFR41042.1|  phenylalanine ammonia-lyase                             159   2e-46   Populus fremontii
gb|AFR41051.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41046.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41056.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41048.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41047.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41049.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41050.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus nigra [black poplar]
gb|AFR41018.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus trichocarpa [western balsam poplar]
gb|AFR41036.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus fremontii
gb|AFR41022.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus trichocarpa [western balsam poplar]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    171   3e-46   Gossypium raimondii
gb|AFR41017.1|  phenylalanine ammonia-lyase                             159   3e-46   Populus trichocarpa [western balsam poplar]
gb|AFR41020.1|  phenylalanine ammonia-lyase                             159   4e-46   Populus trichocarpa [western balsam poplar]
gb|ABI33979.1|  phenylalanine ammonia lyase                             170   4e-46   Jatropha curcas
gb|AFR41023.1|  phenylalanine ammonia-lyase                             159   4e-46   Populus trichocarpa [western balsam poplar]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         170   4e-46   Jatropha curcas
gb|ABL14040.1|  phenylalanine ammonia lyase                             163   4e-46   Astragalus mongholicus
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             170   5e-46   Gossypium arboreum [tree cotton]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    170   5e-46   Pyrus x bretschneideri [bai li]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            170   5e-46   Daucus carota [carrots]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        170   5e-46   Medicago truncatula
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              170   5e-46   Ricinus communis
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     170   6e-46   Petroselinum crispum
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            170   6e-46   Lotus japonicus
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            170   6e-46   Lotus japonicus
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             170   6e-46   Citrus clementina [clementine]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             170   7e-46   Perilla frutescens [beefsteak-mint]
gb|ACF94716.1|  phenylalanine ammonia lyase                             170   7e-46   Robinia pseudoacacia [black locust]
ref|XP_010662173.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      160   7e-46   Vitis vinifera
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             169   8e-46   Citrus clementina [clementine]
gb|KGN48166.1|  hypothetical protein Csa_6G446280                       159   1e-45   Cucumis sativus [cucumbers]
gb|AGY49231.1|  phenylalanine ammonia lyase                             169   1e-45   Ricinus communis
gb|AHY94892.1|  phenylalanine ammonia lyase                             169   1e-45   Prunella vulgaris
gb|ABD42947.1|  phenylalanine ammonia lyase                             169   1e-45   Acacia auriculiformis x Acacia mangium
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   1e-45   Nicotiana sylvestris
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       169   1e-45   Cucumis sativus [cucumbers]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   1e-45   Solanum tuberosum [potatoes]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      169   1e-45   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             169   2e-45   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   2e-45   Solanum tuberosum [potatoes]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     169   2e-45   Glycine max [soybeans]
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             169   2e-45   Gossypium arboreum [tree cotton]
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       168   2e-45   Cucumis sativus [cucumbers]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        168   2e-45   
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     168   3e-45   Petroselinum crispum
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    168   3e-45   Solanum lycopersicum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    168   3e-45   Petroselinum crispum
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        168   3e-45   Cucumis melo [Oriental melon]
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    168   3e-45   Solanum lycopersicum
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             168   3e-45   
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        168   4e-45   
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            167   4e-45   Daucus carota [carrots]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           167   4e-45   Fragaria vesca subsp. vesca
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       166   4e-45   Cucumis sativus [cucumbers]
gb|AGV54597.1|  phenylalanine ammonia-lyase                             167   4e-45   Phaseolus vulgaris [French bean]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     167   5e-45   Petroselinum crispum
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             167   5e-45   Phaseolus vulgaris [French bean]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    167   6e-45   
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       166   7e-45   Cucumis sativus [cucumbers]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          167   8e-45   Cynara cardunculus var. scolymus [artichoke]
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   8e-45   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    166   1e-44   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   1e-44   
gb|AER58180.1|  phenylalanine ammonia lyase                             166   1e-44   Cucumis sativus [cucumbers]
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   1e-44   
gb|AHA42445.1|  phenylalanine ammonia lyase                             165   1e-44   Cannabis sativa
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           166   1e-44   Astragalus membranaceus
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   1e-44   Solanum tuberosum [potatoes]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             166   2e-44   Chrysanthemum boreale
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   2e-44   Cucumis melo [Oriental melon]
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            160   2e-44   Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             166   2e-44   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   2e-44   Cucumis melo [Oriental melon]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       166   2e-44   Helianthus annuus
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   2e-44   Cucumis melo [Oriental melon]
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       163   2e-44   Cucumis sativus [cucumbers]
emb|CAA44818.1|  phenylalanine ammonia-lyase                            155   2e-44   Solanum tuberosum [potatoes]
gb|AJO53272.1|  phenylalanine ammonia-lyase                             166   2e-44   Pogostemon cablin
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   2e-44   Cucumis sativus [cucumbers]
ref|XP_007027354.1|  PHE ammonia lyase 1                                166   2e-44   Theobroma cacao [chocolate]
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            165   3e-44   Vigna radiata [mung bean]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    165   3e-44   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    165   3e-44   Solanum tuberosum [potatoes]
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           165   3e-44   Ageratina adenophora
gb|AGT63063.1|  phenylalanine ammonia-lyase                             165   3e-44   Solanum tuberosum [potatoes]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             165   3e-44   Hibiscus cannabinus [bimli-jute]
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   165   3e-44   Lactuca sativa [cultivated lettuce]
gb|AHA42443.1|  phenylalanine ammonia lyase                             165   4e-44   Cannabis sativa
emb|CAA44817.1|  phenylalanine ammonia-lyase                            154   4e-44   Solanum tuberosum [potatoes]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     165   4e-44   Nicotiana tomentosiformis
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              165   4e-44   Ricinus communis
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      164   5e-44   
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     164   5e-44   Daucus carota [carrots]
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    164   5e-44   Rubus idaeus [European raspberry]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 164   6e-44   Rubus idaeus [European raspberry]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    164   6e-44   
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    164   6e-44   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   6e-44   Cucumis melo [Oriental melon]
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   6e-44   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             164   7e-44   Glycine soja [wild soybean]
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 164   7e-44   Manihot esculenta [manioc]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             164   7e-44   Citrus clementina [clementine]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             164   8e-44   Quercus suber [cork oak]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             164   9e-44   Pogostemon cablin
prf||2001451A  Phe ammonia lyase                                        164   9e-44
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       164   1e-43   Pisum sativum [garden pea]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   164   1e-43   Populus tremuloides
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            164   1e-43   Lotus japonicus
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       164   1e-43   Citrus limon [lemon]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      164   1e-43   
gb|AIA66448.1|  PAL1                                                    164   1e-43   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    164   1e-43   Capsicum annuum
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   164   1e-43   Citrus sinensis [apfelsine]
gb|AEC11891.1|  PAL1                                                    163   1e-43   Petunia exserta
gb|AAV98199.1|  phenylalanine ammonialyase 1                            163   1e-43   Petunia x hybrida [garden petunia]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             163   1e-43   Gossypium arboreum [tree cotton]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             163   1e-43   Euphorbia pulcherrima
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    163   1e-43   Populus sieboldii x Populus grandidentata
gb|ACM44926.1|  phenylalanine ammonia-lyase                             163   1e-43   Euphorbia pulcherrima
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           163   1e-43   Ageratina adenophora
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           163   1e-43   Populus tomentosa [Chinese white poplar]
emb|CAA44609.1|  phenylalanine ammonia-lyase                            156   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 163   1e-43   Manihot esculenta [manioc]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             163   1e-43   Vitis vinifera
gb|AFU90757.1|  phenylalanine ammonia-lyase                             163   1e-43   Epimedium sagittatum
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             163   2e-43   Populus tomentosa [Chinese white poplar]
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        163   2e-43   Cucumis melo [Oriental melon]
gb|AAW78932.1|  phenylalanine-ammonia lyase                             163   2e-43   Rhodiola sachalinensis
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       163   2e-43   Stylosanthes humilis [alfafinha do nordeste]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           163   2e-43   Manihot esculenta [manioc]
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     163   2e-43   Nicotiana sylvestris
emb|CBI31445.3|  unnamed protein product                                162   2e-43   Vitis vinifera
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      162   3e-43   Citrus sinensis [apfelsine]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                162   3e-43   Medicago truncatula
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          162   3e-43   Vitis vinifera
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         162   3e-43   Jatropha curcas
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     162   3e-43   Nicotiana tomentosiformis
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                162   3e-43   Erythranthe guttata [common monkey flower]
gb|AIB06732.1|  phenylalanine ammonia lyase                             162   3e-43   Mangifera indica
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    162   3e-43   Solanum lycopersicum
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            162   4e-43   Gynura bicolor
emb|CDY18463.1|  BnaA04g21240D                                          155   4e-43   Brassica napus [oilseed rape]
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             162   4e-43   Cucumis melo [Oriental melon]
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      162   4e-43   Cucumis sativus [cucumbers]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             162   4e-43   Vitis vinifera
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       162   5e-43   Cucumis sativus [cucumbers]
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   5e-43   
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      162   5e-43   Cucumis melo [Oriental melon]
gb|ADD12041.1|  phenylalanine ammonia lyase                             162   5e-43   Cistanche deserticola
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                162   6e-43   Medicago truncatula
gb|ACT21093.1|  phenylalanine ammonia-lyase                             161   6e-43   Camellia oleifera [abura-tsubaki]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            161   6e-43   Lotus japonicus
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    161   7e-43   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             161   7e-43   Prunus persica
gb|AAQ74878.1|  phenylalanine ammonia lyase                             161   7e-43   Populus trichocarpa x Populus deltoides
gb|ACC63889.1|  phenylalanine ammonia-lyase                             161   8e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         161   8e-43   Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             161   8e-43   Populus szechuanica
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      161   8e-43   
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        161   9e-43   
gb|AEA72280.1|  phenylalanine ammonia-lyase                             160   1e-42   Angelica gigas
gb|ADO64252.1|  PAL                                                     160   1e-42   Epimedium sagittatum
emb|CBI26455.3|  unnamed protein product                                160   1e-42   Vitis vinifera
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         160   1e-42   Populus euphratica
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             160   1e-42   Vitis vinifera
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             160   1e-42   Phaseolus vulgaris [French bean]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        160   1e-42   Vitis vinifera
gb|AEX32784.1|  phenylalanine ammonia-lyase                             160   1e-42   Vitis vinifera
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        160   1e-42   Vitis vinifera
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          160   1e-42   Populus euphratica
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         160   2e-42   Populus trichocarpa [western balsam poplar]
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       160   2e-42   Medicago sativa [alfalfa]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         160   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        160   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             160   2e-42   Vitis vinifera
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            160   2e-42   Musa balbisiana [starchy banana]
gb|ACG56648.1|  phenylalanine ammonia lyase                             160   2e-42   Musa acuminata AAA Group [Cavendish banana]
gb|ACG56647.1|  phenylalanine ammonia lyase                             160   2e-42   Musa acuminata [banana]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              160   2e-42   Vitis vinifera
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             160   2e-42   Vitis vinifera
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        160   3e-42   Vitis vinifera
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    160   3e-42   Solanum tuberosum [potatoes]
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          159   3e-42   Cynara cardunculus var. scolymus [artichoke]
