BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF028D10

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             149   1e-39   Prunus persica
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    145   8e-38   Nicotiana tomentosiformis
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    143   3e-37   Nicotiana tomentosiformis
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             142   5e-37   Prunus persica
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          142   6e-37   Solanum tuberosum [potatoes]
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    142   7e-37   Nicotiana sylvestris
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             140   2e-36   
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    140   3e-36   Nicotiana sylvestris
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    140   6e-36   Nicotiana sylvestris
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    139   7e-36   Nicotiana sylvestris
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    139   7e-36   
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    140   7e-36   Nicotiana tomentosiformis
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          139   8e-36   Pyrus x bretschneideri [bai li]
ref|XP_002516727.1|  uv excision repair protein rad23, putative         139   1e-35   Ricinus communis
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         139   1e-35   Jatropha curcas
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                140   2e-35   
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        138   2e-35   Nicotiana tabacum [American tobacco]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    138   2e-35   Solanum lycopersicum
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    138   2e-35   Solanum lycopersicum
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    138   2e-35   Solanum lycopersicum
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               139   2e-35   Solanum lycopersicum
ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    132   2e-35   Nicotiana tomentosiformis
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               138   2e-35   Nicotiana sylvestris
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          138   3e-35   
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             137   4e-35   Prunus persica
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               137   5e-35   Prunus mume [ume]
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   135   7e-35   Citrus sinensis [apfelsine]
emb|CDP19777.1|  unnamed protein product                                136   1e-34   Coffea canephora [robusta coffee]
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          135   2e-34   Sesamum indicum [beniseed]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          136   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               136   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          135   3e-34   Sesamum indicum [beniseed]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    135   3e-34   Vitis vinifera
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   135   3e-34   Citrus sinensis [apfelsine]
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    135   3e-34   Vitis vinifera
gb|KJB80004.1|  hypothetical protein B456_013G076900                    135   3e-34   Gossypium raimondii
emb|CDX74251.1|  BnaA03g27960D                                          135   3e-34   
gb|KJB80005.1|  hypothetical protein B456_013G076900                    135   3e-34   Gossypium raimondii
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               135   4e-34   Brassica rapa
gb|ACJ83348.1|  unknown                                                 129   5e-34   Medicago truncatula
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like          127   6e-34   
emb|CDX91998.1|  BnaC03g33000D                                          134   6e-34   
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    135   6e-34   Arabis alpina [alpine rockcress]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          134   7e-34   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          135   7e-34   
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   7e-34   Citrus sinensis [apfelsine]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    135   8e-34   Arabis alpina [alpine rockcress]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   134   8e-34   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   8e-34   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   134   8e-34   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   134   8e-34   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   134   8e-34   Citrus sinensis [apfelsine]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             134   1e-33   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             134   1e-33   
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    132   1e-33   Nicotiana tomentosiformis
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             134   1e-33   Citrus clementina [clementine]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                134   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    133   1e-33   
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   134   1e-33   Citrus sinensis [apfelsine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          134   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               133   1e-33   
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   133   2e-33   Citrus sinensis [apfelsine]
ref|NP_974211.1|  UV excision repair protein RAD23C                     131   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ABB02636.1|  RAD23-like                                              133   2e-33   Solanum tuberosum [potatoes]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               132   3e-33   Solanum tuberosum [potatoes]
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    132   4e-33   Populus euphratica
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             132   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    132   5e-33   Populus euphratica
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    132   5e-33   Phoenix dactylifera
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    132   5e-33   
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    132   5e-33   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    132   5e-33   Phoenix dactylifera
gb|ACU18469.1|  unknown                                                 126   7e-33   Glycine max [soybeans]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             132   8e-33   Capsella rubella
ref|XP_002305813.1|  ubiquitin family protein                           131   8e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    132   8e-33   
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                131   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          131   9e-33   Tarenaya hassleriana [spider flower]
gb|ABD96960.1|  hypothetical protein                                    132   1e-32   Tarenaya spinosa
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    131   1e-32   
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          131   1e-32   Amborella trichopoda
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    131   1e-32   
