BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028J09

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                243   3e-72   Sesamum indicum [beniseed]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             238   4e-70   Prunus persica
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                235   3e-69   Erythranthe guttata [common monkey flower]
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                234   6e-69   Prunus mume [ume]
ref|XP_007012625.1|  Subtilase family protein                           232   6e-68   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                231   8e-68   
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                231   1e-67   Nicotiana sylvestris
ref|XP_010090170.1|  Subtilisin-like protease                           230   2e-67   Morus notabilis
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           229   5e-67   Solanum tuberosum [potatoes]
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                229   5e-67   Nicotiana tomentosiformis
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                229   7e-67   Erythranthe guttata [common monkey flower]
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                229   7e-67   Solanum lycopersicum
emb|CBI27801.3|  unnamed protein product                                228   8e-67   Vitis vinifera
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           228   1e-66   Solanum tuberosum [potatoes]
gb|KJB82990.1|  hypothetical protein B456_013G223900                    228   2e-66   Gossypium raimondii
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                228   3e-66   Vitis vinifera
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                227   4e-66   Fragaria vesca subsp. vesca
gb|KHG16003.1|  Subtilisin-like protease                                224   6e-65   Gossypium arboreum [tree cotton]
gb|EPS65938.1|  hypothetical protein M569_08836                         223   6e-65   Genlisea aurea
emb|CDP03080.1|  unnamed protein product                                220   2e-64   Coffea canephora [robusta coffee]
gb|KJB27211.1|  hypothetical protein B456_004G284900                    218   1e-63   Gossypium raimondii
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           219   3e-63   Glycine max [soybeans]
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                218   4e-63   Sesamum indicum [beniseed]
gb|KJB27210.1|  hypothetical protein B456_004G284900                    218   8e-63   Gossypium raimondii
ref|XP_006381615.1|  subtilase family protein                           216   4e-62   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                215   1e-61   Populus euphratica
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                214   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                213   4e-61   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                213   7e-61   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                212   1e-60   Nicotiana sylvestris
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                212   1e-60   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             211   2e-60   Phaseolus vulgaris [French bean]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   211   3e-60   Citrus sinensis [apfelsine]
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         211   4e-60   Jatropha curcas
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    209   9e-60   Citrus sinensis [apfelsine]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                209   1e-59   Malus domestica [apple tree]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             209   1e-59   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                208   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           207   4e-59   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                207   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                207   1e-58   Nicotiana tomentosiformis
gb|AHA84190.1|  subtilisin-like protease                                206   2e-58   Phaseolus vulgaris [French bean]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                206   3e-58   Brassica rapa
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     206   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      204   6e-58   Ricinus communis
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                204   1e-57   Cucumis melo [Oriental melon]
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                203   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                203   2e-57   Tarenaya hassleriana [spider flower]
gb|KCW79385.1|  hypothetical protein EUGRSUZ_C00797                     200   3e-57   Eucalyptus grandis [rose gum]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                202   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             201   1e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002519361.1|  conserved hypothetical protein                     188   1e-56   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             201   1e-56   Capsella rubella
emb|CAN71376.1|  hypothetical protein VITISV_001491                     201   1e-56   Vitis vinifera
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                200   2e-56   Eucalyptus grandis [rose gum]
emb|CDY33400.1|  BnaA07g04390D                                          199   3e-56   Brassica napus [oilseed rape]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           199   4e-56   Cicer arietinum [garbanzo]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                198   8e-56   Eucalyptus grandis [rose gum]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                198   1e-55   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     197   2e-55   Eucalyptus grandis [rose gum]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                197   3e-55   Eucalyptus grandis [rose gum]
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           195   1e-54   Glycine max [soybeans]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                191   3e-53   Eucalyptus grandis [rose gum]
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             189   2e-52   Phaseolus vulgaris [French bean]
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                     188   3e-52   Eucalyptus grandis [rose gum]
ref|XP_003595292.1|  Subtilisin-like protease                           186   2e-51   Medicago truncatula
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                185   4e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002885806.1|  predicted protein                                  184   8e-51   Arabidopsis lyrata subsp. lyrata
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    181   1e-49   Arabis alpina [alpine rockcress]
gb|KHN06066.1|  Subtilisin-like protease                                180   1e-49   Glycine soja [wild soybean]
ref|NP_565330.1|  Subtilase-like protein                                180   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ACN39811.1|  unknown                                                 176   4e-48   Picea sitchensis
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                175   2e-47   Fragaria vesca subsp. vesca
emb|CDY18042.1|  BnaC07g04280D                                          172   2e-46   Brassica napus [oilseed rape]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                172   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             172   2e-46   Musa acuminata [banana]
ref|XP_003609994.1|  Subtilisin-like protease                           170   1e-45   
gb|AES92191.2|  subtilisin-like serine protease                         169   2e-45   Medicago truncatula
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   168   6e-45   Citrus sinensis [apfelsine]
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           168   7e-45   Citrus sinensis [apfelsine]
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                168   8e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                167   8e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                167   1e-44   Nicotiana sylvestris
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             167   1e-44   Citrus clementina [clementine]
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         169   1e-44   Jatropha curcas
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                167   2e-44   Cucumis melo [Oriental melon]
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                166   3e-44   Nicotiana sylvestris
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           166   3e-44   Solanum tuberosum [potatoes]
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           166   3e-44   Cucumis sativus [cucumbers]
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                166   4e-44   Nicotiana tomentosiformis
gb|ABR16566.1|  unknown                                                 164   4e-44   Picea sitchensis
emb|CDP02570.1|  unnamed protein product                                166   4e-44   Coffea canephora [robusta coffee]
gb|ACN40199.1|  unknown                                                 165   5e-44   Picea sitchensis
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          165   6e-44   Amborella trichopoda
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                165   8e-44   Vitis vinifera
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           165   9e-44   Glycine max [soybeans]
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                164   9e-44   Nelumbo nucifera [Indian lotus]
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           164   1e-43   Glycine max [soybeans]
ref|XP_010105478.1|  Subtilisin-like protease                           164   1e-43   Morus notabilis
ref|NP_001234282.1|  SBT1 protein precursor                             164   1e-43   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                164   1e-43   Populus euphratica
ref|XP_003608462.1|  Subtilisin-like protease                           164   1e-43   Medicago truncatula
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                164   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                164   2e-43   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                164   2e-43   Eucalyptus grandis [rose gum]
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           164   2e-43   
emb|CDX75758.1|  BnaC03g38410D                                          157   3e-43   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                163   3e-43   Nicotiana tomentosiformis
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                163   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease                163   3e-43   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                163   4e-43   Elaeis guineensis
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         163   4e-43   Jatropha curcas
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             163   4e-43   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                163   5e-43   Solanum lycopersicum
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           163   5e-43   Glycine max [soybeans]
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           162   5e-43   Cicer arietinum [garbanzo]
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                163   5e-43   Malus domestica [apple tree]
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                162   6e-43   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                162   7e-43   
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                162   8e-43   Pyrus x bretschneideri [bai li]
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                162   8e-43   Erythranthe guttata [common monkey flower]
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                162   9e-43   Pyrus x bretschneideri [bai li]
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                162   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43570.1|  BnaC02g16670D                                          153   1e-42   Brassica napus [oilseed rape]
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                162   1e-42   Pyrus x bretschneideri [bai li]
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         161   1e-42   Jatropha curcas
emb|CDY18651.1|  BnaA09g07440D                                          161   1e-42   Brassica napus [oilseed rape]
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           161   1e-42   Setaria italica
gb|ABR18065.1|  unknown                                                 161   2e-42   Picea sitchensis
gb|EPS59495.1|  hypothetical protein M569_15309                         161   2e-42   Genlisea aurea
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                161   2e-42   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP20511.1|  unnamed protein product                                161   2e-42   Coffea canephora [robusta coffee]
tpg|DAA51518.1|  TPA: putative subtilase family protein                 161   2e-42   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                161   2e-42   Phoenix dactylifera
ref|NP_001151463.1|  LOC100285096 precursor                             161   2e-42   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like           161   2e-42   Glycine max [soybeans]
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           161   3e-42   Cicer arietinum [garbanzo]
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           160   3e-42   Solanum tuberosum [potatoes]
gb|EYU21279.1|  hypothetical protein MIMGU_mgv1a023973mg                159   3e-42   Erythranthe guttata [common monkey flower]
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          160   3e-42   Amborella trichopoda
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      160   3e-42   Ricinus communis
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg               154   3e-42   Erythranthe guttata [common monkey flower]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                160   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                160   3e-42   Solanum lycopersicum
ref|XP_010109072.1|  Subtilisin-like protease                           160   3e-42   Morus notabilis
gb|AGT16155.1|  subtilisin-like protease                                160   4e-42   Saccharum hybrid cultivar R570
ref|NP_001051353.1|  Os03g0761500                                       160   4e-42   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             160   4e-42   Phaseolus vulgaris [French bean]
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    160   4e-42   Glycine max [soybeans]
gb|KJB29423.1|  hypothetical protein B456_005G099900                    160   4e-42   Gossypium raimondii
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                160   5e-42   Camelina sativa [gold-of-pleasure]
emb|CDY29697.1|  BnaA04g17300D                                          160   5e-42   Brassica napus [oilseed rape]
gb|EPS61757.1|  hypothetical protein M569_13035                         160   5e-42   Genlisea aurea
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                160   6e-42   Prunus mume [ume]
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                160   6e-42   Brassica rapa
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                160   6e-42   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                160   6e-42   Malus domestica [apple tree]
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                159   7e-42   Brachypodium distachyon [annual false brome]
ref|XP_010105479.1|  Subtilisin-like protease                           160   7e-42   
ref|XP_002510884.1|  Cucumisin precursor, putative                      159   8e-42   Ricinus communis
ref|NP_001049524.2|  Os03g0242900                                       159   9e-42   
tpg|DAA50265.1|  TPA: putative subtilase family protein                 159   1e-41   
gb|KJB34441.1|  hypothetical protein B456_006G065800                    157   1e-41   Gossypium raimondii
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           159   1e-41   Cicer arietinum [garbanzo]
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             159   1e-41   Phaseolus vulgaris [French bean]
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          159   1e-41   Sorghum bicolor [broomcorn]
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                159   2e-41   Solanum lycopersicum
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                159   2e-41   Prunus mume [ume]
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          158   2e-41   Sorghum bicolor [broomcorn]
gb|KJB34438.1|  hypothetical protein B456_006G065800                    157   2e-41   Gossypium raimondii
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                158   2e-41   Sesamum indicum [beniseed]
emb|CDY18654.1|  BnaA09g07410D                                          158   2e-41   Brassica napus [oilseed rape]
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             158   2e-41   Prunus persica
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             158   2e-41   Phaseolus vulgaris [French bean]
ref|XP_010105482.1|  Subtilisin-like protease                           158   2e-41   Morus notabilis
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                158   2e-41   Brassica rapa
ref|XP_004985040.1|  PREDICTED: subtilisin-like protease-like           158   2e-41   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                158   3e-41   Populus euphratica
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                158   3e-41   Vitis vinifera
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...    157   3e-41   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                157   3e-41   Brassica rapa
emb|CDY18653.1|  BnaA09g07420D                                          157   3e-41   Brassica napus [oilseed rape]
gb|KJB43875.1|  hypothetical protein B456_007G221100                    157   4e-41   Gossypium raimondii
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                158   4e-41   Phoenix dactylifera
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           157   4e-41   Solanum tuberosum [potatoes]
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             157   4e-41   Capsella rubella
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                157   4e-41   Elaeis guineensis
ref|XP_007047459.1|  Subtilase family protein                           157   5e-41   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                157   5e-41   Eucalyptus grandis [rose gum]
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                157   5e-41   Nelumbo nucifera [Indian lotus]
gb|ADD09584.1|  proteinase inhibitor                                    157   5e-41   Trifolium repens [creeping white clover]
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like           157   5e-41   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    157   5e-41   Cucumis sativus [cucumbers]
ref|NP_001152427.1|  LOC100286067 precursor                             157   6e-41   
gb|KJB34440.1|  hypothetical protein B456_006G065800                    157   6e-41   Gossypium raimondii
ref|XP_002465573.1|  hypothetical protein SORBIDRAFT_01g041350          157   6e-41   Sorghum bicolor [broomcorn]
gb|ACN28204.1|  unknown                                                 157   6e-41   Zea mays [maize]
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             157   6e-41   Prunus persica
emb|CDY57437.1|  BnaAnng14520D                                          157   6e-41   Brassica napus [oilseed rape]
gb|KEH35793.1|  subtilisin-like serine protease                         157   7e-41   Medicago truncatula
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             157   7e-41   Phaseolus vulgaris [French bean]
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           157   7e-41   Setaria italica
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                157   7e-41   Prunus mume [ume]
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                157   7e-41   Elaeis guineensis
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like           157   9e-41   Glycine max [soybeans]
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                156   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                156   1e-40   Eucalyptus grandis [rose gum]
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           156   1e-40   Cicer arietinum [garbanzo]
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                156   1e-40   Phoenix dactylifera
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                157   1e-40   Phoenix dactylifera
emb|CDY12840.1|  BnaC07g15930D                                          156   1e-40   Brassica napus [oilseed rape]
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                156   1e-40   Sesamum indicum [beniseed]
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             156   1e-40   Phaseolus vulgaris [French bean]
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                156   1e-40   Cucumis melo [Oriental melon]
gb|KDP22364.1|  hypothetical protein JCGZ_26195                         156   1e-40   Jatropha curcas
ref|XP_003558354.1|  PREDICTED: subtilisin-like protease                156   1e-40   Brachypodium distachyon [annual false brome]
ref|NP_001151549.1|  subtilisin-like protease precursor                 156   1e-40   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           155   2e-40   Cicer arietinum [garbanzo]
gb|EPS61652.1|  hypothetical protein M569_13143                         155   2e-40   Genlisea aurea
emb|CAA59963.1|  subtilisin-like protease                               155   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                156   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                155   2e-40   Nicotiana sylvestris
emb|CDY63300.1|  BnaCnng41800D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            155   2e-40   Prunus persica
emb|CDY63302.1|  BnaCnng41810D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                155   2e-40   Eucalyptus grandis [rose gum]
dbj|BAJ99493.1|  predicted protein                                      155   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           155   2e-40   Cicer arietinum [garbanzo]
dbj|BAJ91233.1|  predicted protein                                      155   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                155   3e-40   Nicotiana tomentosiformis
gb|AES62637.2|  subtilisin-like serine protease                         155   3e-40   Medicago truncatula
emb|CDY40653.1|  BnaA03g53100D                                          155   3e-40   Brassica napus [oilseed rape]
dbj|BAJ94518.1|  predicted protein                                      155   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             155   3e-40   Eutrema salsugineum [saltwater cress]
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                155   3e-40   Erythranthe guttata [common monkey flower]
tpg|DAA44340.1|  TPA: putative subtilase family protein                 155   3e-40   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           155   3e-40   Setaria italica
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                155   3e-40   Nicotiana tomentosiformis
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease                155   3e-40   
ref|XP_003592386.1|  Subtilisin-like protease                           155   3e-40   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           155   3e-40   Cicer arietinum [garbanzo]
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           155   4e-40   Solanum tuberosum [potatoes]
ref|XP_006649720.1|  PREDICTED: subtilisin-like protease-like           155   4e-40   
ref|NP_569048.1|  subtilisin-like protease                              155   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                155   4e-40   Vitis vinifera
gb|AAM10321.1|  AT5g67360/K8K14_8                                       155   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             155   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003627424.1|  Subtilisin-like serine protease                    155   4e-40   Medicago truncatula
dbj|BAJ86110.1|  predicted protein                                      155   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                155   5e-40   Sesamum indicum [beniseed]
dbj|BAJ87780.1|  predicted protein                                      154   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96698.1|  predicted protein                                      154   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          154   5e-40   
ref|NP_567972.1|  subtilisin-like serine protease 2                     154   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           154   6e-40   Glycine max [soybeans]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                154   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN12975.1|  Subtilisin-like protease                                154   6e-40   Glycine soja [wild soybean]
dbj|BAJ88205.1|  predicted protein                                      154   6e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             154   6e-40   Phaseolus vulgaris [French bean]
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                154   7e-40   Elaeis guineensis
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             154   7e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           154   8e-40   Glycine max [soybeans]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           154   8e-40   Setaria italica
ref|NP_001234288.1|  SBT2 protein precursor                             154   8e-40   Solanum lycopersicum
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    154   8e-40   Arabis alpina [alpine rockcress]
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             154   9e-40   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                154   9e-40   Brassica rapa
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           154   1e-39   Glycine max [soybeans]
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                154   1e-39   Populus euphratica
emb|CDX82491.1|  BnaA03g33300D                                          154   1e-39   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    154   1e-39   Elaeis guineensis
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2      153   1e-39   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                153   1e-39   Camelina sativa [gold-of-pleasure]
emb|CDX72509.1|  BnaC07g45310D                                          153   1e-39   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             153   1e-39   Citrus clementina [clementine]
ref|XP_008788427.1|  PREDICTED: subtilisin-like protease                153   1e-39   Phoenix dactylifera
gb|KJB58612.1|  hypothetical protein B456_009G218000                    153   1e-39   Gossypium raimondii
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                153   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                153   2e-39   
ref|XP_002466832.1|  hypothetical protein SORBIDRAFT_01g014930          152   2e-39   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           153   2e-39   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      153   2e-39   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                153   2e-39   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                153   2e-39   
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           152   2e-39   
emb|CDY63219.1|  BnaAnng18730D                                          152   2e-39   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                153   2e-39   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    152   3e-39   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      152   3e-39   
emb|CDP05276.1|  unnamed protein product                                152   3e-39   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           152   3e-39   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease                152   3e-39   
emb|CDX97560.1|  BnaA05g25190D                                          152   3e-39   
emb|CDX98438.1|  BnaC05g39370D                                          152   4e-39   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             152   4e-39   
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g             152   4e-39   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           152   4e-39   
gb|EMT29812.1|  hypothetical protein F775_42283                         151   5e-39   
emb|CBI24480.3|  unnamed protein product                                150   5e-39   
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                152   5e-39   
ref|XP_010103418.1|  Subtilisin-like protease                           152   5e-39   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                152   5e-39   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                152   6e-39   
emb|CDY00497.1|  BnaA10g07760D                                          151   6e-39   
gb|AIX97848.1|  SBT1.5                                                  151   6e-39   
ref|XP_006651591.1|  PREDICTED: subtilisin-like protease-like           148   7e-39   
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                151   7e-39   
ref|XP_003605881.1|  Subtilisin-like protease                           151   7e-39   
ref|XP_003636375.1|  Subtilisin-like protease                           151   8e-39   
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                151   8e-39   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                151   9e-39   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           151   9e-39   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     151   1e-38   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                151   1e-38   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             151   1e-38   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           151   1e-38   
gb|ABR17987.1|  unknown                                                 151   1e-38   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             150   1e-38   
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease                150   1e-38   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             150   1e-38   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                150   2e-38   
ref|XP_002320086.2|  subtilase family protein                           150   2e-38   
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                150   2e-38   
emb|CDY67452.1|  BnaCnng55020D                                          150   2e-38   
emb|CDY55359.1|  BnaCnng28690D                                          149   2e-38   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                150   2e-38   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                150   2e-38   
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g             150   2e-38   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    150   2e-38   
emb|CDX97540.1|  BnaA05g25390D                                          143   2e-38   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                150   2e-38   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           150   2e-38   
gb|KEH30495.1|  subtilisin-like serine protease                         150   2e-38   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                150   3e-38   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                150   3e-38   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                149   3e-38   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease                149   3e-38   
emb|CDY22001.1|  BnaC09g01070D                                          149   3e-38   
ref|XP_002886065.1|  predicted protein                                  149   3e-38   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                149   4e-38   
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                149   4e-38   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                149   4e-38   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     149   4e-38   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     149   4e-38   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             149   4e-38   
ref|XP_002321861.2|  subtilase family protein                           149   4e-38   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                149   4e-38   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                149   4e-38   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                149   4e-38   
gb|KHN45156.1|  Subtilisin-like protease                                149   5e-38   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     149   5e-38   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             149   5e-38   
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    149   5e-38   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                149   5e-38   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                149   5e-38   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like           149   5e-38   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             149   6e-38   
gb|AAO62352.1|  subtilase                                               149   6e-38   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                149   6e-38   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     149   6e-38   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           149   6e-38   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like           149   6e-38   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     149   6e-38   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    149   7e-38   
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        149   7e-38   
ref|NP_001050634.1|  Os03g0605300                                       149   7e-38   
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg               147   7e-38   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                149   8e-38   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                149   8e-38   
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                148   8e-38   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           148   8e-38   
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                148   8e-38   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like           148   8e-38   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                148   8e-38   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                148   9e-38   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                148   9e-38   
ref|XP_007024651.1|  Subtilase family protein                           148   9e-38   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                148   9e-38   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             150   1e-37   
emb|CDP01316.1|  unnamed protein product                                148   1e-37   
emb|CDY44380.1|  BnaA02g29970D                                          147   1e-37   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           148   1e-37   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             148   1e-37   
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             148   1e-37   
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                148   1e-37   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             148   1e-37   
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease                148   1e-37   
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             148   1e-37   
gb|EPS74243.1|  subtilase family protein                                147   1e-37   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           148   1e-37   
ref|XP_003597117.1|  Subtilisin-like protease                           147   1e-37   
ref|XP_002885009.1|  subtilase family protein                           147   2e-37   
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...    147   2e-37   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                147   2e-37   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             147   2e-37   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                147   2e-37   
ref|XP_002534468.1|  Cucumisin precursor, putative                      143   2e-37   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                147   2e-37   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           147   2e-37   
ref|XP_006369129.1|  subtilase family protein                           147   2e-37   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           147   2e-37   
ref|XP_003589103.1|  Subtilisin-like protease                           147   2e-37   
ref|NP_566473.2|  Subtilase family protein                              147   2e-37   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             147   2e-37   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             147   3e-37   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         147   3e-37   
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                147   3e-37   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    147   3e-37   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_009409659.1|  PREDICTED: subtilisin-like protease                147   3e-37   
ref|XP_010089708.1|  Subtilisin-like protease                           147   3e-37   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                146   4e-37   
ref|XP_010526897.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    146   5e-37   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             146   5e-37   
gb|KDO59722.1|  hypothetical protein CISIN_1g037455mg                   146   5e-37   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                146   6e-37   
ref|NP_568765.1|  subtilase 1.3                                         146   7e-37   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             146   7e-37   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                146   7e-37   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           145   7e-37   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    146   8e-37   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                146   8e-37   
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           145   9e-37   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         145   9e-37   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg             145   9e-37   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    145   9e-37   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                   144   9e-37   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     145   1e-36   
ref|XP_006369092.1|  subtilase family protein                           145   1e-36   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   145   1e-36   
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                145   1e-36   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                145   1e-36   
emb|CDX99895.1|  BnaC09g28100D                                          145   1e-36   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     145   1e-36   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             145   1e-36   
ref|XP_002976152.1|  hypothetical protein SELMODRAFT_416154             143   1e-36   
ref|XP_002523606.1|  Cucumisin precursor, putative                      145   1e-36   
ref|XP_010087293.1|  Subtilisin-like protease                           145   1e-36   
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                145   1e-36   
ref|XP_010090327.1|  Subtilisin-like protease                           145   1e-36   
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease                143   1e-36   
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                145   2e-36   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                145   2e-36   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                   145   2e-36   
emb|CAN64995.1|  hypothetical protein VITISV_001779                     145   2e-36   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    145   2e-36   
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           144   2e-36   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg             145   2e-36   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                145   2e-36   
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           144   2e-36   
ref|XP_004292752.1|  PREDICTED: subtilisin-like protease                144   2e-36   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           144   2e-36   
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                144   2e-36   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             144   2e-36   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     144   2e-36   
emb|CDY33251.1|  BnaC01g37240D                                          144   2e-36   
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g             144   2e-36   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           144   3e-36   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             144   3e-36   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                144   3e-36   
gb|EPS65791.1|  hypothetical protein M569_08985                         144   3e-36   
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                144   3e-36   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     144   3e-36   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             144   3e-36   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                144   3e-36   
ref|XP_006487074.1|  PREDICTED: subtilisin-like protease-like           142   3e-36   
gb|KJB84343.1|  hypothetical protein B456_N019600                       142   3e-36   
emb|CAH67004.1|  OSIGBa0160I14.2                                        144   3e-36   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                144   3e-36   
emb|CAE03027.1|  OSJNBa0084A10.2                                        144   3e-36   
emb|CAN60787.1|  hypothetical protein VITISV_034533                     144   3e-36   
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             144   3e-36   
ref|NP_001052820.1|  Os04g0430700                                       144   3e-36   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                144   4e-36   
ref|XP_010111996.1|  Subtilisin-like protease                           144   4e-36   
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           144   4e-36   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           144   4e-36   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease                144   4e-36   
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           144   4e-36   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                144   4e-36   
dbj|BAJ87233.1|  predicted protein                                      144   4e-36   
emb|CDY52259.1|  BnaC05g52030D                                          143   4e-36   
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                144   4e-36   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    144   4e-36   
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                143   5e-36   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             144   5e-36   
ref|NP_001055646.1|  Os05g0435800                                       143   5e-36   
dbj|BAJ88882.1|  predicted protein                                      143   5e-36   
ref|XP_002310134.2|  subtilase family protein                           143   5e-36   
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                144   5e-36   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             144   5e-36   
ref|NP_001053614.1|  Os04g0573300                                       143   5e-36   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                143   5e-36   
emb|CAH66960.1|  OSIGBa0147H17.8                                        143   5e-36   



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 146/195 (75%), Gaps = 12/195 (6%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            A  +++WF A++ ++    P       AKKTYIVHMKHH+KP+S+ TH DWY  HLQS  
Sbjct  2    AFRAVIWFLAVSFVI----PSCLHLTCAKKTYIVHMKHHQKPASYATHSDWYTDHLQSLT  57

Query  181  --SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              + DSLLYTY  AYHG+AAAL  +EVE LR+ E+VVGVYED++YSLHTTRTPEFLGLD+
Sbjct  58   SGAGDSLLYTYDVAYHGYAAALIPEEVESLRQSESVVGVYEDTIYSLHTTRTPEFLGLDS  117

Query  355  EFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
              G  AGH   E    + DVI+G+LDTGVWPESKSF D+ M  VPARWRG CE+A +F+P
Sbjct  118  GLGPWAGHSLQELNQASQDVIIGVLDTGVWPESKSFIDADMPDVPARWRGECEAAHDFNP  177

Query  523  KTHCNKKLIGARFYT  567
            K HCNKKLIGARF++
Sbjct  178  KIHCNKKLIGARFFS  192



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSL  195
            WF+A+ +L+  L      +A+AK+TYIV M HH KPSS+ TH DWY+AHLQS   +EDSL
Sbjct  8    WFAALLLLVTCL------SAMAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTYTTAYHGFAA+L +++ E LR+ ++V+GVYED++Y+LHTTRTPEFLGL+ E GL AG
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDSVLGVYEDTLYTLHTTRTPEFLGLEIESGLWAG  121

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVIVG+LDTGVWPESKSFDD+GM  +P RWRG+CES  +F P + CNKK
Sbjct  122  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDAGMPEIPTRWRGQCESGSDFTP-SFCNKK  180

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  181  LIGARSFS  188



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 146/193 (76%), Gaps = 10/193 (5%)
 Frame = +1

Query  19   LVWFSAIT-ILLHLLRP-CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----  180
            ++W  A+  +LLH   P  +ATAA A KTYIVHMKH++KP+S+ TH +WY+ HLQS    
Sbjct  6    VIWLCAVAFVLLHSWLPLVSATAAAAVKTYIVHMKHNQKPASYATHTEWYSDHLQSLTSA  65

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            + DSLLYTY  AY GFAAAL  +E + +R+ ++V+GVYED+VY+LHTTRTPEFLGL+ E 
Sbjct  66   APDSLLYTYDAAYSGFAAALTPEEADSIRQSDSVLGVYEDTVYTLHTTRTPEFLGLNTEP  125

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            G   GH   E    + DVI+G+LDTGVWPESKSF D GM  VP RWRGRCE+A +F+PK 
Sbjct  126  GPWTGHSLQELNKASQDVIIGVLDTGVWPESKSFADFGMPDVPTRWRGRCEAAGDFNPKI  185

Query  529  HCNKKLIGARFYT  567
            HCNKKLIGARF++
Sbjct  186  HCNKKLIGARFFS  198



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 147/188 (78%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSL  195
            WF+A+ +L+  L      +A AK+TYIV M HH KPSS+ TH DWY+AHLQS   +EDSL
Sbjct  8    WFAALLLLVTCL------SAKAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTYTTAYHGFAA+L +++ E LR+ ++V+GVYED++Y+LHTTRTPEFLGL+ E GL AG
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDSVLGVYEDTLYTLHTTRTPEFLGLEIESGLWAG  121