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             160   3e-42   Gossypium arboreum [tree cotton]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       159   3e-42   Camellia sinensis [black tea]
emb|CAA59217.1|  phenylalanine ammonia-lyase                            149   3e-42   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             159   3e-42   
gb|AAA34179.2|  phenylalanine ammonia lyase                             159   4e-42   
gb|KJB46525.1|  hypothetical protein B456_007G373600                    159   4e-42   
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        159   4e-42   
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             159   5e-42   
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       159   5e-42   
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         159   5e-42   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             159   5e-42   
gb|ACE95170.1|  phenylalanine ammonia-lyase                             159   6e-42   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             159   6e-42   
gb|KJB62426.1|  hypothetical protein B456_009G416300                    159   7e-42   
gb|AAU08174.1|  phenylalanine ammonia-lyase                             159   7e-42   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           159   7e-42   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        158   8e-42   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    158   8e-42   
gb|ACM62741.1|  phenylalanine ammonia-lyase                             158   1e-41   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    158   1e-41   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             158   1e-41   
gb|AGE10589.1|  phenylalanine amononia-lyase                            157   1e-41   
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       157   2e-41   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           157   2e-41   
emb|CDX74991.1|  BnaA05g07370D                                          154   2e-41   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             157   2e-41   
prf||2006271A  Phe ammonia lyase                                        157   2e-41
emb|CDX91331.1|  BnaC04g08190D                                          154   2e-41   
gb|AGH13333.1|  phenylalanine ammonia-lyase                             157   2e-41   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             157   2e-41   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             157   3e-41   
gb|AEX32790.1|  phenylalanine ammonia-lyase                             157   3e-41   
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   157   3e-41   
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        157   4e-41   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       157   4e-41   
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     155   4e-41   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             156   4e-41   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    156   4e-41   
gb|AAC18870.1|  phenylalanine ammonia lyase                             156   5e-41   
gb|ADY02661.1|  phenylalanine ammonia lyase                             156   5e-41   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         156   5e-41   
gb|ADY02662.1|  phenylalanine ammonia lyase                             156   5e-41   
gb|ADY02660.1|  phenylalanine ammonia lyase                             156   5e-41   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      156   6e-41   
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             156   7e-41   
gb|AEE81750.1|  phenylalanine ammonia lyase                             156   7e-41   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             155   8e-41   
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        155   8e-41   
emb|CDY13306.1|  BnaC06g14510D                                          147   9e-41   
gb|AID16077.1|  phenylalanine ammonium lyase                            155   1e-40   
emb|CAN77065.1|  hypothetical protein VITISV_009233                     155   1e-40   
gb|ADI40166.1|  phenylalanine ammonia-lyase                             155   1e-40   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            155   1e-40   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     155   1e-40   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    155   2e-40   
gb|ACZ36441.1|  phenylalanine ammonialyase                              155   2e-40   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           155   2e-40   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    155   2e-40   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      155   2e-40   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             155   2e-40   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             154   2e-40   
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            154   2e-40   
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        147   2e-40   
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             154   2e-40   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             154   3e-40   
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             154   3e-40   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    154   3e-40   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      154   3e-40   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      154   3e-40   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           154   3e-40   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        154   3e-40   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           154   3e-40   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        154   4e-40   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             154   4e-40   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             154   4e-40   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           154   5e-40   
emb|CDX67566.1|  BnaA07g16060D                                          152   6e-40   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        153   6e-40   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             153   7e-40   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             153   7e-40   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             153   8e-40   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            152   8e-40   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    153   9e-40   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         152   1e-39   
gb|AAC18871.1|  phenylalanine ammonia lyase                             152   1e-39   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           152   1e-39   
emb|CDO99754.1|  unnamed protein product                                152   1e-39   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             152   1e-39   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             152   1e-39   
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    151   1e-39   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      152   2e-39   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            152   2e-39   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           152   2e-39   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      152   2e-39   
gb|AGE10591.1|  phenylalanine amononia-lyase                            151   2e-39   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             152   2e-39   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             151   3e-39   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 151   3e-39   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             151   3e-39   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           151   3e-39   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        151   4e-39   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            151   4e-39   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           151   4e-39   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        151   5e-39   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             150   5e-39   
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     150   5e-39   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             150   5e-39   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           150   5e-39   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             150   6e-39   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             150   7e-39   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           150   7e-39   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        150   7e-39   
emb|CDX78161.1|  BnaA09g33560D                                          149   8e-39   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             150   1e-38   
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             150   1e-38   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             149   1e-38   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           149   1e-38   
emb|CDX73567.1|  BnaC08g24360D                                          148   1e-38   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             149   1e-38   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        149   2e-38   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        149   2e-38   
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    148   2e-38   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             149   2e-38   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      149   2e-38   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            149   2e-38   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        149   2e-38   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      149   3e-38   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             149   4e-38   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       148   4e-38   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             148   4e-38   
gb|KJB62427.1|  hypothetical protein B456_009G416400                    147   4e-38   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    148   4e-38   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    148   4e-38   
emb|CDX76219.1|  BnaA04g04830D                                          147   5e-38   
emb|CDY66761.1|  BnaCnng52250D                                          146   6e-38   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            147   7e-38   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           147   8e-38   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             147   9e-38   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      147   1e-37   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        147   1e-37   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            147   1e-37   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             147   1e-37   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             147   1e-37   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             147   1e-37   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        147   1e-37   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    146   2e-37   
emb|CAN61378.1|  hypothetical protein VITISV_032212                     146   2e-37   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    146   3e-37   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         146   3e-37   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            145   3e-37   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        145   4e-37   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             145   5e-37   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             145   5e-37   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             145   6e-37   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             145   7e-37   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   145   7e-37   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            145   7e-37   
emb|CDY00922.1|  BnaC05g42780D                                          144   9e-37   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           144   1e-36   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           144   1e-36   
emb|CDY08611.1|  BnaA05g28470D                                          144   1e-36   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             144   2e-36   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 144   2e-36   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        143   3e-36   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        143   3e-36   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             143   3e-36   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             143   3e-36   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             143   4e-36   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             143   4e-36   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              142   5e-36   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      142   5e-36   
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        142   6e-36   
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             142   6e-36   
gb|ADP88940.1|  phenylalanine ammonia-lyase                             132   8e-36   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           142   8e-36   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        142   9e-36   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            142   9e-36   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             141   1e-35   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             141   1e-35   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        141   1e-35   
ref|XP_010106883.1|  Phenylalanine ammonia-lyase                        132   2e-35   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        141   2e-35   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                140   2e-35   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        140   3e-35   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        140   3e-35   
ref|XP_004248441.1|  PREDICTED: phenylalanine ammonia-lyase-like        131   3e-35   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             140   4e-35   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        140   4e-35   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             140   5e-35   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        139   7e-35   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      139   7e-35   
gb|AGE10590.1|  phenylalanine amononia-lyase                            139   7e-35   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             139   8e-35   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           138   1e-34   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    138   2e-34   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        138   2e-34   
ref|XP_004248442.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      129   2e-34   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             138   2e-34   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             138   2e-34   
dbj|BAD14379.1|  hypothetical protein                                   128   2e-34   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       138   2e-34   
gb|EMT29667.1|  Phenylalanine ammonia-lyase                             132   3e-34   
ref|XP_006354305.1|  PREDICTED: phenylalanine ammonia-lyase-like        137   4e-34   
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        137   5e-34   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    137   5e-34   
gb|AIZ76766.1|  PAL2                                                    134   7e-34   
ref|XP_006846821.1|  hypothetical protein AMTR_s00148p00088930          136   9e-34   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        136   9e-34   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           136   1e-33   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            134   1e-33   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             135   2e-33   
gb|AIC66437.1|  phenylalanine ammonia lyase                             135   3e-33   
ref|XP_010107517.1|  Phenylalanine ammonia-lyase 1                      130   3e-33   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        135   3e-33   
gb|ABV72579.1|  phenylalanine ammonia lyase 1                           125   3e-33   
dbj|BAJ88975.1|  predicted protein                                      134   5e-33   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             134   5e-33   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             133   9e-33   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          133   1e-32   
gb|EEC73636.1|  hypothetical protein OsI_08144                          133   2e-32   
ref|NP_001047482.1|  Os02g0626400                                       132   2e-32   
ref|XP_004171092.1|  PREDICTED: phenylalanine ammonia-lyase-like        132   2e-32   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             132   2e-32   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            MEGAIENGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ
Sbjct  1    MEGAIENGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  60