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          130   1e-32   
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          130   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          130   2e-32   Cucumis melo [Oriental melon]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               130   2e-32   Glycine max [soybeans]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       130   2e-32   Cucumis sativus [cucumbers]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186903.1|  UV excision repair protein RAD23C                     130   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                129   3e-32   Erythranthe guttata [common monkey flower]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                129   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          129   5e-32   Phoenix dactylifera
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    129   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    129   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    129   7e-32   Glycine max [soybeans]
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                129   7e-32   Morus notabilis
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               129   7e-32   Vitis vinifera
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   8e-32   Elaeis guineensis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   8e-32   Elaeis guineensis
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    128   9e-32   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    128   9e-32   
gb|ACU18529.1|  unknown                                                 128   9e-32   Glycine max [soybeans]
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    129   9e-32   Cicer arietinum [garbanzo]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    129   1e-31   
ref|NP_001242098.1|  uncharacterized protein LOC100813881               129   1e-31   
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    129   1e-31   Glycine max [soybeans]
gb|KEH44233.1|  RAD23 UV excision repair family protein                 128   1e-31   Medicago truncatula
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    129   1e-31   
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   1e-31   Elaeis guineensis
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   1e-31   Elaeis guineensis
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          128   1e-31   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     128   2e-31   Glycine soja [wild soybean]
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          127   3e-31   Elaeis guineensis
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             127   3e-31   
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          126   4e-31   
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg             123   5e-31   
emb|CDP02781.1|  unnamed protein product                                126   5e-31   Coffea canephora [robusta coffee]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          126   6e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    126   7e-31   Fragaria vesca subsp. vesca
ref|XP_006383464.1|  ubiquitin family protein                           126   7e-31   
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    126   8e-31   Fragaria vesca subsp. vesca
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             124   9e-31   
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               126   1e-30   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     125   1e-30   Glycine soja [wild soybean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             125   1e-30   Phaseolus vulgaris [French bean]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             124   2e-30   
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   Phoenix dactylifera
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    124   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          124   5e-30   Citrus sinensis [apfelsine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         124   5e-30   Ricinus communis
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             124   5e-30   Citrus clementina [clementine]
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          123   9e-30   Elaeis guineensis
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    123   9e-30   Populus euphratica
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    122   1e-29   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    122   1e-29   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    122   1e-29   Populus euphratica
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             122   2e-29   Phaseolus vulgaris [French bean]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          122   2e-29   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             121   4e-29   Populus trichocarpa [western balsam poplar]
gb|KJB80001.1|  hypothetical protein B456_013G076800                    119   8e-29   Gossypium raimondii
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    120   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    119   1e-28   Populus euphratica
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    119   1e-28   Populus euphratica
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    119   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    119   2e-28   Populus euphratica
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             119   2e-28   
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          119   2e-28   
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    119   2e-28   Populus euphratica
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          119   2e-28   Populus euphratica
gb|KJB80000.1|  hypothetical protein B456_013G076800                    119   2e-28   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    119   2e-28   Gossypium raimondii
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71284.1|  hypothetical protein M569_03474                         118   4e-28   Genlisea aurea
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             117   5e-28   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    117   5e-28   
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          118   5e-28   Oryza brachyantha
emb|CAA72741.1|  RAD23, isoform I                                       118   6e-28   Daucus carota [carrots]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    117   1e-27   
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001057334.1|  Os06g0264300                                       117   2e-27   
gb|EAZ00429.1|  hypothetical protein OsI_22453                          117   2e-27   Oryza sativa Indica Group [Indian rice]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    117   2e-27   Gossypium raimondii
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    115   2e-27   Populus euphratica
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          116   2e-27   Fragaria vesca subsp. vesca
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    116   2e-27   Glycine max [soybeans]
gb|KJB79995.1|  hypothetical protein B456_013G076600                    116   2e-27   Gossypium raimondii
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               116   2e-27   Pyrus x bretschneideri [bai li]