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVIVG+LDTGVWPESKSFDD+GM  +P RWRG+CES  +F P + CN+K
Sbjct  122  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDAGMPEIPTRWRGQCESGSDFAP-SLCNRK  180

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  181  LIGARCFS  188



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AKKTYIVHMKHH+KP SF+TH DWY++ LQ+   + DSLLY+YTTA++GFAA+L  ++VE
Sbjct  21   AKKTYIVHMKHHDKPLSFETHHDWYSSSLQALSAAPDSLLYSYTTAFNGFAASLDPEQVE  80

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ ++V+GVYED++Y+LHTTRTP+FLGLD EFGL AGH + +    + DVI+G+LDTG
Sbjct  81   LLRKSDSVLGVYEDTLYTLHTTRTPQFLGLDTEFGLWAGHNTQQLEQASRDVIIGVLDTG  140

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPESKSFDDS M  +P++WRG CESAP+F PK  CNKKLIGAR ++
Sbjct  141  VWPESKSFDDSDMPDLPSKWRGECESAPDFSPK-FCNKKLIGARSFS  186



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 139/191 (73%), Gaps = 9/191 (5%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SE  186
            ++   ++ IL  L    +A     KKTYIVHMKHH KP SF TH  WY  HLQS    ++
Sbjct  6    IILLFSMNILFFLHSSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTSSTQ  65

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
            +SLLYTYT AYHGFAA+L + EVE LR+ E VV +Y+D+ Y+  TTRTPEFLGLD +   
Sbjct  66   NSLLYTYTNAYHGFAASLDSHEVELLRKSEYVVNIYQDTFYTPQTTRTPEFLGLD-KIDF  124

Query  367  GAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
            GAG  SPE    A DVI+G+LD+GVWPES+SF D GM+ VP+RWRG+C+SAP+FDPK HC
Sbjct  125  GAGRTSPEFNMAAQDVIIGVLDSGVWPESESFSDLGMSNVPSRWRGKCQSAPDFDPKVHC  184

Query  535  NKKLIGARFYT  567
            N+KLIGA +++
Sbjct  185  NRKLIGALYFS  195



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 142/197 (72%), Gaps = 17/197 (9%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS + FS I +LL +L+PC     +AKK YIVHMK+H+ PSSF TH DWY A LQS   
Sbjct  1    MGSFLCFSVIVVLL-VLQPC-----LAKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  190  SLL-------YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            S         Y+Y  AY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEFLGL
Sbjct  55   SSTSDESSLLYSYDAAYSGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEFLGL  114

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNF  516
            + E GL AGH   E    A DV++G+LDTGVWPESKS++D GM  VP+RW+G CES P+F
Sbjct  115  NNELGLWAGHSPQELNNAAQDVVIGVLDTGVWPESKSYNDFGMPDVPSRWKGECESGPDF  174

Query  517  DPKTHCNKKLIGARFYT  567
            DPK HCNKKLIGARF++
Sbjct  175  DPKVHCNKKLIGARFFS  191



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 149/191 (78%), Gaps = 10/191 (5%)
 Frame = +1

Query  10   MGSLVWFS-AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            M   +WFS ++ +LL L++ C +     K+TYIVHMK+H+KP ++ TH DWY+A+LQS  
Sbjct  1    MAKPIWFSFSVLLLLLLVQQCRSE----KRTYIVHMKNHDKPLAYATHHDWYSANLQSLS  56

Query  181  --SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              +EDSLLYTYT +Y+GFAA+L  D+ E LR+ ++VVGVYED+VY+LHTTRTPEFLGL  
Sbjct  57   ASAEDSLLYTYTNSYNGFAASLDPDQAELLRKSDSVVGVYEDTVYTLHTTRTPEFLGLAV  116

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
            + GL A   +  + DVIVG+LDTGVWPESKSFD++GM  +PARW+G CESAP+FDPK  C
Sbjct  117  DKGLSAQDVNQASDDVIVGVLDTGVWPESKSFDETGMPEIPARWKGECESAPDFDPKL-C  175

Query  535  NKKLIGARFYT  567
            NKKLIGAR ++
Sbjct  176  NKKLIGARSFS  186



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 142/194 (73%), Gaps = 13/194 (7%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAV---AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            ++  S I ILL  L    +T+A+    KKTYIVHMKHH KP SF TH  WY  HLQS   
Sbjct  6    IILLSTINILL-FLHSSTSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTS  64

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +++SLLYTYTTAYHGFAA+L + EVE LR+ + VV +YED+ Y+  TTRTPEFLGLD +
Sbjct  65   STQNSLLYTYTTAYHGFAASLDSHEVELLRQSDYVVNIYEDTFYTPQTTRTPEFLGLD-K  123

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPK  525
               G G   P+    A DVI+G+LDTGVWPES+SF D GM+ VP+RWRG+C+SAP+FDPK
Sbjct  124  LDFGDGRTLPDFNTAAQDVIIGVLDTGVWPESESFSDLGMSNVPSRWRGKCQSAPDFDPK  183

Query  526  THCNKKLIGARFYT  567
             HCN+KLIGA +++
Sbjct  184  VHCNRKLIGALYFS  197



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 140/197 (71%), Gaps = 17/197 (9%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS + FS I + L + +PC      +KK YIVHMK+H+ PSSF TH DWY A LQS   
Sbjct  1    MGSFLCFSVIVLFL-VFQPC-----FSKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  190  SLL-------YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            S         Y+Y TAY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEFLGL
Sbjct  55   SSTSDESSLLYSYDTAYSGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEFLGL  114

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNF  516
            + E GL AGH   E    A DV++G+LDTGVWPESKSF+D GM  VP+RW+G CES P+F
Sbjct  115  NNELGLWAGHSPQELNNAAQDVVIGVLDTGVWPESKSFNDFGMPNVPSRWKGECESGPDF  174

Query  517  DPKTHCNKKLIGARFYT  567
            DPK HCNKKLIGARF++
Sbjct  175  DPKVHCNKKLIGARFFS  191



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 141/194 (73%), Gaps = 12/194 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            + S+    AI ++L L   C  + + AKKTYIVHMKH  KP+ + TH +WY+ H QS   
Sbjct  3    LASVFCVCAIAVVLQL---CLFSVS-AKKTYIVHMKHRHKPAIYATHGEWYSDHFQSLTA  58

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
               DSLLYTY  AYHGFAAA+  +E E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD+E
Sbjct  59   ADPDSLLYTYDAAYHGFAAAMSPEEAESLRQSDSVLGVYEDAVYNLHTTRTPEFLGLDSE  118

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPK  525
             G   GH   E    + DVI+G+LDTGVWPESKSF DS M  +PARWRG C++A +F+PK
Sbjct  119  LGPWVGHSLQELNQASQDVIIGVLDTGVWPESKSFSDSNMADIPARWRGECQAADDFNPK  178

Query  526  THCNKKLIGARFYT  567
             HCNKKLIGARF++
Sbjct  179  IHCNKKLIGARFFS  192



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 136/194 (70%), Gaps = 15/194 (8%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGSL  FS I  LL +L PC      AKKTYIVH+KH +KP S+ TH DWY A L+S   
Sbjct  1    MGSLFCFSLIAFLL-VLHPC-----FAKKTYIVHVKHQQKPPSYSTHHDWYDAQLKSLSS  54

Query  190  SLLYT-----YTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
            S         Y TAY GFAA+L   E E LR+ E VVGVYED+VY+LHTTRTPEFLGLD 
Sbjct  55   SSNSESLLYSYDTAYPGFAASLDPHEAELLRQSEDVVGVYEDTVYTLHTTRTPEFLGLDN  114

Query  355  EFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
            E G+ AGH   E    A DVI+G+LDTGVWPESKSF D GM  VP+RWRG CES P+FDP
Sbjct  115  ELGVWAGHTQQELNSAAQDVIIGVLDTGVWPESKSFSDVGMPDVPSRWRGECESGPDFDP  174

Query  523  KTHCNKKLIGARFY  564
            K HCNKKL+GARF+
Sbjct  175  KVHCNKKLVGARFF  188



>emb|CBI27801.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   228 bits (581),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 14/194 (7%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            AM S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS  
Sbjct  42   AMASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSIS  95

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V+GVYED VYSLHTTR+PEFLGLD E
Sbjct  96   SNSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVMGVYEDEVYSLHTTRSPEFLGLDTE  155

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPK  525
             GL AGH + +    + DVI+G+LDTGVWP+S+SFDDSGMT VPARWRG+CE  P+F   
Sbjct  156  LGLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVPARWRGKCEEGPDFQ-A  214

Query  526  THCNKKLIGARFYT  567
            + CNKKLIGA+ ++
Sbjct  215  SSCNKKLIGAQSFS  228



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 139/199 (70%), Gaps = 20/199 (10%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGSL+ F  I  LL +L PC      AKKTYIVH+KHH+KPSS+ TH DWY A L+S   
Sbjct  1    MGSLLCFCLIAFLL-VLHPC-----FAKKTYIVHVKHHQKPSSYSTHHDWYDAQLKSLSS  54

Query  190  SLLYT----------YTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEF  339
            S   +          Y TAY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEF
Sbjct  55   SSSSSSSNSESLLYSYDTAYPGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEF  114

Query  340  LGLDAEFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESA  507
            LGLD + G+ AGH   E    A DVI+G+LDTGVWPESKSF D GM  VP+RWRG CES 
Sbjct  115  LGLDNQLGVWAGHTQQELNSAAQDVIIGVLDTGVWPESKSFSDVGMPDVPSRWRGECESG  174

Query  508  PNFDPKTHCNKKLIGARFY  564
            P+FDPK HCNKKLIGARF+
Sbjct  175  PDFDPKVHCNKKLIGARFF  193



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 135/168 (80%), Gaps = 9/168 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMKH +KP SF+TH DWY++ LQS      +SLLY+Y  A+HGFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYSSSLQSLTATPAESLLYSYNAAFHGFAASLDPEQA  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
            E L + ++V+GVYED+VY+LHTTRTP+FLGLDAE GL AGH + +    + DVI+G+LDT
Sbjct  80   EALSKSDSVLGVYEDTVYNLHTTRTPQFLGLDAESGLWAGHNTQQLEQASRDVIIGVLDT  139

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPESKSFDDSGM  VPA+WRG CESAP+F+PK  CN+KLIGAR ++
Sbjct  140  GVWPESKSFDDSGMPEVPAKWRGECESAPDFNPK-FCNRKLIGARSFS  186



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 14/193 (7%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS   
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSISS  54

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V+GVYED VYSLHTTR+PEFLGLD E 
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVMGVYEDEVYSLHTTRSPEFLGLDTEL  114

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            GL AGH + +    + DVI+G+LDTGVWP+S+SFDDSGMT VPARWRG+CE  P+F   +
Sbjct  115  GLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVPARWRGKCEEGPDFQ-AS  173

Query  529  HCNKKLIGARFYT  567
             CNKKLIGA+ ++
Sbjct  174  SCNKKLIGAQSFS  186



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 18/192 (9%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------S  183
            W  A+TILL    PC   +  AK+TYIV MKHH KPSSF TH DWY+A+LQ+        
Sbjct  9    WVVALTILL----PC--LSVTAKQTYIVQMKHHSKPSSFATHSDWYSANLQAVSSDSYSD  62

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             D+LLYTY TAYHGFAA+L  D+ E LR+ E+V+GVYED+VY+LHTTRTPEFLGL+   G
Sbjct  63   SDALLYTYDTAYHGFAASLDPDQAETLRQSESVIGVYEDTVYNLHTTRTPEFLGLETANG  122

Query  364  LGAGHG----SPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
              AGH     +  + DVIVG+LDTGVWPESKSF+D+GM  +P+RWRG CES  +F PK  
Sbjct  123  FWAGHSLQDLNQASNDVIVGVLDTGVWPESKSFNDAGMPEIPSRWRGECESGVDFSPKL-  181

Query  532  CNKKLIGARFYT  567
            CNKKLIGAR ++
Sbjct  182  CNKKLIGARSFS  193



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 134/168 (80%), Gaps = 9/168 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMKH +KP SF+TH DWY + LQS      +SLLY+Y  A++GFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYRSSLQSLTSTPAESLLYSYNAAFNGFAASLDPEQA  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
            E L + ++V+GVYED+VY+LHTTRTP+FLGLDAE GL AGH + +    + DVI+G+LDT
Sbjct  80   EALGKSDSVLGVYEDTVYNLHTTRTPQFLGLDAESGLWAGHNTQQLEQASRDVIIGVLDT  139

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPESKSFDDSGM  VPA+WRG CESAP+F+PK  CN+KLIGAR ++
Sbjct  140  GVWPESKSFDDSGMPEVPAKWRGECESAPDFNPK-FCNRKLIGARSFS  186



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 129/168 (77%), Gaps = 8/168 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMK H KP S++TH DWY+ HL S     ED+LLY Y  AY GFAAA+  +EV
Sbjct  2    AKKTYIVHMKRHMKPPSYRTHADWYSQHLASVASAEEDALLYAYDAAYPGFAAAMSPEEV  61

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG---HGSPEAA-DVIVGILDT  423
            + LRR ++V GVYED+VYSLHTTRTP+FLGLD E G  AG    G   A+ DVI+G+LDT
Sbjct  62   DSLRRSDSVFGVYEDTVYSLHTTRTPQFLGLDLELGPLAGVNIEGLNRASQDVIIGVLDT  121

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPESKSF+D+ M  VPARWRG CE+  +F+PK HCNKKLIGARF++
Sbjct  122  GVWPESKSFNDANMAEVPARWRGGCEATADFNPKIHCNKKLIGARFFS  169



>emb|CDP03080.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 128/162 (79%), Gaps = 11/162 (7%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHLQS-----SEDSLLYTYTTAYHGFAAALGADEVERLRRLE  276
            MKHH+KP S+ TH DWY+  LQS       DS++Y+YTTAYHGFAA+L   E E LR+ +
Sbjct  1    MKHHQKPPSYSTHTDWYSDRLQSLTSSSRPDSIVYSYTTAYHGFAASLDPKEAESLRQSD  60

Query  277  AVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE-----AADVIVGILDTGVWPES  441
             V+GVYED+VY LHTTR+PEFLGLD+E GL AGH +P+     + DVI+G+LDTGVWPES
Sbjct  61   EVLGVYEDAVYQLHTTRSPEFLGLDSELGLWAGH-TPQYLNQASQDVIIGVLDTGVWPES  119

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KSF D+G+  VP+RWRG+CESA +F+PK HCNKKLIGARF++
Sbjct  120  KSFSDAGLPGVPSRWRGQCESAVDFNPKVHCNKKLIGARFFS  161



>gb|KJB27211.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=630

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 6/165 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----LLYTYTTAYHGFAAALGADEV  255
            AKKTYIV MKH +KP SF+TH DW+++ LQS  DS    LLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DVIVGILDTGVW  432
            E L + E+++GVYED+VY+LHTTR+P+FLGLDA+ GL A  GS +A+ DVI+G+LDTGVW
Sbjct  85   ESLSKSESILGVYEDTVYTLHTTRSPQFLGLDADLGLWATGGSTQASEDVIIGVLDTGVW  144

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PESKSFDDSGM  +P++WRG CE  P+F PK  CNKKLIGAR ++
Sbjct  145  PESKSFDDSGMPEIPSKWRGECEPGPDFGPK-FCNKKLIGARSFS  188



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 16/175 (9%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS-----------EDSLLYTYTTAYHGFAA  234
            AKKTYIVHMKHHEKPS + TH DWY+A LQ S            + LLY+YTTAY+GFAA
Sbjct  26   AKKTYIVHMKHHEKPSVYPTHTDWYSASLQQSLTLTTADSDSDSNPLLYSYTTAYNGFAA  85

Query  235  ALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADV  402
            +L  ++ E+L R E V+GVYED+VY LHTTRTPEFLGL+ E GL  GH + +    + DV
Sbjct  86   SLNDEQAEQLLRSEDVLGVYEDTVYQLHTTRTPEFLGLEKETGLWEGHTAQDLNQASNDV  145

Query  403  IVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            I+G+LDTGVWPES SFDD+GM  +PARWRG CE+ P+F PK  CN+KLIGAR ++
Sbjct  146  IIGVLDTGVWPESPSFDDAGMPEIPARWRGECETGPDFSPKM-CNRKLIGARSFS  199



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 14/192 (7%)
 Frame = +1

Query  19   LVWFSAITILLHL-LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----S  183
            +V   A   LLH  L P +A     KKTYIV M H +KP S+ TH  WY+ HLQ+    +
Sbjct  6    VVCLCAAVFLLHSSLFPVSA-----KKTYIVQMNHQQKPPSYATHGQWYSDHLQTLTSAA  60

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             +S+LYTY +AY+GFAAAL  +EVE LR+ ++V+ VYED VY+LHTTRTPEFLGLD E  
Sbjct  61   PESILYTYGSAYNGFAAALSDEEVESLRQSDSVLDVYEDPVYTLHTTRTPEFLGLDTELA  120

Query  364  LGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
               GH   E    + +VI+G+LDTGVWPESKSF D  M  VPARW+G CE+A +FDPK H
Sbjct  121  PSVGHSLQELNQASQEVIIGVLDTGVWPESKSFSDKDMADVPARWQGECEAADDFDPKIH  180

Query  532  CNKKLIGARFYT  567
            CNKKLIGARF++
Sbjct  181  CNKKLIGARFFS  192



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 6/165 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----LLYTYTTAYHGFAAALGADEV  255
            AKKTYIV MKH +KP SF+TH DW+++ LQS  DS    LLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DVIVGILDTGVW  432
            E L + E+++GVYED+VY+LHTTR+P+FLGLDA+ GL A  GS +A+ DVI+G+LDTGVW
Sbjct  85   ESLSKSESILGVYEDTVYTLHTTRSPQFLGLDADLGLWATGGSTQASEDVIIGVLDTGVW  144

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PESKSFDDSGM  +P++WRG CE  P+F PK  CNKKLIGAR ++
Sbjct  145  PESKSFDDSGMPEIPSKWRGECEPGPDFGPK-FCNKKLIGARSFS  188



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH+ KP SF TH DWY A LQS   + DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG----SPEAADVIVGILDTG  426
             L++ ++VV VYED++YSLHTTRTP FLGL+ + GL  GH     +  + DVIVG+LDTG
Sbjct  89   LLKQSQSVVDVYEDTLYSLHTTRTPAFLGLNTDLGLLDGHHAMGINQSSNDVIVGVLDTG  148

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +WPESKSF DSGM  +P RW+G CES P+F PK  CNKKLIGAR+++
Sbjct  149  IWPESKSFYDSGMPEIPTRWKGECESGPDFSPKL-CNKKLIGARYFS  194



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH+ KP SF TH DWY A LQS   + DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG----SPEAADVIVGILDTG  426
             L++ ++VV VYED++YSLHTTRTP FLGL+ + GL  GH     +  + DVIVG+LDTG
Sbjct  89   FLKQSQSVVDVYEDTLYSLHTTRTPAFLGLNTDLGLLDGHHAMGINQSSNDVIVGVLDTG  148

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +WPESKSF DSGM  +P RW+G CES P+F PK  CNKKLIGAR+++
Sbjct  149  IWPESKSFYDSGMPEIPTRWKGACESGPDFSPKL-CNKKLIGARYFS  194



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 11/197 (6%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCA--ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            AM SL W S  T LL LL        + +AK+TYIVHMKHH KP S+ TH DWY+A LQS
Sbjct  2    AMASLAWSSCFTFLLLLLLLLLLHCLSVLAKQTYIVHMKHHLKPLSYATHHDWYSAQLQS  61

Query  181  SEDSLL----YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
               S      YTY+TAYHGFAA+L  D+VE LR   +V+GVY+DS+Y+LHTTRTPEFLGL
Sbjct  62   LSSSGSSTLLYTYSTAYHGFAASLDPDQVEALRLSASVLGVYQDSIYTLHTTRTPEFLGL  121

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNF  516
            D +  L AGH + +      DVI+GILDTGVWPESKSFDDSGM  VP+RWRG CESAP+F
Sbjct  122  DTDLSLWAGHRTQDLDQATKDVIIGILDTGVWPESKSFDDSGMPQVPSRWRGECESAPDF  181

Query  517  DPKTHCNKKLIGARFYT  567
             P + CNKKLIGAR ++
Sbjct  182  SP-SLCNKKLIGARSFS  197



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 136/188 (72%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY+A LQS        
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  ++ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL  G
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTELGLWEG  120

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVIVG+LDTGVWPESKSFDD+GM  +P RWRG+CES P+F   T CNKK
Sbjct  121  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDTGMPEIPTRWRGQCESGPDF-AATLCNKK  179

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  180  LIGARSFS  187



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 138/188 (73%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF A+     LL PC   +A+AK+TYIVHM  H KP S+ TH DWY+A LQS        
Sbjct  7    WFGALL----LLLPC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  D+ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL AG
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTELGLWAG  120

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVI+G+LDTGVWPESKSFDD+GM  +P +WRG+CESAP+F   T CNKK
Sbjct  121  HSTQDLNQASNDVIIGVLDTGVWPESKSFDDTGMPEIPTKWRGQCESAPDF-AATLCNKK  179

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  180  LIGARSFS  187



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 124/166 (75%), Gaps = 9/166 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEVE  258
            KKTYIVHMKHH KP SF TH  WY ++LQS    +++SLLYTY  A HGFAA+L   EV+
Sbjct  25   KKTYIVHMKHHLKPPSFSTHHQWYKSYLQSLTSSNKNSLLYTYDIASHGFAASLYPHEVD  84

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ ++VV VYED+ Y+L TTRTPEFLGLD      AG   PE    A DVI+G+LD+G
Sbjct  85   LLRQSDSVVNVYEDTFYTLQTTRTPEFLGLD-NLNSWAGRTLPELNNAAQDVIIGVLDSG  143

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +WPESKSF D GM+ VP+RWRG C+SAP+FDP   CNKKLIGA+++
Sbjct  144  IWPESKSFSDVGMSNVPSRWRGECQSAPDFDPNVRCNKKLIGAQYF  189



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 138/188 (73%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF A+     LL PC   +A+AK+TYIVHM  H KP S+ TH DWY+A LQS        
Sbjct  7    WFGALL----LLLPC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  D+ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL AG
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTESGLWAG  120

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVI+G+LDTGVWPESKSFDD+GM  +P +WRG+CESAP+F   T CNKK
Sbjct  121  HSTQDLNQASNDVIIGVLDTGVWPESKSFDDTGMPEIPTKWRGQCESAPDF-AATLCNKK  179

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  180  LIGARSFS  187



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 10/193 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            MGS  +F+  T  + L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQS   
Sbjct  1    MGS--FFTLFTFSVLLVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQSFTT  58

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
              D LLYTYT AY+GFAA+L  D+ + L R E V+GVYE++VY LHTTRTP+FLGLD E 
Sbjct  59   DSDPLLYTYTDAYNGFAASLAEDQAQELLRSEDVLGVYEETVYQLHTTRTPQFLGLDRET  118

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            GL  GH + +    + DVIVG+LDTGVWPES SF D+ M  +PARWRG CE+ P+F P  
Sbjct  119  GLWEGHTTQDLNLASHDVIVGVLDTGVWPESPSFADAEMPEIPARWRGECEAGPDFSPSV  178

Query  529  HCNKKLIGARFYT  567
             CNKKLIGAR ++
Sbjct  179  -CNKKLIGARSFS  190



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  84   ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLSAGYSKLDFDKASLDVIIGVLDTG  143

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPESKSFDDS M  VP +WRG+CES P+F PK  CNKKLIGARF++
Sbjct  144  VWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKL-CNKKLIGARFFS  189



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 8/170 (5%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGAD  249
            +  AK+TYIVHMKH+ KP SF TH DWY+A LQS   + DSLLYTYTTA+ GFAA+L  +
Sbjct  21   SVTAKQTYIVHMKHNAKPESFATHHDWYSASLQSITSASDSLLYTYTTAFPGFAASLDPE  80

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGIL  417
            EV+ LR  +AV+ VYED++YSLHTTRTP+FLGL  + G   GH + +    + DV++G+L
Sbjct  81   EVDSLRNSDAVLDVYEDTIYSLHTTRTPQFLGLSTDLGFFNGHTTLDIDQASHDVVIGVL  140

Query  418  DTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DTGV P SKSFDDSGM  +P RW+G CESA +F P T CNKKLIGAR+++
Sbjct  141  DTGVTPGSKSFDDSGMPEIPTRWKGECESAQDFSP-TLCNKKLIGARYFS  189



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  84   ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLLAGYSKLDFDKASLDVIIGVLDTG  143

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPESKSFDDS M  VP +WRG+CES P+F PK  CNKKLIGARF++
Sbjct  144  VWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKL-CNKKLIGARFFS  189



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY+A LQS        
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  ++ E L + ++V+GVYED+VY+LHTTRTPEFLGLD E GL  G
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLHQSDSVIGVYEDTVYNLHTTRTPEFLGLDTESGLWEG  120

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H + +    + DVIVG+LDTGVWPESKSFDD+GM  +P RWRG+CES P+F   T CNKK
Sbjct  121  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDTGMPEIPTRWRGQCESGPDF-AATLCNKK  179

Query  544  LIGARFYT  567
            LIGAR ++
Sbjct  180  LIGARSFS  187



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 8/167 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY GFAA+L  D+ +
Sbjct  43   AKQTYIVHMKHQAKPSTFSTHYDWYASSVQSLSSSTDSLLYTYNTAYDGFAASLDPDQAQ  102

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  103  ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLSAGYSKLDFDKASLDVIIGVLDTG  162

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPESKSFDDS M  VP +WRG+CES P+F PK  CNKKLIGARF++
Sbjct  163  VWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKL-CNKKLIGARFFS  208



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 4/164 (2%)
 Frame = +1

Query  82   AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  261
            A AKKTYIV +KH +KP SFQTH DWY + LQS E SLLYTYTT++HG++A L +DE + 
Sbjct  21   ASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQS-ESSLLYTYTTSFHGYSAYLDSDEADS  79

Query  262  L-RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWP  435
            L R  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G     A++ V++G+LDTGVWP
Sbjct  80   LLRDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLGSASNGVVIGVLDTGVWP  139

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ESKSFDD+ M  +P++W+G CES  +FDPK  CNKKLIGAR ++
Sbjct  140  ESKSFDDTDMPEIPSKWKGECESGSDFDPKL-CNKKLIGARSFS  182



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 10/169 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL-----YTYTTAYHGFAAALGADE  252
            AKKTYIVHMKHH  PS + TH DWY+A+LQS   S       YTYT+++HGFAA L + E
Sbjct  23   AKKTYIVHMKHHALPSQYLTHHDWYSANLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSQE  82

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILD  420
            VE LR+ ++V+GVYED+VY+LHTTRTP FLGLD++FGL  GH + +    + DVI+G+LD
Sbjct  83   VELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASHDVIIGVLD  142

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            TG+WPESKSFDD+GM  +P+RWRG CE+ P+F P + CNKKLIGAR ++
Sbjct  143  TGIWPESKSFDDTGMPEIPSRWRGECEAGPDFSP-SLCNKKLIGARSFS  190



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 4/181 (2%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  210
            S+ITI+   L       A AKKTYIV +KH +KP SFQTH DWY + LQS E SLLYTYT
Sbjct  4    SSITIITTFLFLFLLHHASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQS-ESSLLYTYT  62

Query  211  TAYHGFAAALGADEVERL-RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
            T++HG++A L +DE + L R  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G    
Sbjct  63   TSFHGYSAYLDSDEADSLLRDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLG  122

Query  388  EAAD-VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             A++ VI+G+LDTGVWPESKSFDD+ M  +P++W+G CES  +FD K  CNKKLIGAR +
Sbjct  123  SASNGVIIGVLDTGVWPESKSFDDTDMPEIPSKWKGECESGSDFDSKL-CNKKLIGARSF  181

Query  565  T  567
            +
Sbjct  182  S  182



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 125/182 (69%), Gaps = 25/182 (14%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------------------SEDSLLYTYT  210
            KKTYIVHMK H KP SF TH  WY ++LQS                    +++SLLYTY 
Sbjct  26   KKTYIVHMKRHLKPPSFSTHNQWYKSYLQSLTSSNKNSLLYTYNISLTSSNKNSLLYTYN  85

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGFAA+L   EV+ LR+ ++VV VYED+ Y+L TTRTPEFLGLD      AG   PE
Sbjct  86   IASHGFAASLYPHEVDLLRQSDSVVNVYEDTFYTLQTTRTPEFLGLD-NLNSWAGRTLPE  144

Query  391  ----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGAR  558
                A DVI+G+LD+G+WPESKSF+D GM+ VP+RWRG C+SAP+FDP  HCN+KLIGA+
Sbjct  145  LNNAAQDVIIGVLDSGIWPESKSFNDLGMSNVPSRWRGECQSAPDFDPNVHCNRKLIGAQ  204