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIAARDNAVKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  61   VAAIAARDNAVKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  112



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  375  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  115



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  375  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  115



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NGH N FC+KVDPLNWE+AADSL+GSHLDEVK MVAEFR PAVK+GG+TLTVAQVAAIA+
Sbjct  9    NGHQNGFCVKVDPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLTVAQVAAIAS  68

Query  396  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            RDNAV VELSE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  69   RDNAVTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  375  QVAAIAARDN--AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  115



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  375  QVAAIAARDN--AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  115



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK MVAE+R P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGGETLTVA  60

Query  375  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DNA  V VELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  115



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 101/116 (87%), Gaps = 7/116 (6%)
 Frame = +3

Query  204  GAIENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            G+ ENGH N     DFC+K DPLNW MAADSLKGSHLDEVKRMVAEFR P VK+GG+TLT
Sbjct  5    GSTENGHINNGEVLDFCLK-DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGGETLT  63

Query  369  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIAARD NAVKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  64   ISQVAAIAARDYNAVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  119



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            MEGAI NGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  +
Sbjct  1    MEGAIANGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTSLR  60

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
               IAARDNA K   S    A  ++SSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  61   SPPIAARDNASKWS-SPRLPARRESSSDWVMNSMNNGTDSYGVTTGFGATSH  111



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  HSNDFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  392
            + N FCIK   VDPLNWEMAA+SL+GSHLDEVKRMVAEFR PAVK+GG+TLTVAQVA IA
Sbjct  3    NQNGFCIKKQQVDPLNWEMAAESLRGSHLDEVKRMVAEFRKPAVKLGGETLTVAQVARIA  62

Query  393  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +RDNAV VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  63   SRDNAVAVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  109



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            M  A ENGH SN FC+K  DPLNW  AA++L+GSHLDEVK+MV EFR PAVK+GG+TLT+
Sbjct  1    MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIAARDNAV VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   AQVAAIAARDNAVAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 4/113 (4%)
 Frame = +3

Query  207  AIENGHS---NDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            A ENGH    N FC++  DPLNW MAA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT++
Sbjct  82   AAENGHHAAGNGFCVQQNDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGETLTIS  141

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAARDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  142  QVAAIAARDNAVAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  194



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ME A++N  SN    DFC+K DPLNW MAA++LKGSHLDEVKRMV EFR P VK+GG+TL
Sbjct  1    MEIALQNSDSNGKSMDFCVK-DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TV+QVAAIAARDNAV VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  60   TVSQVAAIAARDNAVTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AEW25915.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKKGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25882.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25893.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25899.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25902.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25904.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25905.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25913.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25916.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25917.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25920.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25925.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25926.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25929.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25931.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25932.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25933.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25936.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25944.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25948.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25886.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25891.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25892.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25896.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25898.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25901.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25911.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25918.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25927.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25928.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25930.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25937.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25884.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
Length=125

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEAXFCLSKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25883.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25887.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25895.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25900.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25910.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25934.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25935.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25939.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25942.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25945.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25946.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25889.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25914.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25943.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLXKNGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25888.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25908.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25909.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25912.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25921.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25922.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25938.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25941.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
Length=125

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLXKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25885.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25897.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25907.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25923.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25940.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25947.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLGKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  392
            +NG   +FC+K DPLNW MAA+SLKGSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIA
Sbjct  12   QNGERAEFCVKGDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTVSQVAAIA  71