gb|AFK37901.1|  unknown                                                 113   3e-27   Medicago truncatula
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    115   3e-27   Cicer arietinum [garbanzo]
ref|NP_001130219.1|  uncharacterized protein LOC100191313               113   4e-27   
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   4e-27   Populus euphratica
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633              114   1e-26   
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          114   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    113   2e-26   Camelina sativa [gold-of-pleasure]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    113   3e-26   Arabis alpina [alpine rockcress]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    113   3e-26   Camelina sativa [gold-of-pleasure]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 112   4e-26   Medicago truncatula
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    112   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    112   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    112   4e-26   
gb|AFK37577.1|  unknown                                                 112   6e-26   Lotus japonicus
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             111   1e-25   
gb|AAB65841.1|  osRAD23                                                 110   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063134.1|  Os09g0407200                                       110   2e-25   
emb|CDY01661.1|  BnaC04g30910D                                          110   2e-25   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               110   2e-25   Brassica rapa
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             110   3e-25   Capsella rubella
gb|EMT27109.1|  Putative DNA repair protein RAD23                       110   4e-25   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    109   4e-25   Gossypium raimondii
gb|EMS61794.1|  putative DNA repair protein RAD23                       110   4e-25   Triticum urartu
emb|CDX74522.1|  BnaA04g08670D                                          109   6e-25   
emb|CDY58121.1|  BnaCnng32650D                                          109   6e-25   Brassica napus [oilseed rape]
dbj|BAJ97496.1|  predicted protein                                      109   6e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50196.1|  putative DNA repair protein RAD23                       111   7e-25   Triticum urartu
gb|KJB69952.1|  hypothetical protein B456_011G053200                    109   7e-25   Gossypium raimondii
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     108   7e-25   Eucalyptus grandis [rose gum]
gb|KJB69954.1|  hypothetical protein B456_011G053200                    108   8e-25   Gossypium raimondii
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       109   8e-25   Brachypodium distachyon [annual false brome]
dbj|BAJ98767.1|  predicted protein                                      109   8e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    109   8e-25   Gossypium raimondii
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               108   9e-25   Gossypium arboreum [tree cotton]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               108   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          108   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          108   2e-24   Eucalyptus grandis [rose gum]
dbj|BAC76395.1|  RAD23-like protein                                     108   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149553.1|  LOC100283179                                       108   2e-24   Zea mays [maize]
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    108   2e-24   
emb|CDX67404.1|  BnaA07g14440D                                          108   2e-24   
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    107   2e-24   Setaria italica
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               107   2e-24   Brassica rapa
ref|NP_198663.1|  ubiquitin receptor RAD23d                             107   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         107   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg            101   3e-24   
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               107   3e-24   Gossypium arboreum [tree cotton]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          107   6e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001061854.1|  Os08g0430200                                       107   6e-24   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    106   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    106   7e-24   Setaria italica
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    106   9e-24   Nelumbo nucifera [Indian lotus]
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                  103   9e-24   Citrus sinensis [apfelsine]
gb|ACU20959.1|  unknown                                                 106   1e-23   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               105   1e-23   Glycine max [soybeans]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    105   1e-23   Glycine max [soybeans]
gb|ACN40029.1|  unknown                                                 105   1e-23   Picea sitchensis
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             105   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_001763027.1|  predicted protein                                  105   2e-23   
gb|KJB67005.1|  hypothetical protein B456_010G170000                    105   2e-23   Gossypium raimondii
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    105   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    105   2e-23   Brachypodium distachyon [annual false brome]
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                  103   3e-23   Citrus sinensis [apfelsine]
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                  103   4e-23   Citrus sinensis [apfelsine]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          104   4e-23   Nelumbo nucifera [Indian lotus]
dbj|BAC76393.1|  RAD23-like protein                                     103   4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84340.1|  unknown                                               99.4    4e-23   Medicago truncatula
gb|ACG32894.1|  DNA repair protein RAD23                                103   6e-23   Zea mays [maize]
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                  102   6e-23   Citrus sinensis [apfelsine]
ref|NP_001149140.1|  LOC100282762                                       103   6e-23   Zea mays [maize]
gb|ACN26781.1|  unknown                                                 102   8e-23   Zea mays [maize]
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   9e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   1e-22   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   1e-22   Glycine max [soybeans]
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          103   1e-22   Citrus sinensis [apfelsine]
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     103   1e-22   Glycine soja [wild soybean]
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              103   1e-22   
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    103   1e-22   Cucumis sativus [cucumbers]
gb|ACH72675.1|  RAD23                                                   103   1e-22   Pinus sylvestris var. mongolica