Query  559  FY  564
            ++
Sbjct  205  YF  206



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 131/192 (68%), Gaps = 15/192 (8%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----S  183
            LV FS +     L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQ       
Sbjct  9    LVHFSVL-----LVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQLLLSPLH  63

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             D LLYTYTTAY+GFAA+L  D+ + L R E V+GVYE++VY LHTTRTP+FLGLD E G
Sbjct  64   SDPLLYTYTTAYNGFAASLAEDQAQELLRSEDVLGVYEETVYQLHTTRTPQFLGLDRETG  123

Query  364  LGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
            L  GH + +    + DVIVG+LDTGVWPES SF D+ M  +PARWRG CE+ P+F P   
Sbjct  124  LWEGHTTQDLNQASHDVIVGVLDTGVWPESPSFADAEMPEIPARWRGECEAGPDFSPSV-  182

Query  532  CNKKLIGARFYT  567
            CNKKLIGAR ++
Sbjct  183  CNKKLIGARSFS  194



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 132/187 (71%), Gaps = 18/187 (10%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-SEDS---------  192
            I L LL      +A AK+TYIV +KH +KP SF TH DWY + LQS S D          
Sbjct  11   IFLFLLY-----SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSQSESE  65

Query  193  --LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              LLYTYTT+++GF+A L  DE E L R E+++ V+ED VY+L TTRTPEFLGL++EFG+
Sbjct  66   SPLLYTYTTSFNGFSAFLDTDEAESLLRSESILDVFEDPVYTLDTTRTPEFLGLNSEFGV  125

Query  367  GAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKL  546
             +G+    +  VI+G+LDTGVWPESKS+DD GM  +P++W+G CES P+FDPK  CNKKL
Sbjct  126  ASGYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIPSKWKGECESGPDFDPKL-CNKKL  184

Query  547  IGARFYT  567
            +GAR ++
Sbjct  185  VGARSFS  191



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 130/174 (75%), Gaps = 12/174 (7%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------SEDSLLYTYTTAYHGFAAA  237
            A  +++TYIV M HH KP SF TH DWY++HLQS        E SLLYTYT+A+HGFAA 
Sbjct  28   AGASRRTYIVRMNHHAKPESFSTHHDWYSSHLQSLSSSSDSGEYSLLYTYTSAFHGFAAV  87

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG---HGSPEAAD-VI  405
            L  DE E LRR + V+ V+E++VYSLHTTRTPEFLGL+ EFG   G   H   +A++ V+
Sbjct  88   LNPDEAEALRRSDPVLDVFEETVYSLHTTRTPEFLGLNPEFGSWVGYSAHDLDQASNGVV  147

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +G+LDTGVWPES+SFDD+GM  +P +WRG CES P+FDPK  CNKKLIGAR ++
Sbjct  148  IGVLDTGVWPESRSFDDTGMPEIPEKWRGECESGPDFDPKL-CNKKLIGARSFS  200



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 137/188 (73%), Gaps = 11/188 (6%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS------L  195
            A+T+L  L      +  +AK+TYIVHMKHH KP +F TH++WY+A LQS   +      L
Sbjct  5    ALTLLSLLFISITCSTTIAKQTYIVHMKHHTKPEAFATHQEWYSASLQSVTTTTSPSDSL  64

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LY+Y++A+ GFAA+L  +E + LR+  AV+ VYED+VYSLHTTRTPEFLGL+ + GL  G
Sbjct  65   LYSYSSAFPGFAASLDPEEADSLRKSNAVLDVYEDTVYSLHTTRTPEFLGLNTDLGLLGG  124

Query  376  HGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            H S +    +  V++G+LDTGVWPESKSFDDSGM  +P++W+G CES  +F PK  CNKK
Sbjct  125  HNSLDIDRASYSVVIGVLDTGVWPESKSFDDSGMPEIPSKWKGECESGSDFSPKL-CNKK  183

Query  544  LIGARFYT  567
            LIGARF++
Sbjct  184  LIGARFFS  191



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 10/169 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL-----YTYTTAYHGFAAALGADE  252
            AKKTYIVHMKHH  PS + TH DWY+A LQS   S       YTYT+++HGFAA L ++E
Sbjct  25   AKKTYIVHMKHHALPSEYLTHHDWYSASLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSEE  84

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILD  420
            VE LR+ ++V+GVYED+VY+LHTTRTP FLGLD++FGL  GH + +    + DVI+G+LD
Sbjct  85   VELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASHDVIIGVLD  144

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            TG+WPESKSFDD+GM  +P+RWRG CE+ P+F P + CNKKLIGAR ++
Sbjct  145  TGIWPESKSFDDTGMPEIPSRWRGGCEAGPDFSP-SLCNKKLIGARSFS  192



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 124/168 (74%), Gaps = 6/168 (4%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEV  255
            T   AK+TYIVHM H +KP+SF TH DWY + L +   SL+Y+Y  A+HGFA +L  +++
Sbjct  21   TVFAAKQTYIVHMNHQQKPTSFPTHHDWYQS-LSTDPSSLIYSYNNAFHGFAISLDPNQL  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
              LRR ++V+ +Y DS+YSLHTTR+PEFLGLD++ GL  GH + +    + DVI+G+LDT
Sbjct  80   ASLRRSDSVLAIYPDSLYSLHTTRSPEFLGLDSDLGLWPGHSTEDLDQASQDVIIGVLDT  139

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPESKSFDD G+  VP+RW G CES P+F P   CNKKLIGAR ++
Sbjct  140  GVWPESKSFDDMGIPPVPSRWLGACESGPDFSPSV-CNKKLIGARSFS  186



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 129/173 (75%), Gaps = 14/173 (8%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL---------LYTYTTAYHGFAAAL  240
             ++TYIV M H+EKP SF TH DWY++HL S   S          LYTYT+A+HGF+A L
Sbjct  23   GRRTYIVRMNHNEKPESFSTHHDWYSSHLHSLSSSSSSGDDESSLLYTYTSAFHGFSAVL  82

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIV  408
              DE E LRR + V+ V+E++VYSLHTTRTPEFLGL++EFG  AG+G+ +    +  V++
Sbjct  83   DPDEAEALRRSDPVLDVFEETVYSLHTTRTPEFLGLNSEFGSWAGYGAQDLNQASYGVVI  142

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            G+LDTGVWPES+SFDD+GM  +PA+WRG CES P+FDPK  CNKKLIGAR ++
Sbjct  143  GVLDTGVWPESRSFDDTGMPEIPAKWRGECESGPDFDPKL-CNKKLIGARSFS  194



>gb|KCW79385.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=564

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = +1

Query  100  YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---------YTYTTAYHGFAAALGADE  252
            YIVHM HHEKPS F TH DWY + L S   S           Y+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               LRR  AV+GVYED+VYSLHTTRTPEFLGL AE      +  P +ADV++G+LDTGVW
Sbjct  91   AASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPNPDPSSADVVIGVLDTGVW  150

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PES+SFDDSGM  VPARWRG+CES P+FDP+  CNKKLIGAR ++
Sbjct  151  PESRSFDDSGMPDVPARWRGQCESGPDFDPRL-CNKKLIGARSFS  194



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 4/162 (2%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL-  264
            AKKTYIV +KH ++P SFQTH DWY + LQS E SLLYTYTT++HG++A L +DE + L 
Sbjct  24   AKKTYIVRVKHSDEPDSFQTHHDWYTSQLQS-ESSLLYTYTTSFHGYSAYLDSDEADSLL  82

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWPES  441
            R  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G     A++ VI+G+LDTGVWPES
Sbjct  83   RDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLGSASNGVIIGVLDTGVWPES  142

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KSFDD+ M  +P++W+G CES  +FD K  CNKKLIGAR ++
Sbjct  143  KSFDDTDMPEIPSKWKGECESGSDFDSKL-CNKKLIGARSFS  183



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 137/191 (72%), Gaps = 15/191 (8%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--------E  186
            S+ITI   L+    +T A  KKTYIV +KH +KP SF TH DWY + LQS         E
Sbjct  3    SSITISFLLIFLLYSTEA--KKTYIVRVKHSDKPDSFPTHHDWYTSQLQSLSTQQQSESE  60

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             SLLYTYTT+++GF+A L ++E E L R ++++ V+ED VY+LHTTRTPEFLGL++EFG+
Sbjct  61   SSLLYTYTTSFNGFSAFLDSNEAESLLRSDSILDVFEDPVYTLHTTRTPEFLGLNSEFGV  120

Query  367  GAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
             AG+   +    +  VI+G+LDTGVWPESKSFDDSGM  +P++W+G CES  +FD K  C
Sbjct  121  AAGYSGQDLGQASNSVIIGVLDTGVWPESKSFDDSGMPEIPSKWKGECESGTDFDSKL-C  179

Query  535  NKKLIGARFYT  567
            NKKLIGAR ++
Sbjct  180  NKKLIGARSFS  190



>ref|XP_002519361.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42978.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 10/190 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS+    A T     L    +  A+AKKTYIVHM H+ KP+S+ TH  WY + + SS  
Sbjct  1    MGSM----ATTFYFFSLVLSFSLPAIAKKTYIVHMNHNAKPNSYPTHHHWYQSLVTSSSS  56

Query  190  SLL-YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              L YTYT A+HGFAA L   E + LR +++V+ V+E+ +Y+L TT TP+FLG+DA FGL
Sbjct  57   DSLLYTYTAAFHGFAAHLDPQEADALREMDSVLNVFEEEIYTLQTTHTPQFLGIDANFGL  116

Query  367  GAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
              G    +    +ADVIVG+LD+GVWPESKS DD G+ A+P RW+G+C+S  +FD K  C
Sbjct  117  SDGRNFNDVEQASADVIVGVLDSGVWPESKSLDDKGLPAIPKRWKGKCKSTKDFDHKL-C  175

Query  535  NKKLIGARFY  564
            NKKLIGAR++
Sbjct  176  NKKLIGARYF  185



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 126/164 (77%), Gaps = 4/164 (2%)
 Frame = +1

Query  82   AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  261
            A AKKTYIV +KH +KP SFQ+H DWY++ L S E SLLYTYTT++HGF+A L + E E 
Sbjct  23   AAAKKTYIVRVKHSDKPESFQSHHDWYSSQLNS-ESSLLYTYTTSFHGFSAYLTSSEAES  81

Query  262  L-RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWP  435
            L R  ++++ V+ED +Y+LHTTRTPEFLGL++EFG+        A++ VI+G+LDTGVWP
Sbjct  82   LLRDSDSILDVFEDPLYTLHTTRTPEFLGLNSEFGVYTNQDLVSASNGVIIGVLDTGVWP  141

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ESKSFDD+ M  +P++WRG CES  +FD K  CNKKLIGAR ++
Sbjct  142  ESKSFDDTDMPEIPSKWRGECESGSDFDSKL-CNKKLIGARSFS  184



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 24/193 (12%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS   
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYXTHDDWYSASLQSISS  54

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V GVYED VYSLHTTR           
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVXGVYEDEVYSLHTTR----------L  104

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            GL AGH + +    + DVI+G+LDTGVWP+S+SFDDSGMT VPARWRG+CE  P+F   +
Sbjct  105  GLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVPARWRGKCEEGPDFQ-AS  163

Query  529  HCNKKLIGARFYT  567
             CNKKLIGA+ ++
Sbjct  164  SCNKKLIGAQSFS  176



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = +1

Query  100  YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---------YTYTTAYHGFAAALGADE  252
            YIVHM HHEKPS F TH DWY + L S   S           Y+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               LRR  AV+GVYED+VYSLHTTRTPEFLGL AE      +  P +ADV++G+LDTGVW
Sbjct  91   AASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPNPDPSSADVVIGVLDTGVW  150

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PES+SFDDSGM  VPARWRG+CES P+FDP+  CNKKLIGAR ++
Sbjct  151  PESRSFDDSGMPDVPARWRGQCESGPDFDPRL-CNKKLIGARSFS  194



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 126/179 (70%), Gaps = 16/179 (9%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDS  192
            I L LL      +A AK+TYIV +KH +KP SF TH DWY + LQS          SE  
Sbjct  11   IFLFLLY-----SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSESESP  65

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            LLYTYTT+++GF+A L  DE E L R E+++ V+ED VY+L TTRTPEFLGL++EFG+ +
Sbjct  66   LLYTYTTSFNGFSAFLDTDEAESLLRSESILDVFEDPVYTLDTTRTPEFLGLNSEFGVAS  125

Query  373  GHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLI  549
            G+    +  VI+G+LDTGVWPESKS+DD GM  +P++W+G CES P+FD K  CNKKL+
Sbjct  126  GYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIPSKWKGECESGPDFDSKL-CNKKLM  183



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 125/180 (69%), Gaps = 21/180 (12%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLYTYTTAY  219
            +KKTYIVHMK H KPS +QTH DWY A LQS                  D LLY+YTTAY
Sbjct  23   SKKTYIVHMKDHNKPSVYQTHHDWYTASLQSLSINTDSESSDSDSDSDFDPLLYSYTTAY  82

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---  390
            +GFA  L  ++V+ L R ++V+GVYED+VY LHTTRTP+FLGL+ E GL  GH + E   
Sbjct  83   NGFAVTLNDEQVQSLTRSDSVLGVYEDTVYQLHTTRTPQFLGLETETGLWEGHRTQELDQ  142

Query  391  -AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
             + DVIVG+LDTGVWPES SF+D+G+  +P RWRG CE  P+F+  + CN+KLIGAR ++
Sbjct  143  ASHDVIVGVLDTGVWPESLSFNDAGLPVIPTRWRGACEDTPDFN-ASLCNRKLIGARSFS  201



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 122/175 (70%), Gaps = 17/175 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  240
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  33   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  92

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAGHGSPEA-ADV  402
              DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL     G   G   A  DV
Sbjct  93   DPDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISGDLGLWDPQEGPNGGKRRAFGDV  152

Query  403  IVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            IVG+LDTGVWPESKSFDD+GM  +PARW+G CES P+F  K+ CNKKLIGARF++
Sbjct  153  IVGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSAKS-CNKKLIGARFFS  206



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 119/174 (68%), Gaps = 16/174 (9%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  243
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA------ADVI  405
             DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL   H  P         DVI
Sbjct  90   PDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISDDLGLWDPHEGPNGGKRRAFGDVI  149

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VG+LDTGVWPESKSFDD+GM  +PARW+G CES P+F  K+ CNKKLIGARF++
Sbjct  150  VGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSTKS-CNKKLIGARFFS  202



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 119/174 (68%), Gaps = 16/174 (9%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  243
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA------ADVI  405
             DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL   H  P         DVI
Sbjct  90   PDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISDDLGLWDPHEGPNGGKRRAFGDVI  149

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VG+LDTGVWPESKSFDD+GM  +PARW+G CES P+F  K+ CNKKLIGARF++
Sbjct  150  VGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSTKS-CNKKLIGARFFS  202



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 121/175 (69%), Gaps = 17/175 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  240
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  30   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  89

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAGHGSPEA-ADV  402
              DE + LR   +V+GVYED+VY LHTTR P FLG+  + GL     G   G   A  DV
Sbjct  90   DPDEADALRSSASVLGVYEDTVYELHTTRKPAFLGISGDLGLWDQQEGPNGGKRRAFGDV  149

Query  403  IVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            IVG+LDTGVWPESKSFDD+GM  +PARW+G CES P+F  K+ CNKKLIGARF++
Sbjct  150  IVGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSAKS-CNKKLIGARFFS  203



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 123/184 (67%), Gaps = 14/184 (8%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  210
            S+I++   LL+    +A   KKTYIVHMK     S   T RDWYAA L SS DSLLY YT
Sbjct  3    SSISLFFLLLQLTMLSAT--KKTYIVHMKQRHDSSVHPTQRDWYAATLDSSPDSLLYAYT  60

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAG  375
             +Y+GFAA L   E   LR  ++V+GVYED+ Y+LHTTRTPEFLGL A          A 
Sbjct  61   ASYNGFAAILDPQEAHVLRASDSVLGVYEDTRYTLHTTRTPEFLGLQAHSAFWQDLHQAS  120

Query  376  HGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGA  555
            H      DV++G+LDTGVWPES+SFDDS M  +P RWRG CESAP+FDP + CN KLIGA
Sbjct  121  H------DVVIGVLDTGVWPESQSFDDSQMPQIPTRWRGNCESAPDFDP-SLCNNKLIGA  173

Query  556  RFYT  567
            R ++
Sbjct  174  RSFS  177



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 128/192 (67%), Gaps = 15/192 (8%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SE  186
            S  W   + + L L  PCA    +AKKTYIV M     P +F T +DWY+A+LQS     
Sbjct  4    SAAWLPFLALSL-LAFPCA----MAKKTYIVQMTDQSVPGTFNTSQDWYSANLQSLASGA  58

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              +LY Y+ A+HG+AA+L  ++ E LR  +AV+GVYED +Y LHTTRTP FL ++ EFGL
Sbjct  59   TDILYVYSEAFHGYAASLEPNQAEALRSSDAVLGVYEDVMYHLHTTRTPSFLKVEDEFGL  118

Query  367  GAGHGSP-EAAD-----VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
              G G+P E  D     VIVGILDTGV+PESKSFDD G   VPARW+G+C   P+FDP +
Sbjct  119  WPGTGNPTEKTDEPFPEVIVGILDTGVFPESKSFDDLGFPEVPARWKGKCVKGPDFDP-S  177

Query  529  HCNKKLIGARFY  564
             CNKKLIGA F+
Sbjct  178  LCNKKLIGAYFF  189



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 116/162 (72%), Gaps = 6/162 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  267
            AKK+YIVHMK    P    TH DWY A L SS DSL+Y YT+ Y+GFAA L   ++  LR
Sbjct  30   AKKSYIVHMKERHDPGVHPTHLDWYTATLLSSSDSLIYAYTSVYNGFAATLDPQQLHALR  89

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDA--EFGLGAGHGSPEAADVIVGILDTGVWPES  441
              ++V+GVYED++Y+LHTTRTPEFLGL A  EF       S    +V++G+LDTGVWPES
Sbjct  90   TSDSVLGVYEDTLYTLHTTRTPEFLGLQAHSEFWEDLHQAS---HNVVIGVLDTGVWPES  146

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +SFDDS M  +P RWRG C+SAP+FDP + CN KLIGAR ++
Sbjct  147  QSFDDSQMPQIPTRWRGSCDSAPDFDP-SLCNNKLIGARSFS  187



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 15/192 (8%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SE  186
            S  W + + + L L  PCA    +AKKTYIV MK    P +F T  DWY+A+LQS     
Sbjct  4    SAAWLTFLALSL-LAFPCA----MAKKTYIVQMKEQSVPGTFNTSLDWYSANLQSLAPGV  58

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             ++LY Y+ A+HG+A +L   + E LR  + V+GVYED +Y LHTTRTP FL ++ EFGL
Sbjct  59   ANILYVYSEAFHGYAVSLEPHQAEALRSSDTVLGVYEDIMYHLHTTRTPSFLKVEDEFGL  118

Query  367  GAGHGSPEA------ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
              G G+P         +VI+G++DTGV+PESKSF+DSG   VPARW+G+C   P+FDP+ 
Sbjct  119  WPGTGNPAKETDQTFPEVIIGLIDTGVFPESKSFEDSGFPEVPARWKGKCVKGPDFDPQL  178

Query  529  HCNKKLIGARFY  564
             CNKKLIGA FY
Sbjct  179  -CNKKLIGAYFY  189



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 137/209 (66%), Gaps = 28/209 (13%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY---------  162
            MGS+    +I +LL L+  C +  +  KKTYIVHMK+H  P+ + TH +WY         
Sbjct  1    MGSVSI--SIFLLLTLISQCYSLPS--KKTYIVHMKNHYNPTIYPTHYNWYSSTLQSLSL  56

Query  163  ---AAHLQSSE-------DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYS  312
               +++L S +       D LLY+YTTAY GFAA L   + E L + + V+GVYED++Y 
Sbjct  57   SIDSSNLDSDDVVDETDSDPLLYSYTTAYTGFAAKLNTQQAETLLQNDDVLGVYEDTLYH  116

Query  313  LHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTGVWPESKSFDDSGMTAVPA  480
            LHTTRTP+FLGL+ + GL  GH + E    + DVI+G+LDTGVWPES SF+D+G+  +P 
Sbjct  117  LHTTRTPQFLGLETQTGLWEGHRTQELDQASHDVIIGVLDTGVWPESLSFNDAGLPEIPT  176

Query  481  RWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            RWRG CE+AP+F+    CN+KLIGAR ++
Sbjct  177  RWRGACENAPDFNSSV-CNRKLIGARSFS  204



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 129/195 (66%), Gaps = 21/195 (11%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            +F   ++L  L+     +++  +KTYIVHM HH+KPS FQTH +WY+++L S        
Sbjct  10   FFFTFSLLQFLI-----SSSSLRKTYIVHMNHHQKPSIFQTHHEWYSSNLHSLSSFDTLS  64

Query  199  -----------YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLG  345
                       YTY  +Y GFAA L   EV+ L++ +AV G+YED++Y+LHTTRTPEFLG
Sbjct  65   SSSSSSSPSLLYTYENSYSGFAATLTNSEVQSLQQNDAVFGIYEDTLYTLHTTRTPEFLG  124

Query  346  LD-AEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
            LD A  GL +G    + +DVIVG+LDTG+WPES+SF DSG+  VP RW+G CE+ P F  
Sbjct  125  LDVAGEGLASGE-KLDTSDVIVGVLDTGIWPESESFSDSGIPPVPKRWKGECETGPEFS-  182

Query  523  KTHCNKKLIGARFYT  567
             + CNKKLIGAR ++
Sbjct  183  LSSCNKKLIGARSFS  197



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 130/180 (72%), Gaps = 5/180 (3%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  210
            S+ITI   L      T   AKKTYI+ +KH +KP SF TH DWY + LQS   SLLYTYT
Sbjct  5    SSITITTFLFLFLLHT--TAKKTYIIRVKHSDKPESFLTHHDWYTSQLQSQS-SLLYTYT  61

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
            T++HGF+A L ++E + L    +++ ++ED +Y+LHTTRTPEFLGL++EFG+  G     
Sbjct  62   TSFHGFSAYLDSNEADSLLSSNSILDIFEDPLYTLHTTRTPEFLGLNSEFGVYTGQDLAS  121

Query  391  AAD-VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            A++ VI+G+LDTGVWPESKSFDD+ M  +P++W+G CES  +FD K  CNKKLIGAR ++
Sbjct  122  ASNGVIIGVLDTGVWPESKSFDDTDMPEIPSKWKGECESGSDFDSKL-CNKKLIGARSFS  180



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 121/162 (75%), Gaps = 3/162 (2%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            +K+TYI+ +KH +KP SF TH DWY++ LQS   +  LLY+Y+T++HG++A L + E + 
Sbjct  22   SKRTYIIRVKHSDKPDSFSTHHDWYSSQLQSLSSNPQLLYSYSTSFHGYSAFLDSHEADT  81

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L   ++V+ ++ED +Y+LHTTRTPEFLGL ++ G  A      + DV++G+LDTGVWPES
Sbjct  82   LLNSDSVLDIFEDPIYTLHTTRTPEFLGLSSDLGFAATDLGHASNDVVIGVLDTGVWPES  141

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KS+DD+GM  +P++W+G CES  +FD K  CNKKLIGAR ++
Sbjct  142  KSYDDTGMPEIPSKWKGECESGSDFDSKL-CNKKLIGARSFS  182



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 114/167 (68%), Gaps = 16/167 (10%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHL-----------QSSEDSLLYTYTTAYHGFAAALGADEVE  258
            MKHH+K S + TH DWY   L            S  + LLY+YTT+Y GFAA+L  ++VE
Sbjct  1    MKHHKKSSVYPTHSDWYNTTLLQSLTLTTTDSDSKSNPLLYSYTTSYKGFAASLNDEQVE  60

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             L + E V+ VYED+VY LHTTRTPEFLGL+ E  L  GH + +    + DVI+G+LDTG
Sbjct  61   ELLKSEDVLKVYEDTVYQLHTTRTPEFLGLEKETKLWEGHTAQDLNQASHDVIIGVLDTG  120

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPES SFDD+GM  +PARWRG CE+ P+F  K  CNKKLIGAR ++
Sbjct  121  VWPESSSFDDAGMPEIPARWRGECETGPDFSTKM-CNKKLIGARSFS  166



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 11/164 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  267
            AKKTYI+ + H +KP SF TH DWY + L S E SLLYTYTT++HGF+A L + E + L 
Sbjct  26   AKKTYIIRVNHSDKPESFLTHHDWYTSQLNS-ESSLLYTYTTSFHGFSAYLDSTEADSLL  84

Query  268  RLEAVVG-VYEDSVYSLHTTRTPEFLGLDAEFG---LGAGHGSPEAADVIVGILDTGVWP  435
                 +  ++ED +Y+LHTTRTPEFLGL++EFG   LG+      +  VI+G+LDTGVWP
Sbjct  85   SSSNSILDIFEDPLYTLHTTRTPEFLGLNSEFGVHDLGS-----SSNGVIIGVLDTGVWP  139

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ES+SFDD+ M  +P++W+G CES  +FD K  CNKKLIGAR ++
Sbjct  140  ESRSFDDTDMPEIPSKWKGECESGSDFDSKL-CNKKLIGARSFS  182



>gb|ACN39811.1| unknown [Picea sitchensis]
Length=690

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 124/193 (64%), Gaps = 24/193 (12%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----S  183
            +++LL L   C AT   A      KKTY+VHM   + P+ F +H  WYA+ ++S      
Sbjct  11   VSVLLVL--GCLATVLAAISHDGVKKTYVVHMAKSQMPAGFTSHEHWYASAVKSVLSEEE  68

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD-AEF  360
            E S+LY Y  A+HGFAA L A + E L +   ++G+Y ++VY LHTTRTP+FLGL+ AE 
Sbjct  69   EPSILYNYDDAFHGFAARLNAAQAEALEKTHGILGIYPETVYELHTTRTPQFLGLETAES  128

Query  361  GLGAGHGSPEAA----DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            G+      PE A    DV++G+LDTGVWPES SF+D GM  VPA W+G CES  NF   +
Sbjct  129  GM-----WPEKANFGHDVVIGVLDTGVWPESLSFNDRGMGPVPAHWKGACESGTNFT-AS  182

Query  529  HCNKKLIGARFYT  567
            HCNKKLIGARF +
Sbjct  183  HCNKKLIGARFLS  195



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 115/179 (64%), Gaps = 5/179 (3%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  210
            + +LL      AA    ++ TYIVHM   E P+SFQ H  WY A L+S+ DS  +LYTY+
Sbjct  8    LVVLLLGFSGYAAAEVSSRSTYIVHMAKSEMPASFQHHTHWYDASLKSASDSAEMLYTYS  67

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGF+  L  +E E L+    V+ V  +  Y LHTTRTPEFLGLD    L     S  
Sbjct  68   NAIHGFSTQLTPEEAEMLKFQPGVLFVLPELKYELHTTRTPEFLGLDQNNELFPE--SQS  125

Query  391  AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            A+DVI+G+LDTGVWPESKSFDDSG+  VPA W+G CE   NF   + CN+KLIGAR+++
Sbjct  126  ASDVIIGVLDTGVWPESKSFDDSGLGPVPASWKGTCEVGTNFS-SSACNRKLIGARYFS  183



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 12/166 (7%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------  180
            S ITI L  L      +A AK+TYIV +KH +KP SF TH DWY   LQS          
Sbjct  3    SPITITLIFL--FLLYSAEAKRTYIVRVKHSDKPESFSTHHDWYTWQLQSISTDPQSQTE  60

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            SE  LLYTY T+++GF+A L  +E E L R ++++ V+ED VY+L TTRTPEFLGL +EF
Sbjct  61   SESPLLYTYKTSFNGFSAFLDTEEAESLLRSDSILDVFEDPVYTLDTTRTPEFLGLKSEF  120

Query  361  GLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRC  498
            G+ +G+    +  VI+G+LDTGVWPESKS+DD GM  +P++W+G C
Sbjct  121  GVASGYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIPSKWKGEC  166



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 7/172 (4%)
 Frame = +1

Query  67   CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  231
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVG  411
            A L   E   + R   V+GV  ++ Y LHTTRTPEFLGLD   G      S   +DV+VG
Sbjct  78   ARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLGLDRTEGFIPQ--SNTTSDVVVG  135

Query  412  ILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +LDTGVWPE KS+DD+G+  VPA W+G CE   +F     CN+KL+GARF++
Sbjct  136  VLDTGVWPERKSYDDAGLGPVPASWKGACEEGKDFKAANACNRKLVGARFFS  187



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 7/172 (4%)
 Frame = +1

Query  67   CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  231
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVG  411
            A L   E   + R   V+GV  ++ Y LHTTRTPEFLGLD   G      S   +DV+VG
Sbjct  78   ARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLGLDRTEGFIPQ--SNTTSDVVVG  135