Query  393  ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            A DNA VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  72   ASDNAGVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  119



>gb|AEW25919.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 94/116 (81%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA  D+ V+VELSE ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIAXHDSGVRVELSESARAGVKASSDWVMXSMNNGTDSYGVTTGFGATSH  115



>ref|XP_006424536.1| hypothetical protein CICLE_v10029946mg [Citrus clementina]
 gb|ESR37776.1| hypothetical protein CICLE_v10029946mg [Citrus clementina]
Length=132

 Score =   169 bits (428),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +3

Query  225  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+RD+
Sbjct  15   SGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVASRDD  74

Query  405  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSH
Sbjct  75   GVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSH  117



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 5/112 (4%)
 Frame = +3

Query  210  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            +ENGHS+    +FCI+ DPLNW  AA+SLKGSHLDE+KRMV EFR P VK+GG+TLT++Q
Sbjct  6    VENGHSSGKLLNFCIE-DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLGGETLTISQ  64

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA+RDNAVKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  65   VAAIASRDNAVKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  116



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 96/111 (86%), Gaps = 4/111 (4%)
 Frame = +3

Query  210  IENGHSND---FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            IENG  N+   FCIK DPLNW + A+SLKGSHL+EVKRMVAEFR P VK+GG+TLTV+QV
Sbjct  6    IENGQVNEAIEFCIK-DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGGETLTVSQV  64

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            A IAARDN VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  65   AGIAARDNGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AEW25903.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARA VKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAXVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            M  A ENGH SN FC++   DPLNW  AA++LKGSHLDEVKRMV EFR P VK+GG+TLT
Sbjct  1    MAAATENGHHSNGFCVQKQKDPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIA+RDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   ISQVAAIASRDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AEW25890.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVK MV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLXKNGGDPLNWGAAAESLXGSHLDEVKXMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AEW25906.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH     C+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATXCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 4/116 (3%)
 Frame = +3

Query  198  MEGAIENGHSND-FCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEGA+ NGH+   FC+     DPLNW +AADS+KGSHLDEVKRMV E+RNP V+IGG+TL
Sbjct  3    MEGALSNGHAQPTFCLTKTLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGGETL  62

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  63   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  118



>gb|AEW25894.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25924.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            MEG         FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TLT
Sbjct  1    MEGITNGXVEATFCLSKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGETLT  60

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  61   IAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  213  ENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            ENGH  SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++QVA
Sbjct  3    ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTISQVA  62

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIAA+DNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  63   AIAAKDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  112



>gb|ACF94719.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=210

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +3

Query  192  TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  356
            T +      G +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4    TRVSNGYHQGQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  357  QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +TLT++QVAAIA RD    +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  64   ETLTISQVAAIATRDQDASLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  122



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            M G I      DFCIKVDPLNWEMAA+SL+GSHLDEVK+MVAEFR P VK+GG+TLTVAQ
Sbjct  1    MAGVINGQQDLDFCIKVDPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGETLTVAQ  60

Query  378  VAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VA++AA+ N   VKVEL E ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  61   VASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  114



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 4/112 (4%)
 Frame = +3

Query  210  IENGH--SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            +ENGH  SN  C++   DPLNW  AA+SLKGSHLDEVKRMV EFR PAVK+GG++LT+AQ
Sbjct  1    MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLDEVKRMVEEFRKPAVKLGGESLTIAQ  60

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   VAAIAARDNAVAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  112



>emb|CAA33500.1| unnamed protein product [Petroselinum crispum]
Length=135

 Score =   166 bits (421),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 6/116 (5%)
 Frame = +3

Query  204  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  369  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  121



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 3/118 (3%)
 Frame = +3

Query  186  FNTTMEGAIENGHS-NDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  359
            F T++  A ENGHS N FC+K  DPLNW  AA++L+GSHLD VKRMV EFR PAVK+GG+
Sbjct  47   FTTSIMAA-ENGHSENGFCVKQSDPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGE  105

Query  360  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TLT+AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  106  TLTIAQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  163



>ref|XP_004173742.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=144

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C+K  DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSLESLCMKGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  62   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  111



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 98/121 (81%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  350
            MEG   NGH SN     +FCI     DPLNW  AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHATEAEFCISKTGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  351  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIENGHSN------DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  350
            ME    NGH++      + CI     DPLNW +AA++LKGS LDEVKRMV E+RNP VKI
Sbjct  1    MEAVGANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKI  60

Query  351  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            GG+TLT++QVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 97/118 (82%), Gaps = 6/118 (5%)
 Frame = +3

Query  198  MEGAIENGHSND----FCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  359
            M  A ENGH N     FC+K   DPLNW  AA++LKGSHL+EVKRMV EFR P VK+GG+
Sbjct  1    MAAATENGHRNGAVNGFCVKAQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVKLGGE  60

Query  360  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +LT++QVAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   SLTISQVAAIAARDNAVAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  118



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 4/113 (4%)
 Frame = +3

Query  207  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DNAV VEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  62   QVAAIAAKDNAVAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  114



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  350
            MEG   NGH SN     ++CI     DPLNW +AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  351  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|AEW10551.1| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=119

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 94/118 (80%), Gaps = 11/118 (9%)
 Frame = +3

Query  213  ENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            +NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TLT
Sbjct  1    QNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETLT  60

Query  369  VAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  61   VAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  118



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NG    FC++ DPLNW+MAA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA 
Sbjct  13   NGSIKSFCVQQDPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKLGGETLTISQVAAIAT  72

Query  396  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  73   HDAGVKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  118



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            M  ++EN H SN FC++  DPLNW +AA++LKGSHLDEVK+MVAEFR P VK+GG+TLT+
Sbjct  1    MAPSLENDHHSNGFCVQQKDPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +QVAAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   SQVAAIAARDNGVAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ME A EN + N     FCI+ DPLNWE AA+SLKGSHLDEVKRMV EFR P V++GGQTL
Sbjct  1    MEFAQENCNGNGSLKSFCIQQDPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVRLGGQTL  60

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T++QVAAIA  D  VKV LSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   TISQVAAIATHDAGVKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  116



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +3

Query  210  IENGHSND--FCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            +ENGH N   FC+K  DPLNW  AA++L+GSHLDEVKRMVAEFR P VK+GG+TLT++QV
Sbjct  1    MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGETLTISQV  60

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   AAIAARDNGVVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  350
            MEG   NGH SN     +FCI     DPLNW +AA+++KGSHLDEVKRMV ++RNP VKI
Sbjct  1    MEGEGANGHVSNNVTEAEFCITKTGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVVKI  60

Query  351  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            GG+TLTVAQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTVAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +3

Query  198  MEGAIE--NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            ME  +E  NG S +FC++ DPLNWEMAA+S+KGSHLDEVKRMVAEFR P V++ G+TLT+
Sbjct  1    METIVEKGNGKSMEFCMQ-DPLNWEMAAESMKGSHLDEVKRMVAEFRKPVVQLAGKTLTI  59

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             QVA+IAA D+ VKVEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  60   GQVASIAAHDDGVKVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  113



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = +3

Query  207  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+DNAV VEL E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  62   QVAAIAAKDNAVAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  114



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 5/112 (4%)
 Frame = +3

Query  213  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNRVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  122



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 5/112 (4%)
 Frame = +3

Query  213  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  122



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 6/114 (5%)
 Frame = +3

Query  210  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK+GG++LTVA
Sbjct  1    MENGHDEGVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKLGGESLTVA  60

Query  375  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  120



>gb|AFR41032.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41034.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   163 bits (413),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWSMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  120



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHKNGSVELPELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  120