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   1e-22   Oryza brachyantha
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   1e-22   Oryza brachyantha
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    102   2e-22   Cucumis melo [Oriental melon]
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             102   2e-22   Phaseolus vulgaris [French bean]
gb|ABK24371.1|  unknown                                                 102   2e-22   Picea sitchensis
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...    102   2e-22   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    102   2e-22   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             102   2e-22   Phaseolus vulgaris [French bean]
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             102   2e-22   Prunus persica
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   2e-22   Prunus mume [ume]
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    97.4    2e-22   Nicotiana tomentosiformis
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   2e-22   Oryza brachyantha
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   2e-22   Oryza brachyantha
ref|XP_002512770.1|  uv excision repair protein rad23, putative         101   3e-22   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    101   3e-22   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               102   3e-22   Zea mays [maize]
ref|NP_001266655.1|  DNA repair protein RAD23                           102   3e-22   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              101   5e-22   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      101   5e-22   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   6e-22   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              101   6e-22   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   6e-22   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       101   6e-22   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             100   6e-22   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               100   6e-22   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               100   7e-22   
ref|XP_002299163.1|  DNA repair protein RAD23                           100   7e-22   
ref|XP_001752113.1|  predicted protein                                95.1    8e-22   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               100   8e-22   
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   1e-21   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   1e-21   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   1e-21   
ref|XP_003637291.1|  RAD23 protein                                      100   1e-21   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   1e-21   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   1e-21   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg              99.8    1e-21   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   1e-21   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg              99.8    1e-21   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                100   2e-21   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.8    2e-21   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.8    2e-21   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.8    2e-21   
gb|ACF83232.1|  unknown                                               97.1    2e-21   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g           99.4    2e-21   
ref|XP_002303970.1|  DNA repair protein RAD23                         99.4    2e-21   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.4    2e-21   
emb|CBI25247.3|  unnamed protein product                              99.4    3e-21   
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b             99.4    3e-21   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.6    4e-21   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.6    4e-21   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.6    4e-21   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b             97.8    7e-21   
ref|XP_001775909.1|  predicted protein                                95.5    7e-21   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...  97.8    8e-21   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...  97.8    8e-21   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110        97.4    9e-21   
emb|CDO98260.1|  unnamed protein product                              97.4    1e-20   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like        97.4    1e-20   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857           97.4    1e-20   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               97.1    1e-20   
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  96.7    1e-20   
ref|NP_001148810.1|  LOC100282427                                     97.1    2e-20   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        96.7    2e-20   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                   97.4    2e-20   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b             96.7    2e-20   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like        96.7    2e-20   
ref|XP_001780766.1|  predicted protein                                96.7    2e-20   
emb|CDX69473.1|  BnaA10g18220D                                        98.6    2e-20   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                96.7    2e-20   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                96.7    3e-20   
ref|NP_974181.1|  ubiquitin receptor RAD23b                           96.3    3e-20   
ref|NP_850982.1|  ubiquitin receptor RAD23b                           95.9    3e-20   
dbj|BAC76389.1|  RAD23-like protein                                   95.9    3e-20   
gb|EEC72612.1|  hypothetical protein OsI_06092                        95.9    3e-20   
ref|NP_001046083.1|  Os02g0179300                                     95.9    3e-20   
emb|CDX69474.1|  BnaA10g18230D                                        95.9    3e-20   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  95.9    4e-20   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  95.9    4e-20   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  95.9    4e-20   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        95.9    4e-20   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  95.5    4e-20   
dbj|BAC76390.1|  RAD23-like protein                                   95.5    5e-20   
ref|NP_565216.2|  ubiquitin receptor RAD23b                           95.5    6e-20   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.7    1e-19   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.7    1e-19   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   95.1    1e-19   
emb|CDY33351.1|  BnaC05g12320D                                        94.4    1e-19   
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        94.0    2e-19   
emb|CAA72742.1|  RAD23 protein, isoform II                            94.0    2e-19   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                96.3    2e-19   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  94.0    2e-19   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  94.0    2e-19   
gb|ABG89119.1|  Rad23-3Ai                                             94.0    2e-19   
gb|ABN05900.1|  Ubiquitin                                             96.3    2e-19   