Query  412  ILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +LDTGVWPE KS+DD+G+  VPA W+G CE   +F     CN+KL+GARF++
Sbjct  136  VLDTGVWPERKSYDDAGLGPVPASWKGACEEGKDFKAANACNRKLVGARFFS  187



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   170 bits (430),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 11/176 (6%)
 Frame = +1

Query  46   LLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAY  219
            L+ LL      A   KKTYIVHMKH++  S        Y+  LQSS  S  LLYTYT AY
Sbjct  14   LVMLLLSVTVMALTNKKTYIVHMKHNKNAS-------MYSPILQSSSSSDSLLYTYTHAY  66

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            +GFA +L   +V+ LR  ++V+GVYED++YSLHTTRTPEFLGL  +    +      + D
Sbjct  67   NGFAVSLDTKQVQELRSSDSVLGVYEDTLYSLHTTRTPEFLGL-LQIQTHSQFLHQPSYD  125

Query  400  VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            V++G+LDTGVWPES+SF DS +  +P+RWRG+CESAP+FD  + CNKKLIGAR ++
Sbjct  126  VVIGVLDTGVWPESQSFHDSQIPQIPSRWRGKCESAPDFD-SSLCNKKLIGARSFS  180



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 11/176 (6%)
 Frame = +1

Query  46   LLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAY  219
            L+ LL      A   KKTYIVHMKH++  S        Y+  LQSS  S  LLYTYT AY
Sbjct  14   LVMLLLSVTVMALTNKKTYIVHMKHNKNAS-------MYSPILQSSSSSDSLLYTYTHAY  66

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            +GFA +L   +V+ LR  ++V+GVYED++YSLHTTRTPEFLGL  +    +      + D
Sbjct  67   NGFAVSLDTKQVQELRSSDSVLGVYEDTLYSLHTTRTPEFLGL-LQIQTHSQFLHQPSYD  125

Query  400  VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            V++G+LDTGVWPES+SF DS +  +P+RWRG+CESAP+FD  + CNKKLIGAR ++
Sbjct  126  VVIGVLDTGVWPESQSFYDSQIPQIPSRWRGKCESAPDFD-SSLCNKKLIGARSFS  180



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  29   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWPESK
Sbjct  89   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  146

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+G+  VP+ W+G CE+  NF+  ++CN+KLIGAR++
Sbjct  147  SFDDTGLGPVPSSWKGACETGTNFN-ASNCNRKLIGARYF  185



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  29   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWPESK
Sbjct  89   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  146

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+G+  VP+ W+G CE+  NF+  ++CN+KLIGAR++
Sbjct  147  SFDDTGLGPVPSSWKGACETGTNFN-ASNCNRKLIGARYF  185



>ref|XP_009401756.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=782

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 108/174 (62%), Gaps = 18/174 (10%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLYTYTTAYHG  225
            KTYIVH+   EKP SF TH DWY + + S                  D ++Y+Y TA+HG
Sbjct  33   KTYIVHVAKSEKPDSFATHVDWYLSTINSVAATSSELDASTEADDPADRIVYSYETAFHG  92

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DV  402
            FA  LGADE ERL  +  V+ V  ++VY LHTTR+PEFLG+  E        +  A  DV
Sbjct  93   FATKLGADEAERLESVPGVLAVLPETVYRLHTTRSPEFLGIGPEDSSNIFTTAASANHDV  152

Query  403  IVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             VG+LDTG+WPES SF D GM AVPARW+G CE+  NF   ++CN+K++GAR +
Sbjct  153  FVGVLDTGIWPESPSFSDKGMPAVPARWKGACEAGRNFT-HSNCNRKIVGARIF  205



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 112/176 (64%), Gaps = 14/176 (8%)
 Frame = +1

Query  67   CAATAAVA----KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGF  228
            C++TA VA    K+TYIVHM   + P +F  HR WY A L+S  D+  ++Y Y TA HGF
Sbjct  20   CSSTAVVAAVAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDAAEIIYAYDTAAHGF  79

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---AD  399
            +A L   E   L     V+GV  +  Y LHTTRTPEFLGLD   GL      P++   +D
Sbjct  80   SARLSPAEARALEHRPGVLGVVLEERYELHTTRTPEFLGLDRSEGL-----IPQSNTESD  134

Query  400  VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            V+VG+LDTGVWPE KS+DD+G+  VPA W+G CE   +F     CN+KL+GARF++
Sbjct  135  VVVGVLDTGVWPERKSYDDAGLGPVPASWKGVCEEGKDFKAADACNRKLVGARFFS  190



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 119/189 (63%), Gaps = 17/189 (9%)
 Frame = +1

Query  28   FSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--L  195
            +  I +++ LL  C  + A V KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLFRCHMSVAMVKKKTYIIHMAKSQMPATFNDDHTHWYDSSLRSVSDSAEM  72

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLG  369
            LY Y    HGF+A L   E E L     ++ V  +  Y LHTTRTP FLGLD  A+F   
Sbjct  73   LYVYNNVIHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGLDKSADF---  129

Query  370  AGHGSPEA---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNK  540
                 PE+   +DVI+G+LDTGVWPESKSFDDSG+  +PA W+G+CES  NF   ++CN+
Sbjct  130  ----FPESDAMSDVIIGVLDTGVWPESKSFDDSGLGPIPASWKGQCESGTNFS-SSNCNR  184

Query  541  KLIGARFYT  567
            KLIGAR+++
Sbjct  185  KLIGARYFS  193



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  30   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWPESK
Sbjct  90   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  147

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+G+  VP+ W+G CE+  NF+  ++CN+KLIGAR++
Sbjct  148  SFDDTGLGPVPSSWKGACETGTNFN-ASNCNRKLIGARYF  186



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 78/158 (49%), Positives = 114/158 (72%), Gaps = 8/158 (5%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGV  291
            M H+ KP ++ TH  WY + L S+ DS+LYTYTTA+ GFAA L  +E E L++L+ V+ V
Sbjct  1    MNHNSKPDTYTTHHQWYQS-LTSTSDSILYTYTTAFQGFAAYLDPEEAESLKKLDNVLNV  59

Query  292  YEDSVYSLHTTRTPEFLGLDAEFGL-GAGHGSPE-----AADVIVGILDTGVWPESKSFD  453
            +ED VYSL TT TP+FLGL++ FGL   G  + +     + D+I+G+LD+G+WPESKSFD
Sbjct  60   FEDGVYSLQTTHTPQFLGLNSNFGLIDDGRRTFQEIERASQDIIIGVLDSGIWPESKSFD  119

Query  454  DSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            D+G+  +P  W+G+C++  +F+ K  CNKK+IGA +Y+
Sbjct  120  DTGLPEIPKHWKGKCKTTRDFNSKL-CNKKIIGAYYYS  156



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 115/188 (61%), Gaps = 8/188 (4%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW     +LL L    +      KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVW---TFLLLCLFSVPSMAVGDKKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  57

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L  +E +RL     ++ V  +  Y LHTTR+P+FLGLD    
Sbjct  58   SAEMIYAYNNVVHGFSTRLTTEEAQRLEAQPGILAVVPEMRYELHTTRSPQFLGLDKNAN  117

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            L     S   ++VI+G+LDTGVWPESKSFDD+G+  VP+ W+G CES  NF   ++CN+K
Sbjct  118  LYPESNS--VSEVIIGVLDTGVWPESKSFDDTGLGPVPSSWKGECESGTNFS-ASNCNRK  174

Query  544  LIGARFYT  567
            LIGARF++
Sbjct  175  LIGARFFS  182



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 15/166 (9%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L   E E L
Sbjct  32   KSTYIVHVAKSQMPESFENHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTVQEAESL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLGAGHGSPEA---ADVIVGILDTGV  429
             R   ++ V  +  Y LHTTRTP FLGLD  A+F        PE+   +DVIVG+LDTGV
Sbjct  92   ERQSGILSVLPEMKYELHTTRTPSFLGLDRSADF-------FPESNAMSDVIVGVLDTGV  144

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            WPESKSFDD+G+  VP  W+G CES  NF   ++CN+KLIGAR+++
Sbjct  145  WPESKSFDDTGLGPVPDSWKGECESGTNFS-SSNCNRKLIGARYFS  189



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 113/178 (63%), Gaps = 3/178 (2%)
 Frame = +1

Query  40   TILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTT  213
            T++L L       +   KKTYI+HM     P+ F  H  WY + L+S   S  +LYTY +
Sbjct  11   TLVLVLFHVFVDASQNQKKTYIIHMDKFNMPADFDDHTQWYDSSLKSVSKSANVLYTYNS  70

Query  214  AYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA  393
              HG++  L ADE + L +   ++ V+E+ +Y LHTTR+P FLGL+          +   
Sbjct  71   VIHGYSTQLTADEAKALEQQPGILSVHEEVIYELHTTRSPTFLGLEGHESRSFFPQTEAR  130

Query  394  ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ++VI+G+LDTGVWPESKSFDD+G+  VPA W+G+C++  NFD  + CN+KLIGARF++
Sbjct  131  SEVIIGVLDTGVWPESKSFDDTGLGPVPASWKGKCQTGKNFD-ASSCNRKLIGARFFS  187



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 115/188 (61%), Gaps = 9/188 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWM----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L A+E +RL     ++ V  + +Y LHTTR+PEFLGLD    
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRLEAQPGILAVVPEMIYELHTTRSPEFLGLDKNAN  116

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            L     S   ++VI+G+LDTG+ PESKSFDD+G+  VP+ W+G CES  NF   ++CN+K
Sbjct  117  LYPESNS--VSEVIIGVLDTGISPESKSFDDTGLGPVPSSWKGECESGTNFS-ASNCNRK  173

Query  544  LIGARFYT  567
            L+GARF++
Sbjct  174  LVGARFFS  181



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 17/189 (9%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVA-KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--L  195
            +  I +++ LL  C  + A+  KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLSLCRMSVAMEEKKTYIIHMAKSQMPATFNDDHAHWYDSSLKSVSDSAEM  72

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLG  369
            LY Y    HGF+A L   E E L     ++ V  +  Y LHTTRTP FLGLD  A+F   
Sbjct  73   LYVYNNVVHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGLDKGADF---  129

Query  370  AGHGSPEA---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNK  540
                 PE+   +DVI+G+LDTGVWPESKSFDD+G+  VPA W+G+CES  NF   ++CN+
Sbjct  130  ----FPESDAMSDVIIGVLDTGVWPESKSFDDTGLGPVPASWKGQCESGTNFS-SSNCNR  184

Query  541  KLIGARFYT  567
            KLIGAR+++
Sbjct  185  KLIGARYFS  193



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 9/165 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGAD  249
            A+++YI++M     P  F  H+ WY++ ++      S   +LLYTY T  HGFAA L + 
Sbjct  33   ARQSYIIYMDKSMMPDHFSLHQHWYSSMIKEVSGSNSDPTALLYTYDTVTHGFAACLTST  92

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E + +  ++  + V++DS Y LHTTRTP+FLGL +  GL     S    D+IVG+LDTG+
Sbjct  93   EAQAMENMDGCLSVFQDSTYGLHTTRTPDFLGLSSSHGLWP--LSRYGDDIIVGVLDTGI  150

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            WPESKSF+D G+T VPARW+G CE    F+  +HCN KLIGAR++
Sbjct  151  WPESKSFNDQGLTPVPARWKGECEVGTEFN-ASHCNNKLIGARYF  194



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 112/182 (62%), Gaps = 13/182 (7%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  210
            + L + R   A +AV +K  TYIVH+   + P+SF  H  WY + L+S  +S  +LYTY 
Sbjct  17   VFLGVCRVSVAASAVQQKKNTYIVHVAKSQMPASFDDHTRWYDSSLKSVSESAEMLYTYN  76

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGFA  L A E + L+    ++ V  +  Y LHTTRTP FLGL     L      PE
Sbjct  77   NAIHGFATRLTAQEAKSLQDQPGILYVLPEVKYELHTTRTPSFLGLQQSANL-----FPE  131

Query  391  A---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARF  561
            +    DVIV +LDTGVWPESKSFDD+GM  VPA W+G CE+  NF    HCNKKLIGAR+
Sbjct  132  SDSEGDVIVAVLDTGVWPESKSFDDTGMGPVPASWKGACETGTNFT-SNHCNKKLIGARY  190

Query  562  YT  567
            ++
Sbjct  191  FS  192



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 9/166 (5%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHL------QSSEDSLLYTYTTAYHGFAAALGA  246
            + K++YIV+M    KP  F  H+ WY + +       S   ++LYTY T  HGFAA L +
Sbjct  40   ITKQSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTS  99

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTG  426
             E + +   +  + V+ DSVY LHTTRTP+FLGL +  GL     S  A D+IVG+LDTG
Sbjct  100  TEAQAMENTDGCLAVFPDSVYRLHTTRTPDFLGLSSSHGLWPL--SHYADDIIVGVLDTG  157

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +WPESKSF D G+T VPARW+G CE    F+  +HCN KLIGARF+
Sbjct  158  IWPESKSFSDQGLTQVPARWKGECEMGTEFN-ASHCNNKLIGARFF  202



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 111/168 (66%), Gaps = 13/168 (8%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------LLYTYTTAYHGFAAALGADE  252
            + YIV M     P  F TH  WYA+ LQ++ D+       LLYTY +A+HG+AA L   E
Sbjct  39   RVYIVRMSKAHMPPVFTTHDHWYASELQTTIDADANADSRLLYTYDSAFHGYAALLSPYE  98

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDT  423
             E+LR  ++V+ VYE+ VY LHTTR+P FLGL   DA   + +   + E  DV++G+LDT
Sbjct  99   AEKLRSYDSVLAVYEEYVYELHTTRSPAFLGLGGYDAPVDMASLDQASE--DVVIGVLDT  156

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPES SF D+GM  VP +W+G CES P+F P + CN+KLIGAR ++
Sbjct  157  GVWPESPSFSDAGMAVVPPKWQGACESGPDF-PASACNRKLIGARSFS  203



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 115/185 (62%), Gaps = 11/185 (6%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  192
            +T+ L LL  C    A        ++TYIVHM   + P SFQ    WY + L+S  +S  
Sbjct  8    LTVALTLLGFCHVFVAAVERNDEERRTYIVHMATSQMPESFQERAHWYDSSLKSVSESAE  67

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            +LY Y+   HGF+  L A+E   L+    ++ + E+  Y LHTTRTPEFLGLD    L  
Sbjct  68   MLYKYSNVIHGFSTRLTAEEARSLQGRPGILSILEEVRYELHTTRTPEFLGLDKSADLFP  127

Query  373  GHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIG  552
              GS  A++VI+G+LDTG+WPESKSFDD+G+  +P+ W+G CE+  NF   + CN+KLIG
Sbjct  128  ESGS--ASEVIIGVLDTGIWPESKSFDDTGLGPIPSSWKGECETGTNFT-SSSCNRKLIG  184

Query  553  ARFYT  567
            ARF++
Sbjct  185  ARFFS  189



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 112/181 (62%), Gaps = 5/181 (3%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLY  201
            F ++ + L L    A      K TYIVH+   E P SF+ H  WY + L++  DS  ++Y
Sbjct  11   FLSVVLFLGLYEAAAEQTQTHKSTYIVHVAKSEMPESFEHHAVWYESSLKTVSDSAEMIY  70

Query  202  TYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG  381
            TY  A HG+A  L A+E   L+R   ++ V  ++ Y L TTRTP FLGLD    L     
Sbjct  71   TYDNAIHGYATRLTAEEARLLQRQTGILAVLPETRYELFTTRTPLFLGLDKSADLFPESS  130

Query  382  SPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARF  561
            S   +DVIVG+LDTGVWPESKSFDD+G+  VP+ W+G CE+  NF   ++CN+KLIGARF
Sbjct  131  S--GSDVIVGVLDTGVWPESKSFDDTGLGPVPSTWKGACETGTNFT-ASNCNRKLIGARF  187

Query  562  Y  564
            +
Sbjct  188  F  188



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 108/169 (64%), Gaps = 5/169 (3%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  240
            C  + A  KKTYIVHM   + P SF+ H  WY + L+S  DS  +LYTY    HGF+  L
Sbjct  16   CHLSMAAEKKTYIVHMAKFQMPESFEEHTHWYDSSLKSVSDSAEMLYTYNNVIHGFSTRL  75

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILD  420
              +E + L     ++ V  +  Y LHTTRTPEFLGLD   GL     S  A++V+VG+LD
Sbjct  76   TDEEAKLLEGRPGILLVLPEVRYELHTTRTPEFLGLDKNDGLFPQ--SDSASEVVVGVLD  133

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            TGVWPES SFDD G+  +P+ W+G CE   NF+  ++CN+KLIGARF++
Sbjct  134  TGVWPESLSFDDKGLGPIPSGWKGECEVGKNFN-ASNCNRKLIGARFFS  181



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 114/191 (60%), Gaps = 10/191 (5%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKK-----TYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            +++ F ++ I L L+     T A  K      TYI+HM     P SF  H  W+ + L+S
Sbjct  6    NMLIFKSLQISLLLVFSIRNTTAEKKTHHTKHTYIIHMDKFNMPESFNDHLLWFDSSLKS  65

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LYTY    HGF+  L   E E L +   V+ V  +  Y LHTTRTPEFLGL  
Sbjct  66   VSDSAEMLYTYKKVAHGFSTRLTTQEAELLSKQPGVLSVIPEVRYDLHTTRTPEFLGLAK  125

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
               L    G  + +DVIVG+LDTGVWPE KSFDD+G+  VP+ W+G CE   NF+P ++C
Sbjct  126  YSTLSLASG--KQSDVIVGVLDTGVWPELKSFDDTGLGPVPSSWKGECERGKNFNP-SNC  182

Query  535  NKKLIGARFYT  567
            NKKL+GARF++
Sbjct  183  NKKLVGARFFS  193



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM    KP++F  H +WY + L+S  DS  +LYTY    HGF+ +L   E + L
Sbjct  33   KRTYIIHMDKSNKPATFDNHFNWYDSSLKSVSDSADMLYTYNNVIHGFSTSLTEKEAQFL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVWP  435
            ++   V+ V +++ Y LHTTRTPEFLGL   DA F       S + ++VIVG+LDTGVWP
Sbjct  93   KQQPGVLSVLQENRYELHTTRTPEFLGLGRSDALF-----PASDKLSEVIVGVLDTGVWP  147

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ESKS+DD+G+  VP+ W+G CE   NF+  + CN KLIGAR+++
Sbjct  148  ESKSYDDAGLRRVPSSWKGECEVGKNFN-SSSCNMKLIGARYFS  190



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 107/161 (66%), Gaps = 3/161 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM     P+ F  H  WY + L+S   S  +LYTY +  HG++  L ADE + L
Sbjct  28   KKTYIIHMDKFNMPADFDDHTQWYDSSLKSVSKSANMLYTYNSVIHGYSTQLTADEAKAL  87

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V+E+ +Y LHTTR+P FLGL+          +   ++VI+G+LDTGVWPESK
Sbjct  88   AQQPGILLVHEEVIYELHTTRSPTFLGLEGRESRSFFPQTEARSEVIIGVLDTGVWPESK  147

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+  VPA W+G+C++  NFD  + CN+KLIGARF++
Sbjct  148  SFDDTGLGQVPASWKGKCQTGKNFD-ASSCNRKLIGARFFS  187



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 112/185 (61%), Gaps = 9/185 (5%)
 Frame = +1

Query  28   FSAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
             S  +ILL    H+ R   AT    K TYIVHM   E P+SF+ H  WY + L+S  DS 
Sbjct  11   ISLFSILLLGVCHVSRATLATNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSA  70

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY  A HGF+  L   E + L     ++ V  +  Y LHTTRTPEFLGLD    L 
Sbjct  71   QMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGLDKSADLL  130

Query  370  AGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLI  549
                S   ++VI+G+LDTGVWPESKSF D+G   VP+ W+G CES  NF  K +CN+KLI
Sbjct  131  PQ--SDSVSEVIIGVLDTGVWPESKSFLDTGFGPVPSSWKGECESGTNFTTK-NCNRKLI  187

Query  550  GARFY  564
            GARF+
Sbjct  188  GARFF  192



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 12/180 (7%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL+  +  C A++++ K TYIVHM   E P SF+ H  WY + LQS  DS  ++YTY  A
Sbjct  13   ILVLFMGLCDASSSL-KSTYIVHMAKSEMPESFEHHTLWYESSLQSVSDSAEMMYTYENA  71

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E   L     ++ V  +  Y LHTTRTP+FLGLD    +      PE++
Sbjct  72   IHGFSTRLTPEEARLLESQTGILAVLPEVKYELHTTRTPQFLGLDKSADM-----FPESS  126

Query  397  ---DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
               +V+VG+LDTGVWPESKSF+D+G   +P  W+G CES  NF    +CNKKLIGARF++
Sbjct  127  SGNEVVVGVLDTGVWPESKSFNDAGFGPIPTTWKGACESGTNFT-AANCNKKLIGARFFS  185



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 111/179 (62%), Gaps = 10/179 (6%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL   LR  +++++  + TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  15   ILCLGLRHVSSSSSNEQGTYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENA  74

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSP  387
             HGFA  L  DE + L     V+ V  +  Y LHTTRTP FLGLD   A+     G    
Sbjct  75   IHGFATRLTQDEADSLMTQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTG----  130

Query  388  EAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             + DV+VG+LDTGVWPESKS+ D G   VP+ W+G CE+  NF   +HCN+KLIGARF+
Sbjct  131  ASTDVVVGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFT-ASHCNRKLIGARFF  188



>ref|XP_010527146.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=727

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 116/187 (62%), Gaps = 7/187 (4%)
 Frame = +1

Query  16   SLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            SL   +  +++LHL      +A A   + TYIVHM   + P+SF  H  WY + L+S  D
Sbjct  6    SLTVLTVFSLVLHLGFCHVSSAPAGHGRATYIVHMARSQMPASFDRHSHWYDSSLRSVSD  65

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  LLYTY  A HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD +  
Sbjct  66   SAELLYTYDNAIHGFSTRLTPEEADSLAGQPGVISVLPELRYELHTTRTPLFLGLDHDAD  125

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            +     S  A+DV+VG+LDTG+WPESKSFDD+G   VP+ W+G CE+  NF   ++CN+K
Sbjct  126  MFPQADS--ASDVVVGVLDTGIWPESKSFDDTGFGPVPSGWKGACETGTNFS-ASNCNRK  182

Query  544  LIGARFY  564
            LIGARF+
Sbjct  183  LIGARFF  189



>ref|XP_008367646.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 6/163 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVE  258
            AKKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E  
Sbjct  33   AKKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAG  92

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPE  438
             L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWPE
Sbjct  93   LLEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLPA--TDKASDLIVGVVDTGVWPE  150

Query  439  SKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
             KS+DD+G+ AVP+ W+G CE   NF+  + CN+KLIGARF++
Sbjct  151  IKSYDDTGLAAVPSGWKGVCEEGTNFN-SSSCNRKLIGARFFS  192



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 106/161 (66%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM   + P++FQ H  WY + L+S   S  ++Y+Y T  HGF+A L A+E   L
Sbjct  37   RRTYIVHMAKSQMPAAFQHHAHWYDSSLKSVSGSAQMIYSYDTVVHGFSARLTAEEAGSL  96

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 ++ V  +  Y LHTTRTPEFLGLD    L     S    +V+VG+LDTGVWPESK
Sbjct  97   EARHGILAVMPELRYELHTTRTPEFLGLDKSSSLLPA--SESVNEVVVGVLDTGVWPESK  154

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+ AVP+ WRG CES  NF    +CN+KLIGARF++
Sbjct  155  SFDDTGLGAVPSGWRGACESGTNFT-AANCNRKLIGARFFS  194



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 114/188 (61%), Gaps = 9/188 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWI----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L A+E +RL     ++ V  +  Y LHTTR+PEFLGLD    
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRLEAQPGILAVVPEMRYELHTTRSPEFLGLDKNAN  116

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
            L     S   ++VI+G+LDTG+ PESKSFDD+G+  VP+ W+G CES  NF   ++CN+K
Sbjct  117  LYPESNS--VSEVIIGVLDTGISPESKSFDDTGLGPVPSSWKGECESGTNFS-ASNCNRK  173

Query  544  LIGARFYT  567
            L+GARF++
Sbjct  174  LVGARFFS  181



>emb|CDX75758.1| BnaC03g38410D [Brassica napus]
Length=305

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVH+ H  KPS F THR WY + L S  S  S+++TY T +HGF+A L A +  +L  
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLASLTSTPSIIHTYDTVFHGFSARLTAQDATQLLN  84

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSF  450
               V+ V  + V  +HTTR+PEFLGL +    G    S   +D+++G++DTG+WPE  SF
Sbjct  85   HPHVISVIPEQVRHVHTTRSPEFLGLRSTDKAGLLEESDFGSDLVIGVIDTGIWPERPSF  144

Query  451  DDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DD G+  VPA+W+G+CE + +F P T CN+KL+GARF+
Sbjct  145  DDRGLGPVPAKWKGQCEPSQDF-PATACNRKLVGARFF  181



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 107/166 (64%), Gaps = 15/166 (9%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L   E E L
Sbjct  32   KSTYIVHVAKSQMPESFEDHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTIQEAESL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLGAGHGSPEA---ADVIVGILDTGV  429
             R   ++ V  +  Y LHTTRTP FLGLD  A+F        PE+   +DV+VG+LDTGV
Sbjct  92   ERQSGILSVLPELRYELHTTRTPSFLGLDRSADF-------FPESNAMSDVVVGVLDTGV  144

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            WPESKSFDD+G+  +P  W+G CES  NF   ++CN+KLIGAR+++
Sbjct  145  WPESKSFDDTGLGPIPDSWKGECESGTNFS-SSNCNRKLIGARYFS  189



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 114/192 (59%), Gaps = 10/192 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLR---PCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHL  174
            M SL   +   ++LHL     P AAT    ++  TYIVHM   + P+SF  H  WY + L
Sbjct  1    MTSLTSLAVFLLVLHLGLYHVPSAATGDGRQRRATYIVHMARSQMPASFDHHSHWYDSSL  60

Query  175  QSSEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            +S  DS  LLYTY  A HGF+  L  +E E L     V+ V  +  Y LHTTRTP FLGL
Sbjct  61   RSVSDSAELLYTYDNAIHGFSTRLTPEEAESLTGQPGVISVLPELRYELHTTRTPLFLGL  120

Query  349  DAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
            D    L     S  A DV+VG+LDTGVWPESKSFDDSG   VP+ W+G CE+  NF   +
Sbjct  121  DHNADLFPQ--SDSATDVVVGVLDTGVWPESKSFDDSGFGPVPSGWKGACETGTNFS-AS  177

Query  529  HCNKKLIGARFY  564
             CN KLIGARF+
Sbjct  178  SCNHKLIGARFF  189



>ref|XP_010923357.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=780

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 114/184 (62%), Gaps = 19/184 (10%)
 Frame = +1

Query  61   RPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----------------S  192
            +P   T+  A  TYI+H  +  +P    T   WY++ LQS                   +
Sbjct  34   QPDITTSGTAATTYIIHTDNFSRPPHLATQIQWYSSILQSLSSTNTTTTTTTSVKTHSHN  93

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            ++YTY T  HGFAA L ++E E++  +  VVGVY+D++  LHTTR+P+FLGL+ +FGL  
Sbjct  94   IIYTYDTILHGFAAILSSEEAEKVSEIPGVVGVYKDTIKQLHTTRSPDFLGLNHDFGLWP  153

Query  373  GHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIG  552
                 E  DVI+G++D+G+WPES+SFDD G+  VP+RW+G CES   F P + CNKKLIG
Sbjct  154  ESNFGE--DVIIGLVDSGIWPESESFDDDGLPEVPSRWKGECESGERFSP-SLCNKKLIG  210

Query  553  ARFY  564
            AR++
Sbjct  211  ARWF  214



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 107/170 (63%), Gaps = 11/170 (6%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            A A   + TYIVHM     P++F  H +WY A L+S  DS  +LY Y T  HGF+A L  
Sbjct  27   AAAKEKRVTYIVHMAKSRMPATFTEHGNWYDASLRSVSDSAKILYLYDTVAHGFSARLTP  86

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGIL  417
             E + L  L+ V+ V  +  Y LHTTRTPEFLGLD   GL      P+A   +DV+VG+L
Sbjct  87   AEAQALESLDGVLCVLAEVRYELHTTRTPEFLGLDKSDGL-----VPQANTASDVVVGVL  141

Query  418  DTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DTGVWPE KSFDD+G   VPA W+G CE   +F   T CN+KLIGARF++
Sbjct  142  DTGVWPERKSFDDTGFGPVPAGWKGACEEGKDFK-ATSCNRKLIGARFFS  190