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  115



>gb|AFR41029.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41031.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41035.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWXMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 6/114 (5%)
 Frame = +3

Query  210  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK GG++LTVA
Sbjct  1    MENGHDECVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKFGGESLTVA  60

Query  375  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 3/114 (3%)
 Frame = +3

Query  198  MEGAIENGHSN--DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            ME  +ENG+    +FC+K DPLNWEMA++S+KGSHLDEVK MVAEFR P V++ G+TLT+
Sbjct  1    METIVENGNGKTMEFCMK-DPLNWEMASESMKGSHLDEVKNMVAEFRKPVVQLAGKTLTI  59

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             QVAAIAARD+ V VEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  60   GQVAAIAARDDGVTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  113



>gb|AFR41033.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   XARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            NGH N    DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA
Sbjct  5    NGHVNGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVA  64

Query  384  AIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             IAA  ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  65   GIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  116



>gb|AFR41030.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  AIENGHSND--FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            A  NGHS +  FC++ DPLNW  AA+ LKGSHLDEVK+MV EFR P V++GG+TLT+AQV
Sbjct  2    AYSNGHSKNGGFCVE-DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKTLTIAQV  60

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA  D+ VKVELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  61   AAIATHDSGVKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  111



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
             CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D  VK
Sbjct  4    LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTGVK  63

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  64   VELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  103



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 4/110 (4%)
 Frame = +3

Query  204  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 4/110 (4%)
 Frame = +3

Query  204  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 4/110 (4%)
 Frame = +3

Query  216  NGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            NGH   +N FC+K  DPLNW  AA+SLKGSHL+EVKRMV EFR P VK+GG+TLT++QVA
Sbjct  10   NGHNNGANGFCVKQNDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGETLTISQVA  69

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  70   AIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  119



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH  +       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  123



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 96/117 (82%), Gaps = 11/117 (9%)
 Frame = +3

Query  216  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            NGH N     + C K    DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  372  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  64   AQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  120



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  213  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA  D+ VKVELSE A+AGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  68   QVAAIATHDSGVKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  120



>ref|XP_004173741.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=141

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +3

Query  210  IENGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            + N H N  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNAHQNCSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAA++  D  V+VELSE AR GVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  66   QVAAVSGHDQGVRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  118



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +3

Query  198  MEGAIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            M   +ENGH  +N FC+K  DPLNW  AA+ LKGSHLDEVKRMV EFR   VK+GG+TLT
Sbjct  1    MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLT  60

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIAARDN V V+L+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   ISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  225  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            S++ CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D+
Sbjct  5    SSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDS  64

Query  405  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  65   GVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  107



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +3

Query  204  GAIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            G +  G + + C K  DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG++LTVAQV
Sbjct  5    GHVNGGENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQV  64

Query  381  AAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  65   AAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  118



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  115



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 11/117 (9%)
 Frame = +3

Query  216  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            NGH N     + C K    DPLNWEMA++SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  372  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  64   AQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  120



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 93/114 (82%), Gaps = 8/114 (7%)
 Frame = +3

Query  216  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSH
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSH  124



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 93/114 (82%), Gaps = 8/114 (7%)
 Frame = +3

Query  216  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSH
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSH  124



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  IENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  386
            +ENG+   +FC+K DPLNW MAA+S+KGSHLDEVK+MVAEFR P V++ G+TLT+AQVAA
Sbjct  1    MENGNGKMEFCMK-DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVVQLAGKTLTIAQVAA  59

Query  387  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            IAARD+ V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  60   IAARDDGVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSH  108



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NGH ND CIK DPLNW +AA++L GSHL+EVK+MV EF+NP VKIGG+TLTV+QVA IAA
Sbjct  15   NGHINDLCIK-DPLNWGVAAEALTGSHLNEVKKMVKEFKNPIVKIGGETLTVSQVAGIAA  73

Query  396  RDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             DNA VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  74   SDNASVKVELSESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  120



>gb|AFR41042.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41053.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=127

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41051.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=120

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41046.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=114

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41056.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=126

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41048.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41055.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41057.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=124

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41047.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41052.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=120

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41049.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41054.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=123

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41050.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=122

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41018.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41019.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41021.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41025.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41026.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41027.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41037.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41038.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41039.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41040.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41041.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41043.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41044.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41045.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
Length=127

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41036.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
Length=127

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41022.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41024.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=124

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 96/123 (78%), Gaps = 11/123 (9%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  344
            ME   +NGH       FC         VDPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  345  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  524
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  525  TSH  533
            TSH
Sbjct  121  TSH  123



>gb|AFR41017.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41028.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=115

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|AFR41020.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=126

 Score =   159 bits (402),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 4/116 (3%)
 Frame = +3

Query  198  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  116



>gb|AFR41023.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=123

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 4/116 (3%)
 Frame = +3

Query  198  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  116



>gb|ABL14040.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 7/120 (6%)
 Frame = +3

Query  195  TMEGAIENG--HSND--FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  353
            T EGA  N   H+N+  FCI+    DP NW +AA++LKGSHLDEVKRMV E+R P V+IG
Sbjct  2    TGEGANGNAKNHANEVEFCIRETRGDPFNWGVAAEALKGSHLDEVKRMVEEYRKPVVRIG  61

Query  354  GQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            G+TLT++QVAAIA  D  VKV+LSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  62   GETLTISQVAAIAGHDQGVKVDLSESARDGVKASSDWVMESMNKGTDSYGVTTGFGATSH  121



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 96/123 (78%), Gaps = 11/123 (9%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  344
            ME   +NGH       FC         +DPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  345  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  524
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  525  TSH  533
            TSH
Sbjct  121  TSH  123



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +3

Query  213  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            +NGH N       CIK  PLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKAPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGV TGFGATSH
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVPTGFGATSH  122



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +3

Query  204  GAIENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            G  ENG+  D C+K  DPL+W +AA++LKGSHL+EVKRMVAE+R P VK+GG+TLT++QV
Sbjct  6    GHHENGNGVDLCMKKEDPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVKLGGETLTISQV  65

Query  381  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAI+ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  66   AAISARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  117



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  366  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  115



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 5/117 (4%)
 Frame = +3

Query  198  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            M    ENG  ND    FC +  DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  363  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  117



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 6/116 (5%)
 Frame = +3

Query  204  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            GAI NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GAITNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  369  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  121



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +3

Query  213  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  120



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +3

Query  213  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  120



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 5/117 (4%)
 Frame = +3

Query  198  MEGAIENGH-----SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            ME + EN       S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+T
Sbjct  1    MEASHENQSGGNIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGET  60

Query  363  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LT+AQVAA+A+RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSH
Sbjct  61   LTIAQVAAVASRDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSH  117



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKG HLDEVKRMV EFR P VK+GG+TLT++QVAAIAARDNAV VEL+E
Sbjct  20   DPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNAVAVELAE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +3

Query  192  TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  356
            T +        +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4    TRVSNGYHQSQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  357  QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +TLT++QVAAIA RD  V +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  64   ETLTISQVAAIATRDQDVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  122



>ref|XP_010662173.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Vitis vinifera]
Length=178

 Score =   160 bits (404),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVN  73

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSH
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSH  113



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 5/117 (4%)
 Frame = +3

Query  198  MEGAIENGH-----SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            ME + EN       S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+T
Sbjct  1    MEASHENQSGGNIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGET  60

Query  363  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LT+AQVAA+A+RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSH
Sbjct  61   LTIAQVAAVASRDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSH  117



>gb|KGN48166.1| hypothetical protein Csa_6G446280 [Cucumis sativus]
Length=166

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDFDVTVELSE  73

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  74   SARAGVKASSDWVMESMKKGTDSYGVTTGFGATSH  108