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 107/165 (65%), Gaps = 11/165 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            +KKTYI+HM     P SF  H  WY + L+S  +S  +LYTY T  HGF+  L  +E E 
Sbjct  10   SKKTYIIHMDKANVPESFDDHLQWYDSALKSVSESADILYTYNTVIHGFSTRLTPEEAEL  69

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVW  432
            L +   ++ V  + VY LHTTRTPEFLGL   DA F       S    +V+VG+LDTGVW
Sbjct  70   LEKQGGILSVVPEMVYELHTTRTPEFLGLGKNDAVF-----PASDSVGEVVVGVLDTGVW  124

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PE KSFDD+G+  +P+ W+G CE+  NF+  ++CN+KL+GAR+++
Sbjct  125  PELKSFDDTGLGPIPSTWKGTCETGTNFN-SSNCNRKLVGARYFS  168



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 112/185 (61%), Gaps = 9/185 (5%)
 Frame = +1

Query  28   FSAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
             S  +ILL    H+ R   A+    K TYIVHM   E P+SF+ H  WY + L+S  DS 
Sbjct  11   ISLFSILLLGVCHVSRATLASNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSA  70

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY  A HGF+  L   E + L     ++ V  +  Y LHTTRTPEFLGLD    L 
Sbjct  71   QMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGLDKSADLL  130

Query  370  AGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLI  549
                S   ++VI+G+LDTGVWPESKSF D+G   VP+ W+G CES  NF  K +CN+KLI
Sbjct  131  PQ--SDSVSEVIIGVLDTGVWPESKSFLDTGFGPVPSSWKGECESGTNFTTK-NCNRKLI  187

Query  550  GARFY  564
            GARF+
Sbjct  188  GARFF  192



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 106/170 (62%), Gaps = 11/170 (6%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  243
            +A   + K  +IVHM   + P SF+ H  WY + L+S   S  +LY Y  A HGFAA L 
Sbjct  29   SAGMNMMKSNFIVHMAKSQMPESFEDHTHWYDSSLRSVSGSAEMLYVYNNAVHGFAARLT  88

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGI  414
            A+E E L+    ++ V  +  Y LHTTRTP FLGLD      +    PE+    DVIVG+
Sbjct  89   AEEAESLQNQPGILSVLPEMKYELHTTRTPSFLGLDV-----SADYFPESNAMGDVIVGV  143

Query  415  LDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            LDTGVWPESKSFDD+G   +PA W+G CES  NF  K +CN+KLIGAR++
Sbjct  144  LDTGVWPESKSFDDTGFGPIPASWKGECESGTNFTSK-NCNRKLIGARYF  192



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL--LYTYTTAYHGFAAALGADEVERL  264
            K TYI+HM     P SF  H  WY + L+S  DS   LYTY    HGF+  L   E E L
Sbjct  36   KNTYIIHMDKFNMPESFNDHLHWYDSSLKSVSDSAERLYTYKKVAHGFSTRLTTQEAELL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   V+ V  +  Y LHTTRTPEFLGL     L    G  + +DVIVG+LDTGVWPE K
Sbjct  96   SKQPGVLSVIPEVRYELHTTRTPEFLGLAKYTTLSLASG--KQSDVIVGVLDTGVWPELK  153

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+  VP+ W+G CE   NF P ++CNKKL+GARF++
Sbjct  154  SFDDTGLEPVPSSWKGECERGKNFKP-SNCNKKLVGARFFS  193



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 116/184 (63%), Gaps = 7/184 (4%)
 Frame = +1

Query  22   VWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--L  195
            ++   +++LL L   C A++++ K TYIVHM   E P SF  H  WY + LQS  +S  +
Sbjct  8    IFLIVLSVLL-LTNLCDASSSL-KSTYIVHMAKSEMPESFDHHTMWYESSLQSVSESAEM  65

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTY  A HG++  L A+E   L     ++ V  +  Y LHTTRTP FLGLD    +   
Sbjct  66   LYTYENAIHGYSTRLTAEEARLLESQTGILAVVPEVKYELHTTRTPLFLGLDKSADMFPE  125

Query  376  HGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGA  555
              S   ++V++G+LDTGVWPESKSFDD+G   VPA W+G CE+  NF   ++CNKKLIGA
Sbjct  126  SNS--GSEVVIGVLDTGVWPESKSFDDTGFGPVPASWKGACETGTNFT-TSNCNKKLIGA  182

Query  556  RFYT  567
            R+++
Sbjct  183  RYFS  186



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 114/192 (59%), Gaps = 17/192 (9%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLINPENQEDGG  74

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  ++YTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  75   EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEPH  134

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
                  +   +     DVIVG+LDTGVWPES+SF+D+GMT VPA W+G CE+  +F  K+
Sbjct  135  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVPAHWKGACETGRSFT-KS  193

Query  529  HCNKKLIGARFY  564
            +CNKK++GAR +
Sbjct  194  NCNKKIVGARIF  205



>ref|XP_008393753.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 108/162 (67%), Gaps = 6/162 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWPE 
Sbjct  94   LEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLPA--TDKASDLIVGVVDTGVWPEI  151

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KS+DD+G+ AVP+ W+G CE   NF+  + CN+KLIGARF++
Sbjct  152  KSYDDTGLAAVPSGWKGVCEEGTNFN-SSSCNRKLIGARFFS  192



>ref|XP_008351977.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 108/162 (67%), Gaps = 6/162 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWPE 
Sbjct  94   LEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLPA--TDKASDLIVGVVDTGVWPEI  151

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KS+DD+G+ AVP+ W+G CE   NF+  + CN+KLIGARF++
Sbjct  152  KSYDDTGLAAVPSGWKGVCEEGTNFN-SSSCNRKLIGARFFS  192



>ref|XP_009360421.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 6/162 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R +WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFEWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L +   ++ V  +  Y LHTTRTPEFLGL+    L     + +A+D+IVG++DTGVWPE 
Sbjct  94   LEKQLGILSVLPERRYELHTTRTPEFLGLEKSEALLPA--TDKASDLIVGLVDTGVWPEI  151

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KS+DD+G+ AVP+ W+G CE   NF+  + CN+KLIGARF++
Sbjct  152  KSYDDTGLAAVPSGWKGVCEEGTNFN-SSSCNRKLIGARFFS  192



>gb|EYU25025.1| hypothetical protein MIMGU_mgv1a001588mg [Erythranthe guttata]
Length=789

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 109/176 (62%), Gaps = 18/176 (10%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------------SEDSLLYTYTTA  216
            +K TYI++M    KP  F  H+ WY++ ++S                  +D ++Y+Y TA
Sbjct  34   SKNTYIIYMDKLAKPEEFSDHKQWYSSLIKSVTTKTDEYDEKTGEYENDDDRIIYSYETA  93

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HG AA L  DEVE+L+    V  V+ ++VY LHTTR+P FLGLD E    A        
Sbjct  94   FHGVAARLNGDEVEKLQGQNGVTAVFPETVYQLHTTRSPMFLGLDREDSTSAFSDKLSDY  153

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DV+VG+LDTG+WPES SF+D+GMT +PA W+G CE+   F  K+HC++K++GAR +
Sbjct  154  DVVVGVLDTGIWPESPSFNDTGMTRIPAHWKGTCETGRGF-AKSHCSRKIVGARVF  208



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (59%), Gaps = 17/192 (9%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +Q+            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQAVLIKPDNQEDGG  74

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  +LYTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  75   EDQQRVLYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEQH  134

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
                  +   +     DVIVG+LDTGVWPES+SF+D+GMT VPA W+G CE+   F  K+
Sbjct  135  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVPAHWKGACETGRGFT-KS  193

Query  529  HCNKKLIGARFY  564
            +CNKK++GAR +
Sbjct  194  NCNKKIVGARIF  205



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 102/169 (60%), Gaps = 5/169 (3%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  240
            C++  A  K TYIVHM     P SF  HR WY A L+S   S  +LY Y T  HGF+A L
Sbjct  18   CSSAVAAKKPTYIVHMAKSRMPPSFAEHRHWYDASLRSVSGSAEVLYFYDTVAHGFSARL  77

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILD  420
               E   L R   V+ V  ++ Y LHTTRTPEFLGLD   G G    S    DV+VG+LD
Sbjct  78   TPAEARALARRYGVLSVEPETRYELHTTRTPEFLGLDR--GGGFVTSSDSDGDVVVGVLD  135

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGAR-FY  564
            TGVWPE KSFDD+G   VPA W+G CE   +F P   CN+KL+GAR FY
Sbjct  136  TGVWPERKSFDDAGFGPVPASWKGGCEEGKDFVPAAACNRKLVGARSFY  184



>emb|CDY43570.1| BnaC02g16670D [Brassica napus]
Length=196

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 107/182 (59%), Gaps = 13/182 (7%)
 Frame = +1

Query  40   TILLHLLRP--CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTY  207
            TILL +L P  C  +      TYIVHM   + PS F  H  WY + L++   S  LLYTY
Sbjct  14   TILL-VLHPGFCHVSDGAQHATYIVHMAQSQMPSGFDLHSLWYDSSLRTVSQSAQLLYTY  72

Query  208  TTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
              A HGF+  L  +E + L  L  V+ V  +  Y LHTTRTP FLGL    G+      P
Sbjct  73   ANAIHGFSTRLTPEEADSLMTLPGVISVLPEHRYELHTTRTPLFLGL----GVHNADLFP  128

Query  388  EAA---DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGAR  558
            E     DV+VG+LDTGVWPESKSF D G+  +P+ WRG CE+  NF   + CN+KLIGAR
Sbjct  129  ETGSSLDVVVGVLDTGVWPESKSFSDVGLGPIPSTWRGGCEAGTNFT-ASLCNRKLIGAR  187

Query  559  FY  564
            F+
Sbjct  188  FF  189



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (59%), Gaps = 17/192 (9%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  78   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLIKPENQEDGG  137

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  ++YTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  138  EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEPH  197

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
                  +   +     DVIVG+LDTGVWPES+SF+D+GMT VPA W+G CE+   F  K+
Sbjct  198  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVPAHWKGACETGRGFT-KS  256

Query  529  HCNKKLIGARFY  564
            +CNKK++GAR +
Sbjct  257  NCNKKIVGARIF  268



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 104/167 (62%), Gaps = 5/167 (3%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  243
            A T    KKTYIVHM   + P+SF+ H  WY + L+S   S  +LY Y  A HGF+  L 
Sbjct  2    ATTQKQDKKTYIVHMAKSQMPASFEQHVHWYDSSLKSVSGSAQMLYFYDNAIHGFSTRLT  61

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDT  423
             +E E L     ++ V  +  Y LHTTR+PEFLGLD    +     S    DVI+G+LDT
Sbjct  62   PEEAELLENQPGILSVLPELRYELHTTRSPEFLGLDKSADMFPQ--SDSVGDVIIGVLDT  119

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            GVWPESKSF D+G+  VPA W+G+CES  NF    +CN+KLIGARF+
Sbjct  120  GVWPESKSFADTGLGPVPATWKGQCESGTNFT-SANCNRKLIGARFF  165



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L
Sbjct  30   QGTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPES  441
                 V+ V  +  Y LHTTRTP FLGLD    GL    G+  A+DV++G+LD+GVWPES
Sbjct  90   MTQPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGA--ASDVVIGVLDSGVWPES  147

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            KSF D G   VP  W+G CE+  NF   +HCN+KLIGARF+
Sbjct  148  KSFSDEGYGPVPTTWKGECEAGTNFT-ASHCNRKLIGARFF  187



>ref|XP_004976550.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=777

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 114/199 (57%), Gaps = 17/199 (9%)
 Frame = +1

Query  13   GSLVWFSAITILLHL---LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA-----  168
            GS  W  A+ + L L   L+ C +  A A KTYIV M   E PSSF  H +WYA+     
Sbjct  4    GSTRW-RALPLCLALAVALQACLSACAPAPKTYIVQMAASEMPSSFDFHHEWYASTVKSV  62

Query  169  ---HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTR  327
                L+  ED     ++Y Y TA+HGFAA L  DE ER+   + VV V  D+V  LHTTR
Sbjct  63   SSVQLEGEEDDPFARIVYNYETAFHGFAAKLDEDEAERMADADGVVAVLPDTVLQLHTTR  122

Query  328  TPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESA  507
            +P+FLG+  E             DV+VG+LDTG+WPES SF D G+  VPA+W+G C++ 
Sbjct  123  SPDFLGISPEISNSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVPAKWKGLCQTG  182

Query  508  PNFDPKTHCNKKLIGARFY  564
              F     CN+K+IGAR +
Sbjct  183  RGFT-TASCNRKVIGARIF  200



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 9/166 (5%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHL------QSSEDSLLYTYTTAYHGFAAALGA  246
            + K++YIV+M    KP  F  H+ WY + +       S   ++LYTY T  HGFAA L +
Sbjct  40   ITKQSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTS  99

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTG  426
             E + +   +  + V+ D VY +HTTRTP+FLGL +  GL     S  A D+IVG+LDTG
Sbjct  100  TEAQAMENTDGCLAVFPDYVYRVHTTRTPDFLGLSSSHGLWPL--SHYADDIIVGVLDTG  157

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +WPESKSF D G+T VPARW+G CE    F+  +HCN KLIGARF+
Sbjct  158  IWPESKSFSDQGLTQVPARWKGECEMGTEFN-ASHCNNKLIGARFF  202



>gb|EPS59495.1| hypothetical protein M569_15309, partial [Genlisea aurea]
Length=736

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = +1

Query  100  YIVHMKHHEKPSSF-QTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            +IVHM H + P +F   H DWY + L+S  +S  ++Y YT+  HG++A + A E   L +
Sbjct  1    FIVHMDHSDMPEAFIDNHLDWYGSSLRSVSESANMIYAYTSVVHGYSARMTAAEANLLEK  60

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSF  450
               V+ V ED VY +HTTR+PEFLGL    G  A  GSP   DV+VG+LDTGVWPESKS+
Sbjct  61   QPGVLLVQEDMVYDVHTTRSPEFLGLLGNEGSTAVSGSP-IGDVVVGVLDTGVWPESKSY  119

Query  451  DDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DD+G+  +PA W+G CE + +F+  + CN+KLIGARF++
Sbjct  120  DDAGLGPIPASWKGGCELSRSFN-SSSCNRKLIGARFFS  157



>ref|XP_010693651.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 14/194 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  180
            W   I I+L  L   + ++   K TYIV M +   P  F  H DWY++ + S        
Sbjct  11   WNFIIFIILCSLLSFSFSSTSTKNTYIVQMDNSAMPLVFNNHLDWYSSKINSIVAQNLTT  70

Query  181  ---SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD  351
               +E  ++YTY  A+HG AA L  +E  +L +   VV ++ ++VY LHTTR+P FLGL+
Sbjct  71   TNNAEQRIMYTYKNAFHGLAAQLTEEEASKLGQHHGVVTLFPETVYHLHTTRSPMFLGLN  130

Query  352  AE---FGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
             E                DV+VG+LDTG+WPES SF+DSG+  +PARW+G CE    FDP
Sbjct  131  REEVYLDKARTRAQTRHYDVVVGVLDTGIWPESPSFNDSGLGPIPARWKGACERGRGFDP  190

Query  523  KTHCNKKLIGARFY  564
              HCNKK++GAR +
Sbjct  191  ARHCNKKIVGARVF  204



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 108/172 (63%), Gaps = 11/172 (6%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------SEDSLLYTYTTAYHGF  228
            A ++  ++TYIVH+   +KPS F TH  WY++ L+S            L+YTY  A HGF
Sbjct  22   AASSDGRETYIVHVAKAQKPSVFPTHHHWYSSILRSLSPLSAHHPPTKLIYTYDHAVHGF  81

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            +A L + +   LRR   V+ V  DSV  LHTTRTP FLGLD  FG+     S  A D+IV
Sbjct  82   SARLTSSQAAELRRRRCVLSVVPDSVRQLHTTRTPHFLGLDDFFGIWP--NSDYAEDIIV  139

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             +LDTG+WPE  SF D G++ VP+ W+G CE+ P+F P T CNKK+IGAR Y
Sbjct  140  AVLDTGIWPERPSFSDEGLSPVPSSWKGVCETGPDF-PPTSCNKKIIGARAY  190



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRTPEFLGLD    L    G+    DV+VG+LDTGVWPE  
Sbjct  93   ESQPGVIVVNPEVRYELHTTRTPEFLGLDGTDALFPQSGT--GTDVVVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G   VPA W+G+CE   +F+  + CNKKLIGARF+
Sbjct  151  SYDDTGFGPVPAGWKGKCEDGNDFN-ASACNKKLIGARFF  189



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 105/164 (64%), Gaps = 11/164 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM    +PS+F  H  WY A L+S   S  +LY+Y T  HGF+A L   E + L
Sbjct  32   RQTYIVHMAKSRRPSTFAEHGHWYDASLRSVSSSAEILYSYDTVAHGFSARLTTAEAQAL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
              L+ V+ V  +  Y LHTTRTPEFLGLD    L      P+A   +DV+VG+LDTGVWP
Sbjct  92   ESLDGVLSVLPEVRYELHTTRTPEFLGLDKSDDL-----VPQANTGSDVVVGVLDTGVWP  146

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            E KSFDD+G   VPA W+G CE   +F   T CN+KLIGARF++
Sbjct  147  ERKSFDDAGFGPVPAGWKGACEEGKDFK-ATDCNRKLIGARFFS  189



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRTPEFLGLD    L    G+    DV+VG+LDTGVWPE  
Sbjct  93   ESQPGVIVVNPEVRYELHTTRTPEFLGLDGTDALFPQSGT--GTDVVVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G   VPA W+G+CE   +F+  + CNKKLIGARF+
Sbjct  151  SYDDTGFGPVPAGWKGKCEDGNDFN-ASACNKKLIGARFF  189



>ref|XP_003547873.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=776

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = +1

Query  28   FSAITILLHLL---RPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDS  192
            F ++ IL  LL     C+ +     KT+IV + H  KPS F TH+ WY + L S  +  S
Sbjct  4    FGSLVILPFLLIATVTCSTSEKENSKTFIVQVHHQTKPSIFPTHKHWYDSSLSSISTTAS  63

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            +++TY T +HGF+A L   E ++L+ L  V+ +  + + SLHTTR+PEFLGL      G 
Sbjct  64   VIHTYDTVFHGFSAKLSPSEAQKLQSLGHVITLIPEQLRSLHTTRSPEFLGLTTADRTGL  123

Query  373  GHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIG  552
             H +   +D+++G++DTG+WPE +SF+D  +  VPA+WRG+C +  NF P T CN+KLIG
Sbjct  124  LHETDFGSDLVIGVIDTGIWPERQSFNDRDLGPVPAKWRGKCVAGQNF-PATSCNRKLIG  182

Query  553  ARFYT  567
            AR+++
Sbjct  183  ARWFS  187



>ref|XP_004510560.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=789

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVER  261
            KKT+I+ ++H  KPS F TH++WY + L S   ++D++++TY T +HGF+A L A EVE+
Sbjct  35   KKTFIIQVQHQSKPSIFPTHKNWYQSSLSSITKTQDTIIHTYDTVFHGFSAKLTALEVEK  94

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L+ L  V+ V  + + +LHTTR+P+FLGL      G  H +   +D+++G++DTG+WPE 
Sbjct  95   LQSLSHVITVIPEQIRTLHTTRSPQFLGLKTADRAGLLHETDFGSDLVIGVIDTGIWPER  154

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +SF+D  +  +P++W+G C +  +F P + CN+K+IGA++++
Sbjct  155  QSFNDRDLAPIPSKWKGHCVAGRDF-PASSCNRKIIGAKYFS  195



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 103/164 (63%), Gaps = 11/164 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM   + P +F  H  WY A L+S  +S  ++Y Y    HGFAA L A E E L
Sbjct  37   KKTYIIHMAKSQMPVTFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTAQEAESL  96

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
                 ++ V  + +Y LHTTRTP FLGLD    +      PE+   +DVIVG+LDTGVWP
Sbjct  97   ETQPGILSVLPEVIYQLHTTRTPLFLGLDKSVNI-----FPESDSMSDVIVGVLDTGVWP  151

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            E KSFDD+G   VP  W+G+CES+ NF     CN+KL+GAR+++
Sbjct  152  ERKSFDDTGFGPVPDSWKGQCESSTNFS-SAMCNRKLVGARYFS  194



>gb|EYU21279.1| hypothetical protein MIMGU_mgv1a023973mg, partial [Erythranthe 
guttata]
Length=520

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 114/189 (60%), Gaps = 4/189 (2%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            A+  +   S I      L P +  AA  +KT+IV +KH  KPS F  H +WY + L+S  
Sbjct  2    AISPITTISTIFFCTLFLTPSSIEAAEQRKTFIVRVKHEAKPSVFPNHSNWYESSLRSIS  61

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +   ++++Y T +HGF+A+L A E  +L  L  ++ V  + V  LHTTR+PEFLGL   
Sbjct  62   AASVGVIHSYDTVFHGFSASLSASEAVKLESLPGIIAVIPEQVRQLHTTRSPEFLGLKTG  121

Query  358  FGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCN  537
               G    S   +D+++G++DTG+WPES+SF+D  +   PA+W+G C +  NF P + CN
Sbjct  122  DSAGLLKESDFGSDLVIGVIDTGIWPESESFNDRDLGPAPAKWKGECVAGANF-PASTCN  180

Query  538  KKLIGARFY  564
             KLIGAR++
Sbjct  181  LKLIGARYF  189



>ref|XP_006841997.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
 gb|ERN03672.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
Length=753

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 114/173 (66%), Gaps = 14/173 (8%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQ-THRDWYAAHLQSSEDS--LLYTYTTAYHGFAAA  237
            C+ T  +  KT++VHM     P S+   H+ WY + ++S+  S  +LYTY T  HGFAA 
Sbjct  15   CSPT--LGHKTFLVHMAKSMMPESYNGDHQAWYMSIMKSAVQSTEILYTYDTVLHGFAAR  72

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIV  408
            L  +E E LR+    + VYE++VY LHTTRTPEFLGLD   GL      PE   A DVIV
Sbjct  73   LTDEEAELLRQRPEALSVYEEAVYQLHTTRTPEFLGLDGNNGLW-----PESDYATDVIV  127

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            G+LDTG  PESKS+ D+G+  VP++WRG C++  NFD  + CN+KLIGA+F++
Sbjct  128  GVLDTGASPESKSYVDAGLGPVPSKWRGECQTGKNFD-ASSCNRKLIGAQFFS  179



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 107/165 (65%), Gaps = 11/165 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            +K TYI+HM     P+SF  H  WY + L+S  +S  +LY Y    HGF+  L ++E E 
Sbjct  32   SKNTYIIHMDKSYMPASFDDHLQWYDSSLKSVSESADMLYDYNNVIHGFSTRLTSEEAEL  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVW  432
            L + E ++ V  + +Y LHTTRTPEFLGL   +A F       S   ++V+VG+LDTGVW
Sbjct  92   LEKQEGIISVLPEMIYELHTTRTPEFLGLGKSEAFF-----PTSDSVSEVVVGVLDTGVW  146

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PE+KSFDD+G+  +P  W+G CE+  NF+  + CN+KLIGARF++
Sbjct  147  PEAKSFDDTGLGPIPRTWKGECETGKNFN-SSSCNRKLIGARFFS  190



>gb|EYU44466.1| hypothetical protein MIMGU_mgv1a0020561mg, partial [Erythranthe 
guttata]
Length=293

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 16/176 (9%)
 Frame = +1

Query  67   CAATAAVA-----KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHG  225
            C  +AA A     + TYIVHM   E P  +  H  WY + L+S   S  +LYTYT   HG
Sbjct  25   CHVSAAAAVEEERRGTYIVHMAKSEMPERYDDHTHWYESSLRSVSGSAEMLYTYTNVVHG  84

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---A  396
            F+  L  +E   +     ++ V  ++ Y LHTTRTP FLGLD    +      PE+   +
Sbjct  85   FSTRLTPEEARVMETRPGILSVLPETKYELHTTRTPTFLGLDQNAAM-----FPESDSMS  139

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +VIVG+LDTGVWPES SFDD+G+ +VP  WRG CE+  NF  K++CNKKLIGAR++
Sbjct  140  EVIVGVLDTGVWPESPSFDDAGLGSVPGSWRGECETGTNFT-KSNCNKKLIGARYF  194



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 110/179 (61%), Gaps = 10/179 (6%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL   LR  +++++    TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  15   ILCLGLRHVSSSSSSEHGTYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENA  74

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSP  387
             HGFA  L  DE + L     V+ V  +  Y LHTTRTP FLGLD   A+     G  S 
Sbjct  75   IHGFATRLTQDEADSLMAQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTGASS-  133

Query  388  EAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
               DV+VG+LDTGVWPESKS+ D G   VP+ W+G CE+  NF   +HCN+KLIGARF+
Sbjct  134  ---DVVVGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFT-ASHCNRKLIGARFF  188



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 105/170 (62%), Gaps = 11/170 (6%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            + A V KKTYI+HM   + P+ F  H  WY A L+S  +S  ++Y Y    HGFAA L A
Sbjct  18   SVAMVEKKTYIIHMAKSQMPAIFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTA  77

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGIL  417
             + E L     ++ V  + +Y LHTTRTP FLGLD    +      PE+   +DVIVG+L
Sbjct  78   RQAESLETQPGILSVLPELIYQLHTTRTPLFLGLDRSVNI-----FPESDAMSDVIVGVL  132

Query  418  DTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DTGVWPE KSFDD+G   VP  W+G CES+ NF     CN+KL+GAR+++
Sbjct  133  DTGVWPERKSFDDTGFGPVPDSWKGECESSNNFS-SAMCNRKLVGARYFS  181



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 118/194 (61%), Gaps = 23/194 (12%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------S  183
            W   I++   LL    A    AKKTYI+ M     P SF  H +WY++ ++S        
Sbjct  8    WLVLISLTSCLL--FNAVELSAKKTYIIQMDKSAMPESFSDHLEWYSSKVKSVLMKQSDD  65

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE--  357
            E+ ++Y+Y TA+HG AA L  +E E+L + + V+GV+ ++ Y LHTTR+P FLGLD    
Sbjct  66   EERIIYSYQTAFHGVAAQLSEEEAEKLEQDDDVLGVFPETKYELHTTRSPMFLGLDPRQD  125

Query  358  -----FGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
                   + + H      DV+VG+LDTG+WPES+SF+D+GMT VPA W+G CE+   F  
Sbjct  126  RDNVWSQMLSDH------DVVVGVLDTGIWPESESFNDTGMTPVPAHWKGECETGRGFA-  178

Query  523  KTHCNKKLIGARFY  564
            K HCN+K++GAR +
Sbjct  179  KRHCNRKIVGARMF  192



>gb|AGT16155.1| subtilisin-like protease [Saccharum hybrid cultivar R570]
Length=711

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 113/198 (57%), Gaps = 15/198 (8%)
 Frame = +1

Query  13   GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA------  168
            G + W  A+ + L L  L+ C    A + KTYIV M   E PSSF  H +WYA+      
Sbjct  4    GGIRWKKALPLCLALVALQACLPARAASPKTYIVQMAASEMPSSFDFHHEWYASTVKTVS  63

Query  169  --HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRT  330
               L+   D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR+
Sbjct  64   SVQLEGDADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADGVVTVLPETVLRLHTTRS  123

Query  331  PEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAP  510
            P+FLG+  E             DV+VG+LDTG+WPES SF D G+  VPA+W+G C++  
Sbjct  124  PDFLGISPEISNSIWSAGLTDHDVVVGVLDTGIWPESPSFSDKGLGPVPAKWKGLCQTGR  183

Query  511  NFDPKTHCNKKLIGARFY  564
             F    +CN+K+IGAR +
Sbjct  184  GFT-VANCNRKIIGARIF  200



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM    KP+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  34   RRTYIVHMSRSAKPNDFVEHGEWYAASLQSVSDAATVLYTYDTIVHGYSARLTRAEAEAL  93

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVIVG+LDTGVWPE  
Sbjct  94   ESQPGVLLVNPEVRYELHTTRTPEFLGLDRTDALFPQ--SNTGSDVIVGVLDTGVWPERP  151

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G+  VPA W+G+CE   +F+  + CNKKLIGARF+
Sbjct  152  SYDDAGLGPVPAGWKGKCEEGNDFN-ASACNKKLIGARFF  190



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 106/169 (63%), Gaps = 5/169 (3%)
 Frame = +1

Query  64   PCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAA  237
            P A  +   + TYIVH+   E P SF  H  WY + L+S  +S  ++YTY  A HG+A  
Sbjct  56   PAAQASEPERATYIVHVAKSEMPQSFDHHAMWYESSLKSVSNSAQMIYTYDNAIHGYATR  115

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGIL  417
            L  +E   L     ++ V  +  Y LHTTRTP+FLGLD    +     S  A+DV+VG+L
Sbjct  116  LTPEEARLLESQTGILAVLPEMRYELHTTRTPQFLGLDKSADMFPESNS--ASDVVVGVL  173

Query  418  DTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DTGVWPESKSFDD+G+  VP+ W+G CE+  NF   ++CN+KLIGARF+
Sbjct  174  DTGVWPESKSFDDTGLGPVPSSWKGECETGTNFS-TSNCNRKLIGARFF  221



>ref|XP_006579930.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006579931.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006579932.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
Length=755

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   E P SF+ H  WY + L++  DS  ++YTY  A HG+A  L A+E   L
Sbjct  28   KSTYIVHVAKSEMPESFEHHALWYESSLKTVSDSAEIMYTYDNAIHGYATRLTAEEARLL  87

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 ++ V  ++ Y LHTTRTP FLGLD    +     S   +DVI+G+LDTGVWPESK
Sbjct  88   ETQAGILAVLPETRYELHTTRTPMFLGLDKSADMFPESSS--GSDVIIGVLDTGVWPESK  145

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+  VP+ W+G CE+  NF   ++CN+KLIGARF++
Sbjct  146  SFDDTGLGPVPSTWKGACETGTNFT-ASNCNRKLIGARFFS  185



>gb|KJB29423.1| hypothetical protein B456_005G099900 [Gossypium raimondii]
Length=766

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 108/183 (59%), Gaps = 6/183 (3%)
 Frame = +1

Query  22   VWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--L  195
            +  +AI ++L L   C   A  AK+TYIVHM     P  F  H  WY + L+S   S  +
Sbjct  16   IKVAAIVVVLSLCYACV-MAEQAKRTYIVHMDKSNMPECFTHHSLWYDSSLKSVSKSASM  74

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LY Y    HG++A L  +E E L +   V+ V  D  Y LHTTRTPEFLGL     L   
Sbjct  75   LYRYENVIHGYSARLTPEEAESLGKQSGVLSVLPDVRYELHTTRTPEFLGLGNNSALIPT  134

Query  376  HGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGA  555
              S   ++VIVGILDTGVWPE KSFDDS +  VP+ W+G+CE   NF   + CNKKLIGA
Sbjct  135  TAS--TSEVIVGILDTGVWPELKSFDDSELGPVPSGWKGKCEVGQNFS-SSSCNKKLIGA  191

Query  556  RFY  564
            R+Y
Sbjct  192  RYY  194



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 101/161 (63%), Gaps = 10/161 (6%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A HGFA  L  DE + L  
Sbjct  32   TYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFATRLTQDEADSLMA  91

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSPEAADVIVGILDTGVWPES  441
               V+ V  +  Y LHTTRTP FLGLD   A+     G     + DV+VG+LDTGVWPES
Sbjct  92   QPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTG----ASTDVVVGVLDTGVWPES  147

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            KS+ D G   VP+ W+G CE+  NF   +HCN+KLIGARF+
Sbjct  148  KSYSDEGFGPVPSTWKGGCETGTNFT-ASHCNRKLIGARFF  187



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 111/192 (58%), Gaps = 12/192 (6%)
 Frame = +1

Query  10   MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  183
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  184  EDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +S  LLYTY  A HGF+  L   E + L     V+ V  +  Y LHTTRTP FLGLD  
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVH  120

Query  358  FGLGAGHGSPE---AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
                 G   PE   ++DV+VG++DTGVWPE KSF D G   +P+ W+G+CE   NF   +
Sbjct  121  ----NGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIPSTWKGKCEVGTNFT-AS  175

Query  529  HCNKKLIGARFY  564
             CN+KLIGARF+
Sbjct  176  LCNRKLIGARFF  187



>gb|EPS61757.1| hypothetical protein M569_13035, partial [Genlisea aurea]
Length=752

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS------------EDSLLYTYT  210
            C +TA   + TYIV M    KP  F  H  WY++ ++SS            E+ +LYT+ 
Sbjct  4    CGSTA---RNTYIVFMDKSAKPDEFADHSQWYSSMVRSSIASVTPAASEGGEERILYTFG  60

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
            TA+HG A  L  +E+ RL +   VV V+ ++VY LHTTR+P FLGL++E    +      
Sbjct  61   TAFHGVAVQLNEEEIARLGQRNGVVSVFPETVYHLHTTRSPLFLGLESEDSTSSWPTEVS  120

Query  391  AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
              DV+VG+LDTG+WPES SF+D+G+  +PARW+G CE+   F+ K HCN+K++GAR +
Sbjct  121  EYDVVVGVLDTGIWPESPSFNDTGLGPIPARWKGECETGRGFE-KRHCNRKIVGARSF  177



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            A  TYIVHM   E P+SF+ H  WY + L++  DS  ++Y Y+ A HGF+  L  ++ E 
Sbjct  37   ASTTYIVHMAKSEMPASFEHHTHWYDSSLKTVSDSAEMVYIYSNAIHGFSTKLTPEQAES  96

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L+    V+ V  +  Y LHTTRTPEFLGL           S   +DVI+G+LDTGVWPES
Sbjct  97   LQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETIPQSNS--ESDVIIGVLDTGVWPES  154

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            KSFDD+G+  VP  W+G CES  NF+  ++CN+KLIGAR++
Sbjct  155  KSFDDTGLGPVPGSWKGACESGTNFN-SSNCNRKLIGARYF  194



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 111/192 (58%), Gaps = 12/192 (6%)
 Frame = +1

Query  10   MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  183
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  184  EDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +S  LLYTY  A HGF+  L   E + L     V+ V  +  Y LHTTRTP FLGLD  
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVH  120

Query  358  FGLGAGHGSPE---AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKT  528
                 G   PE   ++DV+VG++DTGVWPE KSF D G   +P+ W+G+CE   NF   +
Sbjct  121  ----NGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIPSTWKGKCEVGTNFT-AS  175

Query  529  HCNKKLIGARFY  564
             CN+KLIGARF+
Sbjct  176  LCNRKLIGARFF  187



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + P+SF+ H  WY + L+S  DS  +LYTYT+A HGF+  L  ++   L  
Sbjct  40   TYIVHMAKSQMPASFEHHTHWYDSSLKSVSDSAEMLYTYTSAIHGFSTRLTPEQAASLSS  99

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSF  450
               V+ V  +  Y LHTTRTPEFLGL           S  A DVI+G+LDTGVWPESKSF
Sbjct  100  QPGVLSVLPELKYELHTTRTPEFLGLGQT--TETMPQSDSAGDVIIGVLDTGVWPESKSF  157

Query  451  DDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DD+G   VP+ W G CES  NF+  ++CN+KLIGAR++
Sbjct  158  DDTGFGPVPSSWNGTCESGTNFN-SSNCNRKLIGARYF  194



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 103/161 (64%), Gaps = 7/161 (4%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----SLLYTYTTAYHGFAAALGADEVER  261
            KT+IVH+   +KP+ F +HR WY + +QS        LLYTY  A HGF+AAL + +  +
Sbjct  32   KTFIVHVSKSDKPALFSSHRSWYTSIIQSLPSPHPTKLLYTYDRAVHGFSAALTSSQATQ  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L    AV+ V  D    LHTT TP FLGL   FGL     S  A DVIVG+LDTG+WPE 
Sbjct  92   LLSHPAVLSVTPDQPRQLHTTHTPSFLGLAESFGLWPN--SDYADDVIVGVLDTGIWPER  149

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             SF DSG+  VP+RW+G C SAP+F P + CN+K+IGAR Y
Sbjct  150  PSFSDSGLGPVPSRWKGTCVSAPDF-PSSSCNRKIIGARAY  189



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLR  267
            +TYIVHM H   P  F  H DWYA+ LQS  DS  +LYTY T  HG++A L   E E L 
Sbjct  32   RTYIVHMSHSAMPDGFAEHGDWYASSLQSVSDSAAVLYTYDTLLHGYSARLTRAEAEALE  91

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF-GLGAGHGSPEAADVIVGILDTGVWPESK  444
                V+ V  ++ Y LHTTRTPEFLGLD     L    G+  A+DV+VG+LDTGVWPE  
Sbjct  92   AQPGVLLVNPETRYELHTTRTPEFLGLDGRTDALFPQSGT--ASDVVVGVLDTGVWPERA  149

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G   VP  W+G+CE   +F+  + CNKKLIGARF+
Sbjct  150  SYDDAGFGPVPTGWKGKCEEGNDFN-ASACNKKLIGARFF  188



>ref|XP_010105479.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04835.1| Subtilisin-like protease [Morus notabilis]
Length=776

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 6/161 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM    KP+ F  H +WY + L+S  DS  +LYTY    HGF+  +  +E   L
Sbjct  35   KRTYIIHMDKSNKPAVFDDHVNWYDSSLKSVSDSAEMLYTYDNVIHGFSTRITEEEAHLL  94

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 VV V  ++ Y LHTTRTP+FLGL   + L A   S +A+DVI+G+LDTGVWPE +
Sbjct  95   NNQPGVVSVIPETRYELHTTRTPDFLGLKESYSLIAA--SDKASDVIIGVLDTGVWPEIE  152

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGAR-FY  564
            S+DD G+  VP  W+G+CE+  NF+  + CN+KLIGAR FY
Sbjct  153  SYDDKGLGPVPKSWKGKCEAGKNFN-SSSCNRKLIGARSFY  192



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 118/197 (60%), Gaps = 16/197 (8%)
 Frame = +1

Query  13   GSLVW-FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            G L W F  +T  L  +     +  + ++TYI+ M  + KP SF  H +WY++ +QS   
Sbjct  4    GPLRWLFFIVTSYLAFI--VVLSYPLNRQTYIIQMDKYAKPESFSNHLEWYSSKVQSVLS  61

Query  181  ---------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTP  333
                     +++ ++Y+Y T +HG AA L  +E +RL   + VV ++ ++ Y +HTTR+P
Sbjct  62   KSEHEADTDNDERIIYSYQTVFHGVAAKLSEEEAKRLEEADGVVAIFPETKYQIHTTRSP  121

Query  334  EFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPN  513
             FLGL+ +        +    DVIVG+LDTG+WPES SF+D+GMT VPA W+G CE+   
Sbjct  122  MFLGLEPQDSTSVWSQTIADHDVIVGVLDTGIWPESASFNDTGMTTVPAHWKGTCETGRG  181

Query  514  FDPKTHCNKKLIGARFY  564
            F  K HCNKK++GAR +
Sbjct  182  FG-KHHCNKKIVGARVF  197



>ref|NP_001049524.2| Os03g0242900 [Oryza sativa Japonica Group]
 gb|ABF94911.1| subtilisin proteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ26232.1| hypothetical protein OsJ_10100 [Oryza sativa Japonica Group]
 dbj|BAH01390.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF11438.2| Os03g0242900 [Oryza sativa Japonica Group]
Length=780

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 12/167 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYA-AHLQSSEDSL----LYTYTTAYHGFAAALGADE  252
            A+KTYI  + H  KPS F +H  WY+ A   S  D      L+ Y T +HGFAA++ A  
Sbjct  32   ARKTYIFRVDHSAKPSVFPSHAHWYSSAAFASGADGAPLEPLHVYDTVFHGFAASVPASR  91

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDTG  426
             + LRR  AV+  +ED V +LHTTR+P+FLGL A  GL   A +GS    DV+VG+LDTG
Sbjct  92   ADALRRHPAVLAAFEDQVRTLHTTRSPQFLGLRARLGLWSLADYGS----DVVVGVLDTG  147

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPE +S  D  +  VP+RWRG C++ P F P + CN+KL+GARF++
Sbjct  148  VWPERRSLSDRNLPPVPSRWRGGCDAGPGF-PASSCNRKLVGARFFS  193



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 8/164 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-----LLYTYTTAYHGFAAALGADEV  255
            ++TYIVHM     P+ +  H +WY A L+S   S     +LY Y T  HGF+A L   E 
Sbjct  25   RRTYIVHMAKSAMPAEYADHAEWYGASLRSVSASASAAKMLYAYDTVLHGFSARLTPQEA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWP  435
              L   E V+ V  ++ Y LHTTRTPEFLG+  + GL    G+  A DV+VG+LDTGVWP
Sbjct  85   SDLASAEGVLAVNPEARYELHTTRTPEFLGIAGQ-GLSPQSGT--AGDVVVGVLDTGVWP  141

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ESKS+DD+G+  VPA W+G+CE+ P FD    CN+KL+GARF++
Sbjct  142  ESKSYDDAGLAEVPAWWKGQCEAGPGFDASAACNRKLVGARFFS  185



>gb|KJB34441.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=505

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 13/172 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGF  228
            + KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG 
Sbjct  29   LIKKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGV  88

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            AA L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIV
Sbjct  89   AAQLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIV  148

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            G+LDTG+WPES SF+D+GMT VPA W+G CE+   F  K HCN+K++GAR +
Sbjct  149  GVLDTGIWPESASFNDTGMTPVPAHWKGTCETGRGFQ-KHHCNRKIVGARVF  199



>ref|XP_004501532.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM     P+SF  H  WY + L+S  +S  +LYTY    HGF+  L   E E L
Sbjct  41   KRTYIIHMDKFNMPTSFNDHLQWYDSSLKSVSESAEMLYTYKHVAHGFSTRLTTQEAELL  100

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  +  Y LHTTRTPEFLGL+    L   +G  + ++VIVG++DTGVWPE K
Sbjct  101  TKQPGILSVIPEVRYELHTTRTPEFLGLEKTTTLLVSYG--KQSEVIVGVIDTGVWPELK  158

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+ +  VP+ W+G CE+  NF+  ++CNKKL+GARF+
Sbjct  159  SFDDTKLGPVPSSWKGECETGKNFN-SSNCNKKLVGARFF  197



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 116/187 (62%), Gaps = 12/187 (6%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------S  183
            +TI L L    +A A  AKKTYI+ M  + KP +F +H +WY + ++S            
Sbjct  14   VTIFLLLCILSSANAEFAKKTYIIQMDKYAKPDTFSSHIEWYTSKVKSILSISVEAEMEK  73

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            E+ ++YTY TA+HG AA L  +E ERL   E VV ++ D+ Y LHTTR+P FLGL+    
Sbjct  74   EERIIYTYQTAFHGMAAKLSREEAERLEAEEGVVAIFPDTKYQLHTTRSPTFLGLEPAQS  133

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
                  +    DV VG+LDTG+WPES+SF+D+GM +VP+ W+G CE+   F  K HCNKK
Sbjct  134  TKVWSETLANYDVTVGVLDTGIWPESESFNDTGMRSVPSHWKGACETGRGF-AKYHCNKK  192

Query  544  LIGARFY  564
            ++GAR +
Sbjct  193  IVGARMF  199



>ref|XP_002448366.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
 gb|EES12694.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
Length=777

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 111/194 (57%), Gaps = 15/194 (8%)
 Frame = +1

Query  25   WFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA--------HL  174
            W  A+ + L L  L+ C    A A KTYIV M   E PSSF  H +WYA+         L
Sbjct  8    WRKALPMCLALVALQACLPARAAAPKTYIVQMAASEMPSSFDFHHEWYASTVKTVSSVQL  67

Query  175  QSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFL  342
            +   D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR+P+FL
Sbjct  68   EGGADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADGVVTVLPETVLRLHTTRSPDFL  127

Query  343  GLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
            G+  E             DV+VG+LDTG+WPES SF D G+  VPA+W+G C++   F  
Sbjct  128  GISPEISNSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVPAKWKGLCQTGRGFT-  186

Query  523  KTHCNKKLIGARFY  564
              +CN+K+IGAR +
Sbjct  187  IANCNRKIIGARIF  200



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM   + P++F  H  WY A L+S  +S  ++Y Y    HGFAA L A E E L
Sbjct  36   KKTYIIHMAKSQMPATFDDHTHWYDASLKSVSESAEMIYVYNNVIHGFAARLTAQEAESL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
            +    ++ V  + +Y LHTTRTP FLGLD    +   + S   ++VI+GILD+G+WPE +
Sbjct  96   KTQPGILSVLSEVIYQLHTTRTPLFLGLDNRPDVF--NDSDAMSNVIIGILDSGIWPERR  153

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+  VP  W+G CES  NF     CN+KLIGAR+++
Sbjct  154  SFDDTGLGPVPESWKGECESGINFS-SAMCNRKLIGARYFS  193



>ref|XP_008220305.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=769

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 115/187 (61%), Gaps = 13/187 (7%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA-------KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS  192
            + +L  +L P +    VA       KKTYI+HM   + P+SF+  H  WY + L+S  +S
Sbjct  7    MLLLAVMLLPISHICVVAEDREQQVKKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNS  66

Query  193  --LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              +LYTY T  HGF+  L A+E E L +   ++ V  +  Y LHTTRTPEFLGL     L
Sbjct  67   ADMLYTYRTIIHGFSTRLTAEEAELLEKQPGILSVLPERKYELHTTRTPEFLGLGKSEAL  126

Query  367  GAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKL  546
                 S + ++VIVG++DTGVWPE KS+DD+G+ AVP  W+G CE   NF   + CN+KL
Sbjct  127  LPA--SDKVSEVIVGVVDTGVWPELKSYDDTGLAAVPTSWKGSCEVGTNFS-SSSCNRKL  183

Query  547  IGARFYT  567
            IGAR+++
Sbjct  184  IGARYFS  190



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   PS F  H +WYAA LQ+  D  ++LYTY T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPSDFVEHEEWYAASLQAVSDAATVLYTYNTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRT EFLGLD    L    G+   +DVIVG+LDTGVWPE  
Sbjct  93   ESQPGVLVVNPEVRYELHTTRTWEFLGLDGTDALFPQSGT--GSDVIVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G   VPA W+G+CE   +F+  T CNKKLIGARF+
Sbjct  151  SYDDTGFGPVPAGWKGKCEDGNDFN-ATACNKKLIGARFF  189



>gb|KJB34438.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=598

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 13/172 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGF  228
            + KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG 
Sbjct  29   LIKKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGV  88

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            AA L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIV
Sbjct  89   AAQLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIV  148

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            G+LDTG+WPES SF+D+GMT VPA W+G CE+   F  K HCN+K++GAR +
Sbjct  149  GVLDTGIWPESASFNDTGMTPVPAHWKGTCETGRGFQ-KHHCNRKIVGARVF  199



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 112/185 (61%), Gaps = 6/185 (3%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
            +++  S +  ++  L  C  + A  K+TYIVHM   E P+ FQ H  WY + L+S  DS 
Sbjct  5    TIIPTSLVVRVVLFLALCQLSLA-EKRTYIVHMAKSEMPAVFQDHTHWYDSSLKSVSDSA  63

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY    HGF+  L  +E + +     ++ V  +  Y LHTTRTP FLGLD    + 
Sbjct  64   EMLYTYNNVIHGFSTRLTPEEAQAMETRPGILSVLPELRYELHTTRTPSFLGLDQNAAMF  123

Query  370  AGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLI  549
                S   ++VIVG+LDTGVWPES SFDD+G   VP+ W+G CE   NF  K++CN+KL+
Sbjct  124  PESDS--VSEVIVGVLDTGVWPESPSFDDTGFGPVPSSWKGECEIGTNFT-KSNCNRKLV  180

Query  550  GARFY  564
            GAR++
Sbjct  181  GARYF  185



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 107/177 (60%), Gaps = 6/177 (3%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I L  L     +    + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY  A
Sbjct  14   IFLLYLSSFHVSDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNNA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEA  393
             HGFA  L  +E + L     V+ V  +  Y LHTTRTP FLGL+    GL    G+  A
Sbjct  74   IHGFATRLTPEEADSLMVQPGVISVQSEQQYELHTTRTPLFLGLEVHNAGLFPETGA--A  131

Query  394  ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +DV++G+LDTGVWPESKSF D G   VP+ W+G CE+  NF   + CN+KLIGARF+
Sbjct  132  SDVVIGVLDTGVWPESKSFSDEGYGPVPSTWKGECETGTNFT-ASLCNRKLIGARFF  187



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            A  TYIVHM   E P+SF+ H  WY + L++  DS  ++Y Y+ A HGF+  L   + E 
Sbjct  38   ASTTYIVHMAKSEMPASFEHHTHWYDSSLKTVSDSAEMMYIYSNAIHGFSTKLTPAQAES  97

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L+    V+ V  +  Y LHTTRTPEFLGL           S   +DVI+G+LDTGVWPES
Sbjct  98   LQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETIPQSNS--ESDVIIGVLDTGVWPES  155

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            KSFDD+G+  VP  W+G CES  NF+  ++CN+KLIGAR++
Sbjct  156  KSFDDTGLGPVPGSWKGACESGTNFN-SSNCNRKLIGARYF  195



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 114/196 (58%), Gaps = 13/196 (7%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            MG++  F + + LL L    +A A  AKKTY++ M     P +F  H +WY++ ++S   
Sbjct  6    MGNMGCFLS-SYLLVLTMLFSANAQFAKKTYLIQMDKSAMPKAFPNHLEWYSSKVKSALS  64

Query  181  --------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPE  336
                    SE  ++YTY  A+HG AA L   E ++L   E VV ++ D+ Y LHTTR+P 
Sbjct  65   TLPEADADSEKRIIYTYQNAFHGVAAKLTEGEAKKLETEEGVVAIFPDTKYELHTTRSPT  124

Query  337  FLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNF  516
            FLGL+ E             DVIVG+LDTG+WPES+SF D  M  VPA W+G CE    F
Sbjct  125  FLGLEPEKAPNMWSEKLAGHDVIVGVLDTGIWPESESFKDVSMGPVPAHWKGACEIGTGF  184

Query  517  DPKTHCNKKLIGARFY  564
              K+HCNKK++GAR +
Sbjct  185  T-KSHCNKKVVGARVF  199



>ref|XP_010105482.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04838.1| Subtilisin-like protease [Morus notabilis]
Length=765

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYI+HM +  KP+ F+ H +WY + L+S  DS  +LYTY    HGF+ +L   E E L
Sbjct  33   KTTYIIHMDNSNKPAVFEDHVNWYDSSLRSVSDSGEMLYTYNNVIHGFSTSLNYKEAELL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP-EAADVIVGILDTGVWPES  441
            +    VV V  +++Y LHTTRTP+FLGL  E    +   SP +  +V+VG+LDTGVWPE 
Sbjct  93   KIQPGVVSVIPETIYELHTTRTPDFLGLMEENASNSILPSPGKVGNVVVGMLDTGVWPEI  152

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +S+DD+G+  VP  W+G C    NF+  + CN+KLIGAR ++
Sbjct  153  RSYDDTGLGPVPRSWKGSCVVGKNFN-SSSCNRKLIGARLFS  193



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 103/161 (64%), Gaps = 6/161 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L
Sbjct  30   QGTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPES  441
                 V+ V  +  Y LHTTRTP FLGLD    GL    G+  A+DV++G+LD+GVWPES
Sbjct  90   MTQPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGA--ASDVVIGVLDSGVWPES  147

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            KSF D G   +P  W+G CE+   F   +HCN+KLIGARF+
Sbjct  148  KSFSDEGYGPIPTTWKGECEAGTKFT-ASHCNRKLIGARFF  187



>ref|XP_004985040.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=786

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 109/168 (65%), Gaps = 13/168 (8%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL------LYTYTTAYHGFAAALGAD  249
            A+KTYI  + H  KPS F TH  WYA+   +S  +       L+ Y T ++GF+A++ A 
Sbjct  36   ARKTYIFRVDHRAKPSVFPTHAHWYASAAFASSGAGAAPLEPLHVYGTVFNGFSASVPAS  95

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDT  423
              E LRR  AV+  +ED V  LHTTR+P+F+GL A  GL   A +GS    DV+VG+LDT
Sbjct  96   RAEELRRHPAVLAAFEDRVRPLHTTRSPQFMGLRARLGLWSLADYGS----DVVVGVLDT  151

Query  424  GVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            GVWPE +S  D  +  VPARWRG C++ P F PK+ CN+KL+GARF++
Sbjct  152  GVWPERRSLSDRNLPPVPARWRGGCDAGPGF-PKSSCNRKLVGARFFS  198



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 12/165 (7%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-----LLYTYTTAYHGFAAALGADEVE  258
            +T+I+H+    KPS F +H DWY + + S   S     LLY Y  A HGF+A L   +VE
Sbjct  31   RTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPPSPHPAKLLYNYNHATHGFSAQLTTTQVE  90

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL--GAGHGSPEAADVIVGILDTGVW  432
             LRR+  ++ V  D +  +HTT TP FLGL   FGL   +G+G      VI+G+LDTG+W
Sbjct  91   MLRRVPGILSVIPDQIRQIHTTHTPAFLGLSESFGLWENSGYGD----GVIIGVLDTGIW  146

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PE +S  DSG++ VPA W+G CE+ P+F P + CNKKLIGAR + 
Sbjct  147  PEHRSLSDSGLSDVPANWKGICETGPDF-PASSCNKKLIGARAFN  190



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 102/161 (63%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVHM     P++F  H  WY + L+++  S  +LYTY    HGF+  L  +E E L
Sbjct  29   KNTYIVHMDKSNMPTTFDDHFQWYDSSLKTASSSADMLYTYNNVVHGFSTRLTTEEAELL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
            R    ++ V  ++ Y LHTTRTPEFLGL           S  A++VIVG+LDTGVWPE K
Sbjct  89   RGQLGILSVLPEARYELHTTRTPEFLGLGKSVAFLPQADS--ASEVIVGVLDTGVWPELK  146

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G+  VP+ W+G CE+   F P + CN+KLIGARF++
Sbjct  147  SFDDTGLGPVPSSWKGECETGKTF-PLSSCNRKLIGARFFS  186



>ref|XP_004142885.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
 ref|XP_004172334.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
Length=641

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 112/191 (59%), Gaps = 18/191 (9%)
 Frame = +1

Query  25   WFSAITILLHLLRPCA--------ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            WF     LL L+  C+        +   + KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LY+Y T  HGF+  L  +E + + + E ++ V  +  Y LHTTRTPEFLGL  
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEGIIAVIPEMKYELHTTRTPEFLGLGK  123

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
                     S + ++VI+G+LDTGVWPE +SF D+G+  +PA W+G CE   NF   ++C
Sbjct  124  SVSFFPA--SEKVSEVIIGVLDTGVWPELESFSDAGLGPIPASWKGECEVGKNFT-SSNC  180

Query  535  NKKLIGARFYT  567
            N+KLIGAR+++
Sbjct  181  NRKLIGARYFS  191



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQVSDGAQQSTYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++
Sbjct  76   IHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASS  135

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DV+VG+LDTGVWPESKSF D+G   VP+ W+G CE+  NF   + CN+KLIGARF+
Sbjct  136  DVVVGVLDTGVWPESKSFSDNGFGPVPSTWKGGCEAGTNFT-ASLCNRKLIGARFF  190



>emb|CDY18653.1| BnaA09g07420D [Brassica napus]
Length=717

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+   L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  14   IVFLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDQHSLWYDSSLRSVSESAEMIYTYNNA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGFA  L  +E + L     V+ V ++  Y LHTTRTP FLGLD   G G    +  ++
Sbjct  74   IHGFATRLTPEEADSLMTQPGVISVRQEQRYELHTTRTPLFLGLDVHNG-GLFPETSTSS  132

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +++VG+LDTG+WPESKSF D G   +P+ W+G CE+  NF   + CN+KL+GARF+
Sbjct  133  NLVVGVLDTGIWPESKSFSDEGYGPIPSTWKGECEAGTNFT-ASLCNRKLVGARFF  187



>gb|KJB43875.1| hypothetical protein B456_007G221100 [Gossypium raimondii]
Length=761

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            +KTYIVHM   E P SFQ H  WY + L+S   S  +LYTY    HGF+  L   E E+L
Sbjct  31   RKTYIVHMAKSEMPPSFQHHTHWYDSSLKSVSGSAAMLYTYDNVIHGFSTQLTDKEAEQL  90

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 ++ V  +  Y LHTTRTPEFLGL     L     S  A++V++G+LDTGVWPESK
Sbjct  91   ESQPGILAVLPEVRYELHTTRTPEFLGLSQAAALFPE--SESASEVVIGVLDTGVWPESK  148

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SF D+G+  +P+ W+G CES  NF    +CNKKLIGA+++
Sbjct  149  SFADTGLGPIPSSWKGACESGTNFT-SANCNKKLIGAKYF  187



>ref|XP_008780995.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=783

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 105/169 (62%), Gaps = 6/169 (4%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYA--AHLQSSED-SLLYTYTTAYHGFAAAL  240
            A T A  KK YI  + H  KPS F TH  WYA  A     E   LL+ Y T +HGF+ +L
Sbjct  28   AVTTASRKKIYIFRVDHRSKPSIFPTHSHWYASPAFAGGGEPLPLLHVYDTVFHGFSTSL  87

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILD  420
              D    L R  AV+ V+ED +  LHTTR+P+FLGL  + GL +   S   +DVIVG+LD
Sbjct  88   QPDRAAELARHSAVLAVFEDRLRRLHTTRSPQFLGLRTQVGLWSD--SDYGSDVIVGVLD  145