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 5/117 (4%)
 Frame = +3

Query  198  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            M    ENG  ND    FC    DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  363  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  117



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  AIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            A ENGH  SN FC+K  DPLNW  AA+S+ GSHL EVKRMV EFR P V++GG+TLT++Q
Sbjct  2    AAENGHHASNGFCVKQSDPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETLTISQ  61

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GT SYGVTTGFGATSH
Sbjct  62   VAAIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSH  113



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 5/108 (5%)
 Frame = +3

Query  225  SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  389
            ++ FC+       DPLNW +AA+SLKGSHLDEVKRMV EFR P V++GG+TLT++QVAAI
Sbjct  11   ADSFCLSGGVAAADPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQVAAI  70

Query  390  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AA D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  71   AAHDQGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  118



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHS-NDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            NGHS  +FCIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSSQEFCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  381  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA R    VKVELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSH
Sbjct  69   AAIAGRSGTEVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSH  120



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG    FC    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESFCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 97/125 (78%), Gaps = 13/125 (10%)
 Frame = +3

Query  198  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            M    +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MVAEFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVK  60

Query  348  IGGQTLTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
            +GG+TLTVAQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  519  GATSH  533
            GATSH
Sbjct  121  GATSH  125



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  116



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FCIK DPLNW MAAD+LKGSHLDEVK+MV E+R   V++GG+TLT++QVAA+A+ D  VK
Sbjct  15   FCIKEDPLNWGMAADALKGSHLDEVKKMVKEYRQGVVRLGGETLTISQVAAVASHDQGVK  74

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  75   VELNESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 95/120 (79%), Gaps = 13/120 (11%)
 Frame = +3

Query  213  ENGHSN--------DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            +NGH N        D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  7    QNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  66

Query  363  LTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  67   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  116



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 92/114 (81%), Gaps = 8/114 (7%)
 Frame = +3

Query  216  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  18   NGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  77

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +QVAAIA RD  VKVELSE A AGVKAS+DWV++ MN GTDSYGVTTGFGATSH
Sbjct  78   SQVAAIATRDLGVKVELSEDAMAGVKASADWVLDGMNKGTDSYGVTTGFGATSH  131



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  207  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  70   AAIATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  120



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  207  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  70   AAIATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  120



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 6/116 (5%)
 Frame = +3

Query  204  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  369  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  121



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 95/119 (80%), Gaps = 11/119 (9%)
 Frame = +3

Query  210  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  366  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 6/116 (5%)
 Frame = +3

Query  204  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  369  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  121



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG S   C+   DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSSESLCMNGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  62   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  111



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 95/119 (80%), Gaps = 11/119 (9%)
 Frame = +3

Query  210  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  366  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 95/119 (80%), Gaps = 11/119 (9%)
 Frame = +3

Query  210  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  366  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 95/119 (80%), Gaps = 11/119 (9%)
 Frame = +3

Query  210  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  366  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +3

Query  204  GAIENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            G  ENG+  D C+K  DPL+W +AA++L GSHL+EVKRMVAE+R P VK+GG+TLT++QV
Sbjct  6    GHHENGNGVDLCMKKEDPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVKLGGETLTISQV  65

Query  381  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAI+ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  66   AAISARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  117



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = +3

Query  189  NTTMEGAIENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            N   +  I+NG  +  C+K        DPLNW  AA+S+ GSHLDEVKRMVAE+R P VK
Sbjct  7    NGYHQNGIQNGSLDILCVKTESLKAVSDPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVK  66

Query  348  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  527
            +GG+TLT+AQVAAIA  D+ VKVEL E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  67   LGGKTLTIAQVAAIANHDSGVKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  126

Query  528  SH  533
            SH
Sbjct  127  SH  128



>gb|KGN48161.1| hypothetical protein Csa_6G445740 [Cucumis sativus]
Length=544

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 86/103 (83%), Gaps = 3/103 (3%)
 Frame = +3

Query  234  FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD 
Sbjct  13   FCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVAAIATRDT  72

Query  405  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  73   DVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AGV54597.1| phenylalanine ammonia-lyase [Phaseolus vulgaris]
Length=714

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = +3

Query  210  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  117



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            NGH+N    D C+K  DPLNW +AA++L GSHLDEVKRMVAE+R P VK+ G+TLT++QV
Sbjct  9    NGHANGNGLDLCMKKEDPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEGETLTISQV  68

Query  381  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  69   AAISARDDSGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  120



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = +3

Query  210  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  117



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = +3

Query  216  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  115



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            NGH N    DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA
Sbjct  5    NGHVNGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVA  64

Query  384  AIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             IAA  ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  65   GIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  116



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = +3

Query  222  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = +3

Query  222  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  115



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  110



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 7/113 (6%)
 Frame = +3

Query  216  NGHSNDFCIK------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            N +   FC+K       DPLNW +AA+S+KGSHLDEVKRMV E+R P V++GG+TLT++Q
Sbjct  9    NFNGGSFCLKNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGETLTISQ  68

Query  378  VAAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA A D+ V+VELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  69   VAAIAGAYDDGVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  121



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 90/106 (85%), Gaps = 5/106 (5%)
 Frame = +3

Query  231  DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  401
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  D 
Sbjct  21   DLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  402  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  81   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            ++NGH+N    + CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+Q
Sbjct  1    MDNGHANGVAKELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQ  59

Query  378  VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VA IAA +NA VKVEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  60   VAGIAASENAGVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  112



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  207  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA RD+ V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  70   AAIATRDSDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  120



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSH
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSH  113



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 10/117 (9%)
 Frame = +3

Query  213  ENGHSN-----DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            +NGH N     D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+V
Sbjct  7    QNGHINGEVAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSV  66

Query  372  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSH
Sbjct  67   AQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSH  123



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG +   C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSTESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 91/108 (84%), Gaps = 3/108 (3%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NG +N FCIK DPLNW +AA++L GSHLDEVK+MV EFR P VK+GG+TLTV+QVA I+A
Sbjct  8    NGSANGFCIK-DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISA  66

Query  396  RD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
                N VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  67   AGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  20   DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>emb|CAA44818.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=141

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 5/106 (5%)
 Frame = +3

Query  231  DFCIKVD--PLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            + C K +  PLNWEMAADSL+GS LD+VK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21   NLCKKQNYLPLNWEMAADSLRGSKLDQVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  405  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
                V+VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  81   KSNGVRVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 6/114 (5%)
 Frame = +3

Query  210  IENGHSND-FCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            +ENG++ D  C++     VDPLNW  AA++L+GSHLDEVKRMV EFR P V++GG+TLT+
Sbjct  1    MENGNNGDGLCVQSRNDVVDPLNWNAAAEALRGSHLDEVKRMVEEFRKPVVRLGGETLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             QVAA+A R+ AV VEL+E AR GVKASSDWVM SMNNGTDSYGVTTGFGATSH
Sbjct  61   GQVAAVATREAAVTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGFGATSH  114



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  ENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  389
            +NG     CI   DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  9    KNGSVESLCIGSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  68

Query  390  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            A RD  V VELSE +RAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  69   ATRDTDVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  116



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 94/125 (75%), Gaps = 13/125 (10%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCIK---------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  338
            ME   +NG  N     FC           VDPLNW   A+SLKGSHLDEVKRMVAE+R P
Sbjct  1    METIAQNGRQNGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKP  60

Query  339  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
            +VK+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGF
Sbjct  61   SVKLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGF  120

Query  519  GATSH  533
            GATSH
Sbjct  121  GATSH  125



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +3

Query  210  IENGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            + NG+ N  FC       DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNGNQNGSFCFTSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  375  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVA ++A D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  66   QVAGVSAHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  118