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            TG+WPE +SF D  +  VP+RWRG CE+ P F P + CN KLIGAR+++
Sbjct  146  TGIWPERRSFSDRNLGPVPSRWRGACETGPGF-PASLCNHKLIGARYFS  193



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 101/163 (62%), Gaps = 11/163 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K  +I+HM   + P  F+ H  WY + L+S   S  +LY Y  A HGFAA L  +E E L
Sbjct  35   KSNFIIHMAKSQMPEGFEDHTHWYDSSLRSVSASAEMLYVYNNAVHGFAARLTPEEAESL  94

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
            +    ++ V  +  Y LHTTRTP FLGLD      +    PE+    DVIVG+LDTGVWP
Sbjct  95   QNQPGILSVLPEMKYELHTTRTPLFLGLDV-----SADYFPESNAMGDVIVGVLDTGVWP  149

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            ESKSFDD+G   +PA W+G CES  NF  K +CN+KLIGAR++
Sbjct  150  ESKSFDDNGFGPIPASWKGECESGTNFTSK-NCNRKLIGARYF  191



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 103/163 (63%), Gaps = 10/163 (6%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM   + PS+F  H +WY + L+S  DS  LLYTY  A HGF+  L  +E + L
Sbjct  36   QGTYIVHMAKSQMPSTFDLHSNWYDSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSPEAADVIVGILDTGVWP  435
                 V+ V  +  Y LHTTRTP FLGLD   A+     G  S    DV+VG+LDTGVWP
Sbjct  96   MTQPGVISVLPEHRYELHTTRTPLFLGLDEHTADLFPETGASS----DVVVGVLDTGVWP  151

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            ESKS+ D+G   +PA W+G CE+  NF   +HCN+KLIGARF+
Sbjct  152  ESKSYSDAGFGPIPATWKGGCETGTNFT-ASHCNRKLIGARFF  193



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 105/170 (62%), Gaps = 11/170 (6%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            A A   ++TYIVHM     P++F  H  WY A L+S  DS  +LY+Y T  HGF+  L  
Sbjct  21   AAAEEKRRTYIVHMAKSRMPATFTDHGHWYHASLRSVSDSAEILYSYDTVSHGFSTRLTP  80

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGIL  417
             E   L   E V+ V  +  Y LHTTRTP FLGLD   GL      P+A   +DV+VG+L
Sbjct  81   AEAATLESREGVLSVLPEVRYELHTTRTPMFLGLDESHGL-----FPQADTGSDVVVGLL  135

Query  418  DTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DTGVWPE KSFDD+G   VPA W+G CE A +F   T CN+KLIGARF++
Sbjct  136  DTGVWPERKSFDDTGFGPVPAGWKGACEEAKDFK-ATSCNRKLIGARFFS  184



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            +KTYIVHM   E P+SF  H  WY + L+S  DS  +LYTY    HGF+  L  +E ++L
Sbjct  30   RKTYIVHMAKSEMPASFLHHTHWYDSSLKSVSDSAQMLYTYDNVIHGFSTQLTNEEAQQL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 ++ V  +  Y LHTTRTP+FLGL     L     S  A++VIVG+LDTGVWPESK
Sbjct  90   ESQAGILAVLPELRYELHTTRTPQFLGLSKAADLFPE--SDSASEVIVGVLDTGVWPESK  147

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SF D+G+  +P+ W+G CE+  NF+  ++CN+KLIGAR++
Sbjct  148  SFADTGLGPIPSGWKGACEAGTNFN-SSNCNRKLIGARYF  186



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 106/174 (61%), Gaps = 16/174 (9%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---------------SEDSLLYTYTTAYH  222
            AK T+IV M     P +F  H DWY++ ++S                E+ ++Y Y TA+H
Sbjct  30   AKTTFIVQMDRSAMPGTFSDHLDWYSSKIKSVVSGSDLQEIRGDADDEERIIYNYRTAFH  89

Query  223  GFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADV  402
            G AA L  DE ++L + + V+ V+ +  Y LHTTR+P FLGLD E             DV
Sbjct  90   GVAARLTGDEAKKLEQEDGVLAVFPEEKYELHTTRSPMFLGLDREDTSDVWSQKNLDHDV  149

Query  403  IVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            +VG+LDTG+WPES+SF+D+GM  VPARW+G CE+   F+ K HCN+K++GAR +
Sbjct  150  VVGVLDTGIWPESESFNDTGMAPVPARWKGACETGKAFE-KRHCNRKIVGARIF  202



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + P+SF  H  WY + L+S  DS  +LYTY    HGF+  L  +E + L  
Sbjct  35   TYIVHMAKFQMPASFDEHTHWYDSSLKSVSDSAEMLYTYDNVIHGFSTRLTDEEAKLLEA  94

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSF  450
               ++ V  +  Y LHTTRTPEFLGLD   GL     S  A++V VG+LDTG+WPES SF
Sbjct  95   QPGILSVLPEVRYELHTTRTPEFLGLDKNEGLFPQ--SDIASEVFVGVLDTGIWPESLSF  152

Query  451  DDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            DD G+  VP+ W+G CE   NF+  ++CN+KLIGARF++
Sbjct  153  DDKGLGPVPSGWKGECEVGKNFN-TSNCNRKLIGARFFS  190



>gb|ADD09584.1| proteinase inhibitor [Trifolium repens]
Length=767

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM     P+SF  H  WY + L+S  ++  +LYTY    HGF+  L   E + L
Sbjct  32   KRTYIIHMDKFNMPASFDDHLQWYDSSLKSVSETAEMLYTYKHVAHGFSTRLTTQEADLL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  +  Y LHTTRTPEFLGL+    LG    S + ++VIVG++DTGVWPE K
Sbjct  92   TKQPGILSVIPEVRYELHTTRTPEFLGLEKTSLLGY---SGQQSEVIVGVIDTGVWPELK  148

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+G+  VP+ W+G CE+  NF+  ++CN+KL+GARF+
Sbjct  149  SFDDTGLGPVPSSWKGECETGKNFN-SSNCNRKLVGARFF  187



>ref|XP_006651839.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=716

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 103/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM     P+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  31   RRTYIVHMSRSAMPNDFAEHGEWYAASLQSVSDAATVLYTYDTLVHGYSARLTRAEAEAL  90

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVIVG+LDTGVWPE  
Sbjct  91   ESQPGVLFVNPEVRYELHTTRTPEFLGLDRTDALFPQ--SNTGSDVIVGVLDTGVWPERP  148

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+D++G+  VPA W+G+CE   +F+  + CNKKLIGARF+
Sbjct  149  SYDETGLGPVPAGWKGKCEEGNDFN-ASACNKKLIGARFF  187



>ref|XP_004142884.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 ref|XP_004172333.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 gb|KGN62460.1| Xylem serine proteinase 1 [Cucumis sativus]
Length=770

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 112/191 (59%), Gaps = 18/191 (9%)
 Frame = +1

Query  25   WFSAITILLHLLRPCA--------ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            WF     LL L+  C+        +   + KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LY+Y T  HGF+  L  +E + + + E ++ V  +  Y LHTTRTPEFLGL  
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEGIIAVIPEMKYELHTTRTPEFLGLGK  123

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
                     S + ++VI+G+LDTGVWPE +SF D+G+  +PA W+G CE   NF   ++C
Sbjct  124  SVSFFPA--SEKVSEVIIGVLDTGVWPELESFSDAGLGPIPASWKGECEVGKNFT-SSNC  180

Query  535  NKKLIGARFYT  567
            N+KLIGAR+++
Sbjct  181  NRKLIGARYFS  191



>ref|NP_001152427.1| LOC100286067 precursor [Zea mays]
 gb|ACG47554.1| subtilisin-like protease precursor [Zea mays]
Length=777

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 113/201 (56%), Gaps = 17/201 (8%)
 Frame = +1

Query  10   MGSL-VWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            MGS  V + A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S
Sbjct  1    MGSGGVRWKALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKS  60

Query  181  SED-------------SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHT  321
                             ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHT
Sbjct  61   VSSVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADGVVAVLPETVLQLHT  120

Query  322  TRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCE  501
            TR+P+FLG+  E             DV+VG+LDTG+WPES SF D G+  VPARW+G C+
Sbjct  121  TRSPDFLGISPEISDSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVPARWKGLCQ  180

Query  502  SAPNFDPKTHCNKKLIGARFY  564
            +   F     CN+K+IGAR +
Sbjct  181  TGRGFT-VASCNRKIIGARIF  200



>gb|KJB34440.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=778

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 13/172 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGF  228
            + KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG 
Sbjct  29   LIKKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGV  88

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            AA L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIV
Sbjct  89   AAQLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIV  148

Query  409  GILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            G+LDTG+WPES SF+D+GMT VPA W+G CE+   F  K HCN+K++GAR +
Sbjct  149  GVLDTGIWPESASFNDTGMTPVPAHWKGTCETGRGFQ-KHHCNRKIVGARVF  199



>ref|XP_002465573.1| hypothetical protein SORBIDRAFT_01g041350 [Sorghum bicolor]
 gb|EER92571.1| hypothetical protein SORBIDRAFT_01g041350 [Sorghum bicolor]
Length=790

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 106/174 (61%), Gaps = 24/174 (14%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWY------------AAHLQSSEDSLLYTYTTAYHGFA  231
            A+KTYI  + H  KPS F TH  WY            AA LQ      L+ Y T +HGF+
Sbjct  34   ARKTYIFRVDHRAKPSVFPTHAHWYASAAFASSAPGGAAPLQP-----LHVYGTVFHGFS  88

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL--GAGHGSPEAADVI  405
            A++ A   E LRR  AV+  +ED    LHTTR+P+F+GL A  GL   A +GS    DVI
Sbjct  89   ASVPASRAEELRRHPAVLAAFEDRPRPLHTTRSPQFMGLRARLGLWSVADYGS----DVI  144

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VG+LDTGVWPE +S  D  +  VPARWRG C++ P F P + CN+KL+GARF++
Sbjct  145  VGVLDTGVWPERRSLSDRNLPPVPARWRGGCDAGPGF-PASSCNRKLVGARFFS  197



>gb|ACN28204.1| unknown [Zea mays]
 gb|ACN28823.1| unknown [Zea mays]
 gb|AFW59138.1| putative subtilase family protein [Zea mays]
Length=777

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 113/201 (56%), Gaps = 17/201 (8%)
 Frame = +1

Query  10   MGSL-VWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            MGS  V + A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S
Sbjct  1    MGSGGVRWKALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKS  60

Query  181  SED-------------SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHT  321
                             ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHT
Sbjct  61   VSSVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADGVVAVLPETVLQLHT  120

Query  322  TRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCE  501
            TR+P+FLG+  E             DV+VG+LDTG+WPES SF D G+  VPARW+G C+
Sbjct  121  TRSPDFLGISPEISDSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVPARWKGLCQ  180

Query  502  SAPNFDPKTHCNKKLIGARFY  564
            +   F     CN+K+IGAR +
Sbjct  181  TGRGFT-VASCNRKIIGARIF  200



>ref|XP_007226995.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
 gb|EMJ28194.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
Length=769

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 109/163 (67%), Gaps = 8/163 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   + P+SF+  H  WY + L+S  +S  +LYTY T  HGF+  L A+E E 
Sbjct  32   KKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNSADMLYTYRTIIHGFSTRLTAEEAEL  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL-DAEFGLGAGHGSPEAADVIVGILDTGVWPE  438
            L +   ++ V  +  Y LHTTRTPEFLGL  +E  L A   S + + VIVG++DTGVWPE
Sbjct  92   LEKQPGILSVLPERKYELHTTRTPEFLGLGKSEAFLPA---SDKVSQVIVGVVDTGVWPE  148

Query  439  SKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
             KS+DD+G+ AVP+ W+G CE   NF   + CN+KLIGAR+++
Sbjct  149  LKSYDDTGLAAVPSSWKGSCEVGTNFS-SSSCNRKLIGARYFS  190



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQISDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++
Sbjct  76   IHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASS  135

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            DV+VG+LDTGVWPESKSF D+G   VP+ W+G CE+  NF   + CN+KLIGARF+
Sbjct  136  DVVVGVLDTGVWPESKSFSDNGFGPVPSTWKGGCEAGTNFT-ASLCNRKLIGARFF  190



>gb|KEH35793.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM     P+SF  H  WY + L+S  D+   +YTY    HGF+  L   E + L
Sbjct  22   KRTYIIHMDKFNMPASFDDHLQWYDSSLKSVSDTAETMYTYKHVAHGFSTRLTTQEADLL  81

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
             +   ++ V  D  Y LHTTRTPEFLGL+    L    G  + ++VIVG++DTGVWPE K
Sbjct  82   TKQPGILSVIPDVRYELHTTRTPEFLGLEKTITLLPSSG--KQSEVIVGVIDTGVWPELK  139

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            SFDD+G+  VP  W+G CE+   F+  ++CNKKL+GARF+
Sbjct  140  SFDDTGLGPVPKSWKGECETGKTFN-SSNCNKKLVGARFF  178



>ref|XP_007136744.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
 gb|ESW08738.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
Length=777

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 110/191 (58%), Gaps = 11/191 (6%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAV------AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ  177
            S++ F ++ I L L+     T A       +K TYI++      PSSF  H  WY + L+
Sbjct  11   SMLIFKSLLISLLLVFSSRHTVAEKKINHHSKSTYIIYTDKFSMPSSFNDHLLWYDSSLK  70

Query  178  SSEDSL--LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD  351
            S  DS   LYTY    HGF+  L   E E L +   ++ V  +  Y LHTTRTPEFLGL+
Sbjct  71   SVSDSAERLYTYQHVAHGFSTRLTTQEAELLSKQPGILSVIPEIRYDLHTTRTPEFLGLE  130

Query  352  AEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
                L    G    +DV+VG+LDTGVWPE KSFDD G+  VP+ W+G CE   NF P  +
Sbjct  131  KFITLSLASG--RQSDVVVGVLDTGVWPELKSFDDKGLGPVPSSWKGECERGKNFGP-AN  187

Query  532  CNKKLIGARFY  564
            CNKKL+GARF+
Sbjct  188  CNKKLVGARFF  198



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P+ F  H +WYAA LQ+  +  ++LYTY T  HG++A L   E E L
Sbjct  30   RQTYIVHMSHSAMPNDFVEHGEWYAASLQAVSEAATVLYTYDTLVHGYSARLTRAEAEAL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVI+G+LDTGVWPE  
Sbjct  90   ESQPGVLIVNPEVRYELHTTRTPEFLGLDGTDALFPQ--SSTGSDVIIGVLDTGVWPERP  147

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            S+DD+G   VPA W+G CE   +F+  + CNKKLIGARF+
Sbjct  148  SYDDTGFGPVPAGWKGECEKGNDFN-ASSCNKKLIGARFF  186



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 110/186 (59%), Gaps = 29/186 (16%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  210
            +A    A KTYIV M    KP SF  H DWY++ + S             +++ ++Y Y 
Sbjct  86   SAKTQFAHKTYIVQMDKSAKPESFTNHLDWYSSKVNSIVFKPENEEDGGHNQERVIYAYQ  145

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A+HG AA L  +E ERL+  + V+ ++ D+ Y LHTTR+P FLGL+        H S  
Sbjct  146  NAFHGVAARLSEEEAERLQEQDGVLAIFPDTKYQLHTTRSPLFLGLEP-------HDSTT  198

Query  391  AA--------DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKL  546
                      DVIVG+LDTGVWPES+SF+D+GM+ VPARW+G CE+   F  K +CNKK+
Sbjct  199  NVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMSPVPARWKGACETGRGFS-KHNCNKKI  257

Query  547  IGARFY  564
            +GAR +
Sbjct  258  VGARIF  263



>ref|XP_010933329.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=781

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 106/167 (63%), Gaps = 6/167 (4%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS---LLYTYTTAYHGFAAALGA  246
            T A  +KTYI  + H  KPS F TH  WYA+   +       LL+ Y T +HGF+A+L  
Sbjct  31   TTASPEKTYIFRVDHRSKPSIFPTHSHWYASSAFAGGGDPLPLLHVYDTVFHGFSASLHP  90

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTG  426
            D    L R  AV+ V+ED +  LHTTR+P+FLGL  + GL +   S   +DVIVG+LDTG
Sbjct  91   DRAAELARHPAVLAVFEDRLRRLHTTRSPQFLGLRTQVGLWSD--SDYGSDVIVGVLDTG  148

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +WPE +SF D  +  VP+RW G CE+ P F P + CN+KLIGAR+++
Sbjct  149  IWPEHRSFSDRNLGPVPSRWSGACETGPGF-PASLCNRKLIGARYFS  194



>ref|XP_003516516.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=775

 Score =   157 bits (396),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGAD  249
            +A   K TYIVH+   E PSSF  H  WY + L+S+ +S  +LYTY    HGF+  L  +
Sbjct  31   SAENPKGTYIVHLAKSEMPSSFNQHSIWYKSVLKSASNSAEMLYTYDNVIHGFSTRLTHE  90

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E   LR    ++ V  + +Y  HTTRTP FLGLD    +     S E +D+I+G+LDTGV
Sbjct  91   EAWLLRSQAGILKVQPEKIYKPHTTRTPHFLGLDKIADMVPE--SNEGSDIIIGLLDTGV  148

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            WPESKSFDD+G+  +P  W+G+CES+ +F+  + CNKKLIGAR Y+
Sbjct  149  WPESKSFDDTGLGPIPNTWKGKCESSVDFNASS-CNKKLIGARSYS  193



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 115/189 (61%), Gaps = 6/189 (3%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            M  L+ +  + I +  L  C  ++++  K TYIVHM   + P++F  H  WY + L+   
Sbjct  1    MRLLISYPLMIIWVVFLYLCHVSSSSPEKNTYIVHMAKSQMPATFDHHTKWYESSLRHVS  60

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            D+  ++YTY+ A HG+A  L   E E L  L  ++ V  ++ Y LHTTRTP FLGLD   
Sbjct  61   DTAEMIYTYSNAAHGYATRLTESEAESLSSLPGILAVLPETRYELHTTRTPSFLGLDRT-  119

Query  361  GLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNK  540
               +   S  A+DVI+G+LDTGVWPESKSFDD GM  VP+ WRG C +  NF   + CN 
Sbjct  120  -RDSFTESESASDVIIGVLDTGVWPESKSFDDKGMGPVPSTWRGACMTGNNFS-ASSCNL  177

Query  541  KLIGARFYT  567
            KLIGA++++
Sbjct  178  KLIGAQYFS  186



>ref|XP_010070627.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59522.1| hypothetical protein EUGRSUZ_H02274 [Eucalyptus grandis]
Length=768

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 115/191 (60%), Gaps = 17/191 (9%)
 Frame = +1

Query  28   FSAITILLHLLRPC------AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            F  +  +L L  PC             ++TYIVH+   + P++FQ H  WY + L+S   
Sbjct  10   FLVLVFVLGLGLPCFRVNGNGNGPQQQRRTYIVHVAKSQMPAAFQHHAHWYDSILKSVSG  69

Query  190  --SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
               ++Y+Y TA HGFAA L A+E   L  L  VV V ++  Y L TTRTPEFLGLD    
Sbjct  70   LAHMVYSYDTAAHGFAARLTAEEAILLDALPWVVAVLKELRYKLSTTRTPEFLGLDKISA  129

Query  364  LGAGHGSPEA---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHC  534
            L      PE+    +V+VG+LDTGVWPESKSFDD+G+  VP+ WRG CES  NF    +C
Sbjct  130  L-----LPESDSVNEVVVGVLDTGVWPESKSFDDTGLGPVPSGWRGACESGTNFT-AANC  183

Query  535  NKKLIGARFYT  567
            N+KLIGARF++
Sbjct  184  NRKLIGARFFS  194



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 8/163 (5%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVE  258
            A   KK+YIVH KH       + +   Y++ LQSS +SLLY YTTAY+GFAA+L  ++ +
Sbjct  24   ALATKKSYIVHTKH-------KYNASMYSSLLQSSSNSLLYAYTTAYNGFAASLNKEQAQ  76

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPE  438
             LR  ++++GVYED+VYSLHTTRTPEFLGL              + DV++ +LDTGVWPE
Sbjct  77   TLRSSDSILGVYEDTVYSLHTTRTPEFLGLVQTHSQFWEDLQQASYDVVIAVLDTGVWPE  136

Query  439  SKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            S+SF DS M  VP RWRG CESAP+FDP + CNKKLIGAR ++
Sbjct  137  SQSFHDSQMPQVPTRWRGYCESAPDFDP-SLCNKKLIGARSFS  178



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 104/164 (63%), Gaps = 11/164 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM     P++F  H  WY A ++S  DS  +LY+Y T  HGF+A L   E   L
Sbjct  32   RRTYIVHMAKSRMPATFAEHGHWYDASVRSVSDSVEILYSYNTVAHGFSAHLTPAEAAAL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE---FGLGAGHGSPEAADVIVGILDTGVWP  435
               + V+ V ++  Y LHTTRTPEFLGLD     F  G       A+DV+VG+LDTGVWP
Sbjct  92   ESRDGVLSVLQEVRYKLHTTRTPEFLGLDKSDDIFPQGN-----TASDVVVGVLDTGVWP  146

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            E KSFDD+G  AVP+ W+G CE   +F   T CN+KLIGARF++
Sbjct  147  ERKSFDDTGFGAVPSWWKGACEEGKDFK-GTACNRKLIGARFFS  189



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 109/198 (55%), Gaps = 20/198 (10%)
 Frame = +1

Query  25   WFSAITILLHL-LRPCAATAA-VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  192
            W S     LHL L  C  T      +TYI+HM   E P  F     WYA+ ++S   S  
Sbjct  41   WLSLCVAALHLTLSLCTTTPPKPPSRTYIIHMAKSEMPQIFTHRLQWYASTIKSVTSSPK  100

Query  193  --------------LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRT  330
                          ++Y+Y  A+HGFAA L  DE E+L  +  V  V  +++Y LHTTR+
Sbjct  101  LEAVAEEEEDPAERIIYSYENAFHGFAAKLTEDEAEKLESIPGVATVLPETIYRLHTTRS  160

Query  331  PEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAP  510
            PEFLG+  E        +    DVIVGILDTG+WPES SF D GMTAVP RWRG CE+  
Sbjct  161  PEFLGITGESN-SMWSAALSDHDVIVGILDTGIWPESPSFSDGGMTAVPPRWRGACETGR  219

Query  511  NFDPKTHCNKKLIGARFY  564
             F  K +CN+KL+GAR +
Sbjct  220  GFTAK-NCNQKLVGARIF  236



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  46   LLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAY  219
            +L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A 
Sbjct  16   ILYLLGSSQVSDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNAI  75

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++D
Sbjct  76   HGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASSD  135

Query  400  VIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            V+VG+LDTGVWPESKSF D G   VP+ W+G CE+  NF   + CN+KLIGARF+
Sbjct  136  VVVGVLDTGVWPESKSFSDKGFGPVPSTWKGGCEAGTNFT-ASLCNRKLIGARFF  189



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 108/173 (62%), Gaps = 15/173 (9%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------------SEDSLLYTYTTAYHG  225
            A KTYIV+M    KP  F  HR WY++ ++S              ++D ++Y Y TA+HG
Sbjct  32   ATKTYIVYMDKWAKPQEFSDHRQWYSSMIKSVASSRTEKRDDADENDDRIIYNYQTAFHG  91

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVI  405
             AA L  +EVE+L   + V+ V+ ++VY LHTTR+P FLGL+ E    A        DV+
Sbjct  92   VAAQLSEEEVEKLLEQDGVMAVFPETVYHLHTTRSPLFLGLEREDSTSAFTDKLSDYDVV  151

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            VG+LDTG+WPES SF+D+GM+ +P  W+G CE+   F  + +CN+K++GAR +
Sbjct  152  VGVLDTGIWPESPSFNDTGMSRIPPHWKGTCETGRGFS-RHNCNRKIVGARVF  203



>ref|XP_007160895.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
 gb|ESW32889.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
Length=777

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 103/166 (62%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGAD  249
            T  +AKKTYI+HM     PS+F  H +W+ + L+S   S  +LYTY    HGF+  L   
Sbjct  35   TQFLAKKTYIIHMDKSTMPSTFSDHLNWFDSSLKSVSASAEILYTYKHVAHGFSTRLTPK  94

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E E L     ++ V  +  Y LHTTRTP+FLGLD    L     S + + VI+G+LDTGV
Sbjct  95   EAETLANQPGILSVTPEHRYKLHTTRTPQFLGLDQSTTLLPA--SEQQSQVIIGVLDTGV  152

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            WPE KS DD+G+  VPA W+G CE   N +  +HCN+KL+GARF++
Sbjct  153  WPELKSLDDTGLGPVPATWKGECEVGNNMN-SSHCNRKLVGARFFS  197



>ref|XP_008444575.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=770

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 109/189 (58%), Gaps = 14/189 (7%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAA------VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            WF    + L     C+ T A      + KKTYI+HM     P +F  H  WY   L+S  
Sbjct  9    WF---LLFLISFSSCSFTEAQKSNQQLKKKTYIIHMDKTSMPQAFDDHFQWYDTSLKSVS  65

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            DS  +LY+Y    HGF+ +L  +E + + + E ++ V  +  Y LHTTRTPEFLGL    
Sbjct  66   DSAQMLYSYNNVIHGFSTSLTVEEAKLMEKQEGIIAVMPEMKYELHTTRTPEFLGLGKSA  125

Query  361  GLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNK  540
                   S + ++VI+GILDTGVWPE +SF D G+  +PA W+G CE   NF+  + CN+
Sbjct  126  SFFPA--SAKVSEVIIGILDTGVWPELESFSDDGLGPIPASWKGECEVGKNFN-SSSCNR  182

Query  541  KLIGARFYT  567
            KLIGAR+++
Sbjct  183  KLIGARYFS  191



>gb|KDP22364.1| hypothetical protein JCGZ_26195 [Jatropha curcas]
Length=778

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 14/173 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYTTAYHG  225
            + +KTYI+ M  H KP  F  H DWY++ +QS             +E+ ++Y+Y TA+HG
Sbjct  29   LTRKTYIIQMDKHAKPEYFSNHFDWYSSKVQSVLSTPENETNESDNEERIIYSYQTAFHG  88

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVI  405
             AA L  +E ERL   + V+ ++ +++Y LHTTR+P FLGL+ E        +    DVI
Sbjct  89   VAAKLSEEEAERLEEEDGVLAIFPETIYQLHTTRSPMFLGLEPEDSTSVWSETIADHDVI  148

Query  406  VGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            VG+LDTG+WPES SF+D+GMT VPA W+G CE+   F  K HCN+K++GAR +
Sbjct  149  VGVLDTGIWPESASFNDTGMTPVPAHWKGICETGRAFQ-KHHCNRKIVGARVF  200



>ref|XP_003558354.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=792

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 107/169 (63%), Gaps = 14/169 (8%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYA-AHLQSSEDS------LLYTYTTAYHGFAAALGA  246
            AKKTYI  + H  KPS F TH  WY+ A   S  D+       L+ Y T +HGF+A++ A
Sbjct  37   AKKTYIFRVDHRAKPSVFPTHAHWYSSAAFASGADADGPLLEPLHVYDTVFHGFSASVSA  96

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILD  420
               + LRR  AV+  +ED V  LHTTR+P+F+GL A  GL   A +GS    DVIVG+LD
Sbjct  97   PRADALRRHPAVLAAFEDRVRPLHTTRSPQFMGLRARLGLWSLADYGS----DVIVGVLD  152

Query  421  TGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            TGVWPE +S  D  +  VPARWRG C++   F P + CN+KL+GARF++
Sbjct  153  TGVWPERRSLSDRNLPPVPARWRGGCDAGAAF-PASSCNRKLVGARFFS  200



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 102/164 (62%), Gaps = 8/164 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-----LLYTYTTAYHGFAAALGADEV  255
            ++TYIVHM     P+    H +WY A L+S   S     +LY Y T  HGF+A L   E 
Sbjct  25   RRTYIVHMAKSAMPAECAXHAEWYGASLRSVSASASAAKMLYAYDTVLHGFSARLTPQEA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWP  435
              L   E V+ V  ++ Y LHTTRTPEFLG+  + GL    G+  A DV+VG+LDTGVWP
Sbjct  85   SDLASAEGVLAVNPEARYELHTTRTPEFLGIAGQ-GLSPQSGT--AGDVVVGVLDTGVWP  141

Query  436  ESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            ESKS+DD G+  VPA W+G+C   P FD  T CN+KL+GARF+ 
Sbjct  142  ESKSYDDXGLAEVPAWWKGQCXXGPGFDASTACNRKLVGARFFN  185