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 13/120 (11%)
 Frame = +3

Query  213  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  363  LTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVA+IA  D   N VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 13/120 (11%)
 Frame = +3

Query  213  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  363  LTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVA+IA  D   N VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 7/117 (6%)
 Frame = +3

Query  204  GAIE-NGHSN---DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            G+IE NG  N    FC+K DPLNW + A+SLKGSHLDEVKRMV EFRNP VK+GG+TLTV
Sbjct  2    GSIEFNGDQNIDNYFCVKGDPLNWGVVAESLKGSHLDEVKRMVTEFRNPVVKLGGETLTV  61

Query  372  AQVAAI--AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            +QVAAI  AA D++ +KVELSE AR GVKASS+WVM SMN GTDSYGVTTGFGATSH
Sbjct  62   SQVAAIAVAATDSSNIKVELSESAREGVKASSEWVMESMNKGTDSYGVTTGFGATSH  118



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 96/125 (77%), Gaps = 13/125 (10%)
 Frame = +3

Query  198  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            M    +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  348  IGGQTLTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
            +GG+TLTVAQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  519  GATSH  533
            GATSH
Sbjct  121  GATSH  125



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  246  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  425
            VDPLNW +AA+SLKGSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  23   VDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  82

Query  426  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSH
Sbjct  83   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSH  118



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NG  N+ CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  8    NGVVNELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  66

Query  396  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             +++  VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  67   ANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  114



>gb|AHA42443.1| phenylalanine ammonia lyase [Cannabis sativa]
Length=707

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  110



>emb|CAA44817.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=138

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 90/117 (77%), Gaps = 10/117 (9%)
 Frame = +3

Query  213  ENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            +NGH N    +V       DPLNWEMA DSL+GSHLDEVK+MV EFR P VK+ G+TLTV
Sbjct  7    QNGHVNGEVEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGETLTV  66

Query  372  AQVAAIAARDNAV---KVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVA+IA  DN     KVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF ATSH
Sbjct  67   AQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSH  123



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 91/112 (81%), Gaps = 6/112 (5%)
 Frame = +3

Query  216  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            NGHS+ + CIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSDQELCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  381  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIA R    V VELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSH
Sbjct  69   AAIAGRSGTEVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSH  120



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 86/104 (83%), Gaps = 4/104 (4%)
 Frame = +3

Query  234  FCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  401
            FC       DPLNW M ADSLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA RD
Sbjct  19   FCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLTIAQVTAIANRD  78

Query  402  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
              +KVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  79   AGIKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  122



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 91/114 (80%), Gaps = 6/114 (5%)
 Frame = +3

Query  210  IENGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            I NG  N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+
Sbjct  6    ITNGSQNGSFCLSTTKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTI  65

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAA+A  D  V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSH
Sbjct  66   AQVAAVAGHDLGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSH  119



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +3

Query  228  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  407
            N  C++ DPLNW MAA++L GSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIAA   +
Sbjct  12   NGLCMQKDPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQLGGETLTVSQVAAIAA--GS  69

Query  408  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  70   VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111



>sp|Q9M568.1|PAL1_RUBID RecName: Full=Phenylalanine ammonia-lyase 1; AltName: Full=RiPAL1 
[Rubus idaeus]
 gb|AAF40223.1|AF237954_1 phenylalanine ammonia-lyase 1 [Rubus idaeus]
Length=710

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NG    FC   DPLNW MAA+SLKGSH+DE+KRMV+++R P VK+GG+TLT+ QVAAIA+
Sbjct  8    NGAVESFCEGHDPLNWNMAAESLKGSHVDELKRMVSDYRKPVVKLGGETLTIGQVAAIAS  67

Query  396  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             D  V+VELSE  RAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  68   HDGGVRVELSEEKRAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  113



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 11/122 (9%)
 Frame = +3

Query  201  EGAIENGHSND-FCIKV----------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            +  I+NG  +D  CIK           DPLNW  AA+S+ GSHLDEV+RMVAE+R P VK
Sbjct  12   QNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVK  71

Query  348  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  527
            +GG+TLT++QVAAIA  D+ VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  72   LGGETLTISQVAAIANHDSGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  131

Query  528  SH  533
            SH
Sbjct  132  SH  133



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 13/125 (10%)
 Frame = +3

Query  198  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            M   + NGH+N      D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  348  IGGQTLTVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
            +GG+TLT+AQVA+IA  D   N VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  519  GATSH  533
            G TSH
Sbjct  121  GDTSH  125



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 11/119 (9%)
 Frame = +3

Query  210  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  365
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  366  TVAQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            T+AQVA+IA  D   N VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFG TSH
Sbjct  66   TIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  124



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVESLCNSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  116



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +3

Query  216  NGHSND-FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  389
            NGH  D  C    DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  6    NGHIEDNLCHTHSDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  65

Query  390  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            A RD+ V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  66   ATRDSDVIVELSESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSH  113



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +3

Query  216  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNN TDSYGVTTGFGATSH
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSH  115



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 5/111 (5%)
 Frame = +3

Query  213  ENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            +NGH N      C   DPLNW +AA+S+ GSHLDEVK+MVAEFR P VK+GG+TLTVAQV
Sbjct  6    QNGHQNGSLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGETLTVAQV  65

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAI AR++ ++VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  66   AAI-ARESGLQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  115



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 9/115 (8%)
 Frame = +3

Query  216  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            NG +ND          C   DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG++LT
Sbjct  9    NGINNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLT  68

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSH  123



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            ME    NG S + C   DPLNW +AA+ LKGSHLDEVKRMV EFR P VK GG++LT+AQ
Sbjct  1    MEYCNGNGSSVNSCKSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLVKPGGKSLTIAQ  60

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA++D A+KVEL+E ARAGVKASSDWVM SM+ G DSYGVTTGFGATSH
Sbjct  61   VAAIASQDGAIKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGFGATSH  112



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  371
            M  A+ENGH SN  C+K  DPLNW  AADSLKGSHLDEVK+MV EFR   VK+GG+TLT+
Sbjct  1    MAPAVENGHFSNGLCVKQSDPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGETLTI  60

Query  372  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AQVAAIAARDNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  61   AQVAAIAARDNAVAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSH  114



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  127



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  207  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  383
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  384  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  127



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPL+W +AA+S+KGSHL+EVKRMVAE+R P VK+GG+TLT+AQVAAIAA +  V VEL E
Sbjct  13   DPLSWGVAAESMKGSHLNEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANEQGVSVELCE  72

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  73   SARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  107



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
             C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIAA D+ VK
Sbjct  24   LCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSGVK  83

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  84   VELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSH  123



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +3

Query  225  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            S  FCI  DPLNW  +A+SLKGSHLDEVKRMV EFR P V++GG+TLT+AQVAAIA RD 
Sbjct  15   SPGFCI-TDPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTIAQVAAIANRDA  73

Query  405  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             VKVELSE AR  VKASSDWVM  MN GTDSYGVTTGFGATSH
Sbjct  74   GVKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSH  116



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 5/106 (5%)
 Frame = +3

Query  231  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  405  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSH  120



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 5/106 (5%)
 Frame = +3

Query  231  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  404
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  405  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSH  120



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
             C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIAA D+ VK
Sbjct  24   LCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSGVK  83

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSH
Sbjct  84   VELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSH  123



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  353
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  354  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  198  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  353
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  354  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  530
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  531  H  533
            H
Sbjct  121  H  121



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  246  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  425
            VDPLNW +AA+SL+GSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  426  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSH
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSH  124



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 8/119 (7%)
 Frame = +3

Query  201  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  363  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  124



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+RNP VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  114