>ref|XP_004512211.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=767

 Score =   155 bits (393),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+     P+ F  H  WY + L+S  +S  +LYTY  A HGF+A+L  +EV+ L
Sbjct  33   KITYIVHVSKPRMPTIFNHHSIWYQSILKSISNSAEMLYTYDNAIHGFSASLTIEEVQLL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
            +    V+ V  D  Y L TTRTP+FLGLD    +     +  ++DVIVG+LDTGVWPESK
Sbjct  93   KSQTGVLKVTMDKNYKLLTTRTPKFLGLDKIANMFPT--TTISSDVIVGLLDTGVWPESK  150

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G   +P+ W+G+CE+  NF+  ++CNKKLIGARFY+
Sbjct  151  SFDDTGYGPIPSSWKGKCETGTNFN-TSNCNKKLIGARFYS  190



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 104/175 (59%), Gaps = 21/175 (12%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE-----------DSLLYTYTTAYHG  225
            ++ AK TY++ MK H+ P  + T  +WY+ H  S             D LLYTY++A+HG
Sbjct  1    SSAAKSTYLIQMKRHKMPEKYSTAAEWYSDHFLSHTKPSSSSSSEKFDGLLYTYSSAFHG  60

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----A  393
            +AA L  +EV+ +R  +AV GV ED VY + TTR+PEFLGLD   G   G+   E     
Sbjct  61   YAAVLAPEEVDAVRGSDAVAGVMEDRVYRVQTTRSPEFLGLDGVDGFLGGYNLTEINVST  120

Query  394  ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGAR  558
            ++VIVG++DTG+WPE  SF D G+  VP  WRG C+S         CN KLIGAR
Sbjct  121  SNVIVGVIDTGIWPEDPSFGDGGLPPVPKGWRGGCDSG------IVCNNKLIGAR  169



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 109/179 (61%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   LLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            LL  L  C  ++++  + TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  4    LLLCLGFCHVSSSSSDQGTYIVHMAKSQTPSSFDLHSNWYDSSLRSISDSAELLYTYENA  63

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA-  393
             HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD           PEA 
Sbjct  64   IHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEH----TADLFPEAG  119

Query  394  --ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
              +DV+VG+LDTGVWPESKS+ D G   +P+ W+G CE+  NF   + CN+KLIGARF+
Sbjct  120  SYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFT-ASLCNRKLIGARFF  177



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 120/195 (62%), Gaps = 18/195 (9%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----  180
            S +W+  +T++  +     AT +  KKTYIVHM     P SF  H +WY++ ++S     
Sbjct  16   SFLWY--LTVVFAV---STATLSSLKKTYIVHMDKSVLPESFADHLEWYSSTVKSVMATP  70

Query  181  -SEDS-----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFL  342
             SED      ++Y+Y TA+HGFAA L  +E +RL     V+ VY ++VY LHTTR+P FL
Sbjct  71   QSEDEDASERIIYSYETAFHGFAARLIEEEAQRLEEGYGVLAVYPETVYHLHTTRSPMFL  130

Query  343  GLDAEFGLGAG-HGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFD  519
            GL+ E         +    DV+VG+LDTG+WPES SF+D+GM  VPA+W+G CE+   F 
Sbjct  131  GLETEDSTSTVWSDTLSDHDVVVGVLDTGIWPESASFNDTGMKPVPAQWKGACETGRGFT  190

Query  520  PKTHCNKKLIGARFY  564
               +CNKK+IGAR +
Sbjct  191  -TDNCNKKIIGARIF  204



>ref|XP_009803919.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 110/187 (59%), Gaps = 6/187 (3%)
 Frame = +1

Query  13   GSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-  189
            G ++  + + +L H+           +KTYI+HM     P+ F  H  WY + L+S  + 
Sbjct  5    GVMILSTLVLVLFHVFVDAGQNQ---RKTYIIHMDKSNMPADFDDHTLWYDSSLKSVSEG  61

Query  190  -SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             +LLYTY    HG++  L ADE + L +   ++ V+E+  Y LHTTR+P FLGL+     
Sbjct  62   ANLLYTYNNVIHGYSTQLTADEAKSLEQQPGILSVHEEVRYELHTTRSPTFLGLEGRESK  121

Query  367  GAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKL  546
                 +   +DV +G+LDTG+WPESKSFDD+G+  VP  W+G C+   NF   + CN+KL
Sbjct  122  SFFLQAETRSDVTIGVLDTGIWPESKSFDDTGLGPVPTSWKGECQIGKNFK-ASSCNRKL  180

Query  547  IGARFYT  567
            IGARF++
Sbjct  181  IGARFFS  187



>emb|CDY63300.1| BnaCnng41800D [Brassica napus]
Length=716

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+   L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  14   IVFLYLGSCHVSHGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVSESAEMIYTYNNA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGFA  L  +E + L     V+ V ++  Y LHTTRTP FLGLD   G G    +  ++
Sbjct  74   IHGFATRLTPEEADSLMTQPGVISVRQEQRYELHTTRTPLFLGLDVHNG-GLFPETSTSS  132

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            ++++G+LDTG+WPESKSF D G   +P+ W+G CE+  NF   + CN+KL+GARF+
Sbjct  133  NLVIGVLDTGIWPESKSFSDEGYGPIPSTWKGECEAGTNFT-ASLCNRKLVGARFF  187



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 109/186 (59%), Gaps = 29/186 (16%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  210
            +A    A KTYIV M    KP SF  H DWY++ + S              ++ ++YTY 
Sbjct  25   SAKTQFAHKTYIVQMDKSAKPESFTNHLDWYSSKVNSIVFKPENEEDGGHDQERVIYTYQ  84

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A+HG AA L  +E ERL+  + V+ ++ D+ Y LHTTR+P FLGL+        H S  
Sbjct  85   NAFHGVAARLSEEEAERLQEQDGVLAIFPDTKYQLHTTRSPLFLGLEP-------HDSTT  137

Query  391  AA--------DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKL  546
                      DVIVG+LDTGVWPES+SF+D+GM+ VPA W+G CE+   F  K +CNKK+
Sbjct  138  TVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMSPVPAYWKGACETGRGFS-KHNCNKKI  196

Query  547  IGARFY  564
            +GAR +
Sbjct  197  VGARIF  202



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+L  L    A+    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  13   IVLLNLSSFHASDGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVSESAEMIYTYNNA  72

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE-FGLGAGHGSPEA  393
             HGFA  L   E + L     V+ V ++  Y LHTTRTP FLGLD +  GL    G+  +
Sbjct  73   IHGFATRLTPGEADSLMTQPGVISVQQEQKYELHTTRTPLFLGLDGQNAGLFPETGA--S  130

Query  394  ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            +D+++G+LDTG+WPESKSF D G   +P+ W+G C++  NF   + CN+KLIGARF++
Sbjct  131  SDIVIGVLDTGIWPESKSFSDEGYGPIPSTWKGECQAGTNFT-ASLCNRKLIGARFFS  187



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 112/185 (61%), Gaps = 13/185 (7%)
 Frame = +1

Query  34   AITILLHLLRPCAA--TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLY  201
            A  +LL L +  AA  T   AK TYI+HM     P++F  H +WY + L+S  D   +LY
Sbjct  9    AALVLLVLSQYGAAESTKKPAKSTYIIHMDKSNMPTTFAGHLEWYDSSLKSVSDGADMLY  68

Query  202  TYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG  381
            TY +  HGF+  L A E E L +   ++ V  +  Y LHTTRTPEFLGL+    L     
Sbjct  69   TYNSVLHGFSVRLTAKEAELLEKQPGILSVLPEVRYELHTTRTPEFLGLEKNEAL-----  123

Query  382  SPE---AADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIG  552
             PE   A++VIV +LDTG WPE KS+DD+G++ VP+ W+G CE    F+  + CN KLIG
Sbjct  124  YPESNLASEVIVAVLDTGAWPELKSYDDAGLSPVPSTWKGTCEVGKTFN-SSSCNNKLIG  182

Query  553  ARFYT  567
            ARF++
Sbjct  183  ARFFS  187



>dbj|BAJ99493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 12/164 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED---SLLYTYTTAYHGFAAALGADEVER  261
            ++TYIVH  H   PS F  H DWYA+ LQS      +++YTY T  HG++A L   E   
Sbjct  33   RRTYIVHCSHAAMPSEFAAHADWYASSLQSVSGGAAAVIYTYDTLLHGYSARLTRAEARA  92

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIVGILDTGVW  432
            L     V+ V  ++ Y LHTTRTPEFLGLD    L      PE   A+DV+VG+LDTGVW
Sbjct  93   LEAQPGVLLVNPETRYELHTTRTPEFLGLDRAEAL-----FPESNTASDVVVGVLDTGVW  147

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            PE  S+DD+G+  VPA W+G+CE   +F+  + CN+KLIGARF+
Sbjct  148  PERASYDDAGLGPVPAGWKGKCEGGSDFN-SSACNRKLIGARFF  190



>ref|XP_004512212.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=757

 Score =   155 bits (392),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 82/161 (51%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+     P+SF  H  WY + L S   S  +LYTY  A HGF+ +L  +EVE L
Sbjct  33   KITYIVHVSKSIMPTSFDHHSIWYKSILTSISKSAEILYTYDNAMHGFSTSLTVEEVELL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPESK  444
            +    V+ V ED  Y L TTRTP+FLGLD    +     +   +DVIVGILDTGVWPESK
Sbjct  93   KSQTGVLKVTEDKKYKLLTTRTPQFLGLDKIDTMFPT--TKNRSDVIVGILDTGVWPESK  150

Query  445  SFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            SFDD+G   +P+ W+G+CE+  NF   ++CNKKLIGAR +T
Sbjct  151  SFDDTGYGPIPSTWKGKCETGTNF-TTSNCNKKLIGARVFT  190



>dbj|BAJ91233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 107/167 (64%), Gaps = 13/167 (8%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL------LYTYTTAYHGFAAALGADE  252
            +KTYI  + H  KPS F TH  WY++   +S  S       L+ Y T +HGF+A+L A  
Sbjct  32   RKTYIFRVDHRAKPSVFLTHTHWYSSAAFASAASADAPVEPLHVYDTVFHGFSASLSASR  91

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDTG  426
             E LRR  AV+  +ED V  LHTTR+P+F+GL A  GL   A +GS    DVIVG+LDTG
Sbjct  92   AEELRRHPAVLASFEDRVRQLHTTRSPQFMGLRARLGLWSLADYGS----DVIVGVLDTG  147

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPE +S  D  ++ VPARWRG C++ P F   + CNKKL+GARF++
Sbjct  148  VWPERRSLSDRNLSPVPARWRGGCDAGPAFL-ASSCNKKLVGARFFS  193



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 114/187 (61%), Gaps = 15/187 (8%)
 Frame = +1

Query  46   LLHLLRPC-AATAAVA--------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS-----  183
            L  LL  C AA  A+         KKTYI+ +    KP  F  H  WY++ ++S+     
Sbjct  9    LFFLLSVCLAANFAICTTSNIPNTKKTYIIQIDKWAKPDVFIDHVKWYSSLVKSATAGEE  68

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            E+ +LY+Y TA+HG AA L  +E+ +LR    V+ V+ ++ Y LHTTR+P FLGLD E  
Sbjct  69   EERILYSYQTAFHGVAAQLSEEEINKLRAQHGVLAVFPETKYQLHTTRSPLFLGLDREDS  128

Query  364  LGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKK  543
                       +VIVG+LDTG+WPES SF+D+GMT +PA W+G CE+   F+ K HC+KK
Sbjct  129  SKLWSDKLADHNVIVGVLDTGIWPESPSFNDTGMTPIPAHWKGACETGRGFE-KHHCSKK  187

Query  544  LIGARFY  564
            ++GAR +
Sbjct  188  IVGARVF  194



>gb|AES62637.2| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +1

Query  28   FSAITILLHLLRPCAAT-AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  180
             S I     LL    +T A   KKTYI+HM    KP  F +H++WY++ ++S        
Sbjct  12   MSCILTTCFLLSIVLSTHAEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEA  71

Query  181  -----SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLG  345
                  E+ ++Y+Y TA+HG AA L  +E ++L     VV ++ D+ Y LHTTR+P FLG
Sbjct  72   EIDSSEEERIIYSYNTAFHGMAAKLSTEEAKKLESEAGVVAIFPDTKYQLHTTRSPYFLG  131

Query  346  LDAEFGLGAGHGSPEAA-DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
            L+             A  DVIVG+LDTG+WPES+SF D+G+  VP+ W+G CE+   F  
Sbjct  132  LEPIQNTNRSWSEKLANHDVIVGVLDTGIWPESESFIDTGLKPVPSHWKGACETGRGFR-  190

Query  523  KTHCNKKLIGARFY  564
            K HCNKK++GAR +
Sbjct  191  KHHCNKKIVGARIF  204



>emb|CDY40653.1| BnaA03g53100D [Brassica napus]
Length=767

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGAD  249
            AA A+ A KT+I  +     PS F TH  WY++   + E S+L+ Y T +HGF+A +  D
Sbjct  21   AADASQAAKTFIFRVDGGSMPSVFPTHYHWYSSEF-AQESSILHVYHTVFHGFSAVVTPD  79

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E + LR   AV+ V+ED    LHTTR+P+FLGL+ + GL +   S   +DVI+G+LDTG+
Sbjct  80   EADNLRNHPAVLAVFEDRRRELHTTRSPQFLGLENQKGLWS--DSDYGSDVIIGVLDTGI  137

Query  430  WPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            WPE +SF D  +  VP RWRG C++   F P+ +CN+K++GARF+
Sbjct  138  WPERRSFSDLNLGPVPKRWRGVCQAGARFGPR-NCNRKIVGARFF  181



>dbj|BAJ94518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 107/167 (64%), Gaps = 13/167 (8%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL------LYTYTTAYHGFAAALGADE  252
            +KTYI  + H  KPS F TH  WY++   +S  S       L+ Y T +HGF+A+L A  
Sbjct  32   RKTYIFRVDHRAKPSVFLTHAHWYSSAAFASAASADAPVEPLHVYDTVFHGFSASLSASR  91

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDTG  426
             E LRR  AV+  +ED V  LHTTR+P+F+GL A  GL   A +GS    DVIVG+LDTG
Sbjct  92   AEELRRHPAVLASFEDRVRQLHTTRSPQFMGLRARLGLWSLADYGS----DVIVGVLDTG  147

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPE +S  D  ++ VPARWRG C++ P F   + CNKKL+GARF++
Sbjct  148  VWPERRSLSDRNLSPVPARWRGGCDAGPAFL-ASSCNKKLVGARFFS  193



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 103/166 (62%), Gaps = 16/166 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM+  E PSSF  H  WY + L+S  +S  LLYTYT A HGF+  L  +E + L
Sbjct  30   QGTYIVHMEKSEMPSSFDLHSLWYDSSLRSVSESAELLYTYTNAIHGFSTRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGS---PE---AADVIVGILDTG  426
                 V+ V  +  Y LHTTRTP FLGLD        H +   PE   ++DV+VG+LDTG
Sbjct  90   MTQPGVISVLPEHRYELHTTRTPLFLGLDI-------HNADLFPETGASSDVVVGVLDTG  142

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            VWPESKSF D G   +P+ W+G CE   NF   + CN+KLIGARF+
Sbjct  143  VWPESKSFSDEGFGPIPSTWKGGCEVGTNFT-ASLCNRKLIGARFF  187



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   155 bits (391),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 72/164 (44%), Positives = 103/164 (63%), Gaps = 9/164 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P +F +H  WY++ L         E  L+YTY  A+HGF+A L  DE
Sbjct  2    RSTYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLSEDE  61

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
            +E L++    +  Y D V + HTTR+ +FL L++  GL     S    DVI+G++DTG+W
Sbjct  62   LEALKKSPGFISSYADDVITTHTTRSTQFLSLNSATGLWPASNS--GKDVIIGVIDTGIW  119

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            PES+SF D GMT VP+RW+G C++   F+  + CNKK+IGAR++
Sbjct  120  PESRSFSDEGMTEVPSRWKGICQAGQEFN-SSLCNKKIIGARYF  162



>tpg|DAA44340.1| TPA: putative subtilase family protein [Zea mays]
Length=794

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 105/167 (63%), Gaps = 13/167 (8%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGADE  252
            +KTYI  + H  KPS F TH  WYA+         ++    L+ Y T +HGF+A++ A  
Sbjct  40   RKTYIFRVDHSAKPSVFPTHAHWYASAAFASAAPGATPLRPLHVYGTVFHGFSASVPASR  99

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDTG  426
             E LRR  AV+  +ED    LHTTR+P+F+GL A  GL   A +GS    DVIVG+LDTG
Sbjct  100  AEELRRHPAVLAAFEDRARPLHTTRSPQFMGLRARLGLWSLADYGS----DVIVGVLDTG  155

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPE +S  D  +  VPARWRG C++ P F P + CN+KL+GARF++
Sbjct  156  VWPERRSLSDRNLPPVPARWRGGCDAGPGF-PASSCNRKLVGARFFS  201



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 108/165 (65%), Gaps = 8/165 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSF-QTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVER  261
            +KTYIVHM     P+ +   HR+WY A L+S  +  ++LY Y T  HGF+A L A E   
Sbjct  29   RKTYIVHMAKSAMPAEYADDHREWYGASLRSVSAASNMLYAYDTVLHGFSARLTAQEAAD  88

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIVGILDTGVW  432
            L  L  V+ V  ++ Y LHTTRTPEFLG+ A+ G   G   P+   AADV+VG+LDTGVW
Sbjct  89   LACLGGVLAVNPEARYELHTTRTPEFLGI-ADGGADQGGLFPQSGTAADVVVGVLDTGVW  147

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PES+S+DD+G+  VP+ W+GRC     F+  + CN+KL+GARF+ 
Sbjct  148  PESRSYDDAGLGEVPSFWKGRCVEGAGFN-ASACNRKLVGARFFN  191



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 114/185 (62%), Gaps = 11/185 (6%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAV-----AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED---  189
            A+++   ++  C  +  +       +T+I+H+   +KP  F TH  WY++ ++S      
Sbjct  6    ALSLFFIIISFCITSITIPVQSDGHETFIIHVSKSDKPRVFATHHHWYSSIIRSVSQHPS  65

Query  190  SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY+ A  GF+A L A + ++LRR+  V+ V  D V  LHTT TP FLGL   FGL 
Sbjct  66   KILYTYSRAAVGFSARLTAAQADQLRRIPGVISVLPDEVRHLHTTHTPTFLGLADSFGLW  125

Query  370  AGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLI  549
                S  A DVI+G+LDTG+WPE  SF D G++ VP+ W+G+C + P+F P+T CNKK+I
Sbjct  126  PN--SDYADDVIIGVLDTGIWPERPSFSDEGLSPVPSSWKGKCATGPDF-PETSCNKKII  182

Query  550  GARFY  564
            GA+ +
Sbjct  183  GAQMF  187



>ref|XP_008377982.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQT-HRDWY--AAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  H  WY  +    SS   +LYTY T  HGFA  L A+E E 
Sbjct  34   KKTYIIHMDKSEMPASFEDDHFQWYDSSLKSVSSSADMLYTYKTIIHGFATRLTAEEAEL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPES  441
            L +   ++ V  +  Y LHTTRTPEFLGL     L    G  + ++VIVG++DTGVWPE 
Sbjct  94   LGKQSGILSVLPERRYELHTTRTPEFLGLGKSEALLPASG--KVSEVIVGVVDTGVWPEL  151

Query  442  KSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            KS+DD+G+ AVP+ W+G CE+  NF   ++CN+KLIGARF++
Sbjct  152  KSYDDTGLAAVPSGWKGVCEAGTNFS-SSNCNRKLIGARFFS  192



>ref|XP_003592386.1| Subtilisin-like protease [Medicago truncatula]
Length=830

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +1

Query  28   FSAITILLHLLRPCAAT-AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  180
             S I     LL    +T A   KKTYI+HM    KP  F +H++WY++ ++S        
Sbjct  12   MSCILTTCFLLSIVLSTHAEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEA  71

Query  181  -----SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLG  345
                  E+ ++Y+Y TA+HG AA L  +E ++L     VV ++ D+ Y LHTTR+P FLG
Sbjct  72   EIDSSEEERIIYSYNTAFHGMAAKLSTEEAKKLESEAGVVAIFPDTKYQLHTTRSPYFLG  131

Query  346  LDAEFGLGAGHGSPEAA-DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDP  522
            L+             A  DVIVG+LDTG+WPES+SF D+G+  VP+ W+G CE+   F  
Sbjct  132  LEPIQNTNRSWSEKLANHDVIVGVLDTGIWPESESFIDTGLKPVPSHWKGACETGRGFR-  190

Query  523  KTHCNKKLIGARFY  564
            K HCNKK++GAR +
Sbjct  191  KHHCNKKIVGARIF  204



>ref|XP_004496644.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 105/181 (58%), Gaps = 17/181 (9%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--------------EDSLLYTY  207
            ++ A  AKKTYI+ M +  KP  F  H++WY + ++S               ED ++Y Y
Sbjct  29   SSNAEFAKKTYIIQMDNSAKPDIFSNHQEWYTSKVKSVVYKSLEADEIDNNIEDRIIYNY  88

Query  208  TTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
             TA+ G AA L  +E ++L   + VV ++ D+ Y LHTTR+P FLGL+            
Sbjct  89   NTAFQGMAAKLSQEEAKKLENEDGVVAIFPDTKYQLHTTRSPSFLGLEPIIQTKNNFSKK  148

Query  388  --EAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARF  561
              +  DVIVG+LDTGVWPES+SF D GM  VP+ W+G CE+   F  K HCN K+IGAR 
Sbjct  149  LVDDHDVIVGVLDTGVWPESESFSDIGMKPVPSHWKGACETGRGFR-KHHCNNKIIGARI  207

Query  562  Y  564
            +
Sbjct  208  F  208



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED---SLLYTYTT  213
            + L L     +  +   KT+IVH+    KP  F TH  WY++ L+S      ++LY+Y  
Sbjct  12   VFLFLSSLAISVKSDGPKTFIVHVSISHKPLIFTTHHHWYSSILRSVSQHSPNILYSYDR  71

Query  214  AYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA  393
            A  GF+A L + + ++L R+  VV V  D V  LHTT TP FLGL+  FG+     S  A
Sbjct  72   AARGFSARLTSGQADQLSRVPGVVSVIPDRVRQLHTTHTPTFLGLEDSFGIWPN--SDYA  129

Query  394  ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
             +VIVG+LDTG+WPE  SF D G++ VP+ W+G+CES P+F P T CN+K+IGAR +
Sbjct  130  DNVIVGVLDTGIWPERPSFSDKGLSPVPSGWKGKCESGPDF-PATSCNRKIIGARLF  185



>ref|XP_006649720.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=783

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 12/167 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL-----LYTYTTAYHGFAAALGADE  252
            A KTYI  + H  KPS F TH  WY++   +S         L+ Y T +HGF+A + A  
Sbjct  35   ATKTYIFRVDHSAKPSVFPTHAHWYSSAAFASGAGGAPLEPLHVYDTVFHGFSALVSASR  94

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILDTG  426
             + LRR  AV+  +ED V +LHTTR+P+FLGL A  GL   A +GS    DVIVG+LDTG
Sbjct  95   ADALRRHPAVLAAFEDQVRTLHTTRSPQFLGLRARLGLWSLADYGS----DVIVGVLDTG  150

Query  427  VWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            VWPE +S  D  +  VP+RWRG C++ P F P + CN+KL+GARF++
Sbjct  151  VWPERRSLSDRNLPPVPSRWRGGCDAGPGFLPSS-CNRKLVGARFFS  196



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SBT17_ARATH RecName: Full=Subtilisin-like protease SBT1.7; AltName: Full=Cucumisin-like 
serine protease; AltName: Full=Subtilase subfamily 
1 member 7; Short=AtSBT1.7; AltName: Full=Subtilisin-like 
serine protease 1; Short=At-SLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 112/191 (59%), Gaps = 11/191 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            M S    S    LL  L  C  ++++  + TYIVHM   + PSSF  H +WY + L+S  
Sbjct  1    MSSSFLSSTAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSIS  60

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            DS  LLYTY  A HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD   
Sbjct  61   DSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEH-  119

Query  361  GLGAGHGSPEA---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
                    PEA   +DV+VG+LDTGVWPESKS+ D G   +P+ W+G CE+  NF   + 
Sbjct  120  ---TADLFPEAGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFT-ASL  175

Query  532  CNKKLIGARFY  564
            CN+KLIGARF+
Sbjct  176  CNRKLIGARFF  186



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 112/176 (64%), Gaps = 12/176 (7%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDS-LLYTYTTA  216
            +A+A+   +TYIV ++H  KPS F TH+ WY + L+S          SE S +L+TY T 
Sbjct  25   SASASALHRTYIVFVQHDAKPSVFPTHKHWYDSSLRSLSSTIQTTSHSETSRILHTYETV  84

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HGF+A L   E ++L+++  +VGV  + V  L TTR+P+FLGL      G    S   +
Sbjct  85   FHGFSAKLSPLEADQLQKVSGIVGVIPEQVRELQTTRSPQFLGLKTTDSAGLLKESDFGS  144

Query  397  DVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFY  564
            D+++G++DTG+WPE +SF+D  +  VPA+W+G C    +F P T CN+KLIGARF+
Sbjct  145  DLVIGVIDTGIWPERQSFNDRNLGPVPAKWKGECVGGKDF-PATSCNRKLIGARFF  199



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 112/191 (59%), Gaps = 11/191 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            M S    S    LL  L  C  ++++  + TYIVHM   + PSSF  H +WY + L+S  
Sbjct  1    MSSSFLSSTAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSIS  60

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            DS  LLYTY  A HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD   
Sbjct  61   DSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEH-  119

Query  361  GLGAGHGSPEA---ADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTH  531
                    PEA   +DV+VG+LDTGVWPESKS+ D G   +P+ W+G CE+  NF   + 
Sbjct  120  ---TADLFPEAGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFT-ASL  175

Query  532  CNKKLIGARFY  564
            CN+KLIGARF+
Sbjct  176  CNRKLIGARFF  186



>ref|XP_002318860.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
 gb|EEE97080.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
Length=778

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 112/188 (60%), Gaps = 13/188 (7%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI L      +    + +KTYIV M    KP  F +H +WY++ +QS            
Sbjct  13   LTIYLPFNIVVSMNNPLTRKTYIVQMDRSAKPEYFTSHLEWYSSKVQSVLSKPEIEGNAD  72

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
             ED ++Y+Y TA+HG AA L  +E ERL   + VV ++ ++ Y LHTTR+P FLGL+ E 
Sbjct  73   EEDRIIYSYETAFHGVAAKLNEEEAERLEEADGVVAIFPETKYQLHTTRSPMFLGLEPED  132

Query  361  GLGAGHGSPEAADVIVGILDTGVWPESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNK  540
                        DVIVG+LDTG+WPES+SF+D+GMT VP  W+G CE+   F  K HCNK
Sbjct  133  TTSVWSEKLAGHDVIVGVLDTGIWPESESFNDTGMTPVPTHWKGMCETGRGFQ-KHHCNK  191

Query  541  KLIGARFY  564
            K++GAR +
Sbjct  192  KIVGARVF  199



>ref|XP_003627424.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AET01900.1| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEVE  258
            K+T+I+ ++H+ KPS F TH++WY + L S    + +++++TY T +HGF+  L   E +
Sbjct  27   KQTFIIQVQHNSKPSIFPTHKNWYESSLSSITKTTSNNIIHTYDTVFHGFSTKLTQLEAQ  86

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPE  438
             L++L  V+ +  + + +LHTTR+PEFLGL      G  H +   +D+++G++DTG+WPE
Sbjct  87   NLQKLSHVITIIPEQIRTLHTTRSPEFLGLKTAAKTGLLHETDFGSDLVIGVIDTGIWPE  146

Query  439  SKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
             +SF+D  +  VPA+W+G C +  +F P T CN+K+IGA++++
Sbjct  147  RQSFNDRELGPVPAKWKGSCVAGKDF-PATACNRKIIGAKYFS  188



>dbj|BAJ86110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 102/165 (62%), Gaps = 9/165 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS------LLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P+ +  H +WY A L+S          +LY Y T  HGF+A L   E
Sbjct  29   RATYIVHMAKSAMPAEYADHGEWYGASLRSVSAGGAPAAKMLYAYDTVLHGFSARLTEQE  88

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               +  +E V+ V  ++ Y LHTTRTPEFLGL    GL    G+  A DV+VG+LDTGVW
Sbjct  89   ASDMAGMEGVLAVNPETRYELHTTRTPEFLGLAGNEGLFPQSGT--AGDVVVGVLDTGVW  146

Query  433  PESKSFDDSGMTAVPARWRGRCESAPNFDPKTHCNKKLIGARFYT  567
            PESKS+DD+G+  VP+ W+G C +  +F+  + CN+KLIGARF+ 
Sbjct  147  PESKSYDDAGLGEVPSSWKGTCMAGADFN-SSACNRKLIGARFFN  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960