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 8/119 (7%)
 Frame = +3

Query  201  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  363  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  124



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  216  NGHSND-FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  392
            NG  ND FCIK DPLNW  AA  L GSHLDEVK+MVAEFR P VK+GG+TLTVAQVA IA
Sbjct  16   NGVVNDPFCIK-DPLNWGAAAAELTGSHLDEVKKMVAEFRKPVVKLGGETLTVAQVAGIA  74

Query  393  ARD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            A D  +AVKVELSE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  75   AADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDSYGVTTGFGATSH  123



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 6/118 (5%)
 Frame = +3

Query  198  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            ME   +NGH N      CI ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGHQNGSLESLCINQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  363  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSH  118



>emb|CAA44609.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=240

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSH  128



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSH
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSH  113



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+  DPLNW +AA+ LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVT  73

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  74   VELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSH  113



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  216  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  395
            NG  +  C+K DPLNW +AA+SL+GSHLDEVKRMV EF  P VK+ GQ+LT++QVAA+A 
Sbjct  14   NGSIDGLCMKSDPLNWGLAAESLQGSHLDEVKRMVNEFHKPIVKLEGQSLTISQVAAVAM  73

Query  396  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            R + ++VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  74   RADGIEVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  119



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P +K+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  114



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDIDVTVELSE  73

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  74   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  108



>gb|AAW78932.1| phenylalanine-ammonia lyase [Rhodiola sachalinensis]
Length=710

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  213  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  392
            +NGHS    +  DPL+W +AA+++KGSHLDEVKRMV E+R PAVK+GG+TLT+AQVAAIA
Sbjct  7    QNGHSVANVVVKDPLSWGLAAEAMKGSHLDEVKRMVEEYRKPAVKLGGETLTIAQVAAIA  66

Query  393  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             R + V+VELSE AR GVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  67   GRGSDVRVELSESAREGVKASSDWVMESMGKGTDSYGVTTGFGATSH  113



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 89/108 (82%), Gaps = 8/108 (7%)
 Frame = +3

Query  234  FCI--------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  389
            FC+        + DPLNW  AA++LKGSHLDEVKRMV+E+R P V +GGQTLT++QVAAI
Sbjct  11   FCLTANNGQQPRHDPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAI  70

Query  390  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AA D  V V+LSE +RAGVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  71   AANDQGVSVQLSEASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  118



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSH
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSH  113



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  216  NGH--SNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            NGH  S +FCIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+ Q
Sbjct  9    NGHNASQEFCIKGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVRLGGETLTIGQ  68

Query  378  VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSH
Sbjct  69   VAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSH  121



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  126



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 92/117 (79%), Gaps = 5/117 (4%)
 Frame = +3

Query  198  MEGAIENGH-----SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  362
            ME + EN       S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R   V++GG+T
Sbjct  1    MEASHENQSGGNIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKQVVRLGGET  60

Query  363  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            LT+AQVAA+A+RD  V VEL+E ARAGVKASSDWVM SMN GTDSYG+TTGFGATSH
Sbjct  61   LTIAQVAAVASRDGGVTVELNEEARAGVKASSDWVMESMNKGTDSYGITTGFGATSH  117



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 97/125 (78%), Gaps = 12/125 (10%)
 Frame = +3

Query  195  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  338
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSHLDEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKP  62

Query  339  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  519  GATSH  533
            GATSH
Sbjct  123  GATSH  127



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSH
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  126



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW   A+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+AQV AIA RD  VKVELSE
Sbjct  21   DPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIAQVTAIANRDAGVKVELSE  80

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  81   AARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  115



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 91/114 (80%), Gaps = 8/114 (7%)
 Frame = +3

Query  216  NGHSN---DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  374
            NGH+N   + CIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+A
Sbjct  9    NGHNNASQELCIKGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVQLGGETLTIA  68

Query  375  QVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            QVAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSH
Sbjct  69   QVAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSH  122



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  AIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            A ENGH  SN +C+K  DPLNW +AA+ LKGSHLDEVKRMV EFR P V +GG+TLT+AQ
Sbjct  6    ATENGHHNSNGYCVKQKDPLNWGLAAEGLKGSHLDEVKRMVEEFRKPVVNLGGKTLTIAQ  65

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAAIAA DNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSH
Sbjct  66   VAAIAATDNAVAVELAEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSH  117



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT+ QV AIA+ D+ V+VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAIASHDSGVRVELSE  75

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGV+ASSDWVM SM NGTDSYGVTTGFGATSH
Sbjct  76   TARAGVQASSDWVMESMKNGTDSYGVTTGFGATSH  110



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 5/106 (5%)
 Frame = +3

Query  231  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  401
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  402  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSH
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSH  107



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = +3

Query  222  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  401
            H +D CIK D LNW +AA++L GSHLDEVK+MVAEFRNP VKIGG+TLTV+QVA IAA  
Sbjct  25   HVHDLCIK-DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQVAGIAAAS  83

Query  402  NA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSH
Sbjct  84   DSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSH  129



>emb|CDY18463.1| BnaA04g21240D [Brassica napus]
Length=263

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  228  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  407
            N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24   NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  408  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSH
Sbjct  84   VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSH  125



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  17   DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  76

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  77   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 92/115 (80%), Gaps = 8/115 (7%)
 Frame = +3

Query  213  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSH
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSH  117



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  413
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREGDVS  73

Query  414  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VELSE ARAGVKASSDWVM SM  G DSYGVTTGFGATSH
Sbjct  74   VELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSH  113



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD+ V VELSE
Sbjct  17   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDSDVIVELSE  76

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  77   SARVGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111



>ref|XP_004156289.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=714

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 92/115 (80%), Gaps = 8/115 (7%)
 Frame = +3

Query  213  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSH
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSH  117



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 8/115 (7%)
 Frame = +3

Query  213  ENGHSN--DFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  368
            E+G+ N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ESGYQNGVEFCIGARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  369  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSH
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSH  117



>gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola]
 gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola]
Length=709

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +3

Query  210  IENGH-SNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  380
            +ENGH SN FC+    DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG++LT+AQV
Sbjct  1    MENGHHSNVFCVNENKDPLNWAAAAESLKGSHLDEVKRMVEEFRKPVVKLGGESLTIAQV  60

Query  381  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            AAIAARDNAV VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  61   AAIAARDNAVAVELAEAARDGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 12/125 (10%)
 Frame = +3

Query  195  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  338
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSH+DEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKP  62

Query  339  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  518
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  519  GATSH  533
            GATSH
Sbjct  123  GATSH  127



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +3

Query  198  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  377
            ME   ENG+ N   IK DPL+WE+AADS+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1    MEFCHENGNGNGHVIK-DPLSWELAADSMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  378  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSH
Sbjct  60   VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSH  109



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  255  LNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSEGA  434
            L+W +AA+S+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQVAAIAA D  V VEL E A
Sbjct  1    LSWGVAAESMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANDQGVSVELCESA  60

Query  435  RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
            RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH
Sbjct  61   RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  93



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 13/122 (11%)
 Frame = +3

Query  195  TMEGAIENGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  347
            T EG   NG++N FC+ V         DPLNW  AA+++ GSHLDEVKRMV E+R P VK
Sbjct  2    TQEG---NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVK  57

Query  348  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  527
            +GG+TLT++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGAT
Sbjct  58   LGGETLTISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGAT  117

Query  528  SH  533
            SH
Sbjct  118  SH  119



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQVAAIA  D+ V VELSE
Sbjct  28   DPLNWGMAAESLKGSHLDEVKRMVNEYRKPVVRLGGETLTIAQVAAIANHDSGVHVELSE  87

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  88   DARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  114



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  249  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  428
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  429  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000