gb|AAF68123.1|AC010793_18  F20B17.8                                   93.6    2e-19   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...  93.6    2e-19   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                        94.0    2e-19   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...  94.0    2e-19   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           93.6    3e-19   
dbj|BAK04690.1|  predicted protein                                    93.2    3e-19   
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...  92.0    4e-19   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           92.8    5e-19   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             92.8    5e-19   
gb|ABY66298.1|  RAD23-like protein                                    92.4    5e-19   
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        92.4    6e-19   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a    92.4    6e-19   
emb|CDX81753.1|  BnaC08g38480D                                        92.4    6e-19   
gb|EPS72838.1|  hypothetical protein M569_01918                       92.0    6e-19   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           92.4    7e-19   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           92.0    8e-19   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  92.4    8e-19   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    92.0    9e-19   
ref|NP_173070.1|  DNA repair protein RAD23A                           92.0    1e-18   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    91.7    1e-18   
emb|CAC01850.1|  putative protein                                     88.6    1e-18   
emb|CDY35071.1|  BnaA06g10810D                                        91.7    1e-18   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    91.7    1e-18   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           86.7    1e-18   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        91.3    1e-18   
ref|NP_197113.4|  uncharacterized protein                             89.0    2e-18   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like        90.5    3e-18   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                  90.5    3e-18   
emb|CDY26494.1|  BnaC09g41740D                                        89.0    6e-18   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg           89.7    7e-18   
emb|CDY26493.1|  BnaC09g41750D                                        87.8    3e-17   
emb|CDX67983.1|  BnaA07g20230D                                        87.8    6e-17   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             85.9    1e-16   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  87.4    1e-16   
emb|CDX79333.1|  BnaC06g19700D                                        85.5    2e-16   
dbj|BAC76391.1|  RAD23-like protein                                   85.1    2e-16   
gb|ABY66299.1|  DNA repair protein RAD23                              84.7    3e-16   
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                84.3    3e-16   
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                84.0    7e-16   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  85.1    7e-16   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        82.0    3e-15   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  81.6    4e-15   
emb|CDY26496.1|  BnaC09g41720D                                        81.3    5e-15   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  79.3    3e-14   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  79.0    4e-14   
gb|EMT30328.1|  Putative DNA repair protein RAD23                     79.3    7e-14   
ref|XP_004973490.1|  PREDICTED: probable DNA repair protein RAD23...  73.6    2e-13   
ref|XP_005646102.1|  UV excision repair protein Rad23                 77.0    2e-13   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           73.6    3e-13   
emb|CCA21947.1|  UV excision repair protein RAD23 putative            73.2    6e-12   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  72.8    8e-12   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  72.0    1e-11   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  72.4    1e-11   
pdb|1P1A|A  Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hh...  66.6    4e-11   
pdb|1UEL|A  Chain A, Solution Structure Of Ubiquitin-Like Domain ...  66.2    6e-11   
ref|XP_006640058.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    1e-10   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    2e-10   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...  68.6    2e-10   
ref|XP_006088115.1|  PREDICTED: UV excision repair protein RAD23 ...  68.2    3e-10   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    3e-10   
ref|XP_006088114.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    3e-10   
ref|XP_007499698.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    4e-10   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...  67.8    4e-10   
ref|XP_007499697.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    4e-10   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    4e-10   
ref|XP_004423355.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    4e-10   
ref|XP_008054682.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    4e-10   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                   67.8    5e-10   
ref|XP_011477015.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    5e-10   
ref|XP_008586188.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
ref|XP_001927901.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
dbj|BAE39643.1|  unnamed protein product                              67.0    5e-10   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
emb|CCI46099.1|  unnamed protein product                              68.2    5e-10   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
ref|XP_011363293.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    5e-10   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
ref|XP_006882076.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    5e-10   
ref|XP_004581217.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    6e-10   
ref|XP_008413853.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    6e-10   
ref|XP_004570397.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    6e-10   
ref|XP_003446521.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    6e-10   
ref|XP_008297295.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    6e-10   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    6e-10   
ref|XP_007573182.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  67.0    6e-10   
ref|XP_005362253.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    6e-10   
ref|XP_010741704.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    6e-10   
ref|XP_005802841.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
gb|ETP29927.1|  UV excision repair protein Rad23                      67.4    7e-10   
gb|ETL25740.1|  UV excision repair protein Rad23                      67.4    7e-10   
gb|ETK72284.1|  UV excision repair protein Rad23                      67.4    7e-10   
gb|ETL78956.1|  UV excision repair protein Rad23                      67.4    7e-10   
gb|ETM32232.1|  UV excision repair protein Rad23                      67.4    7e-10   
gb|ETI31946.1|  UV excision repair protein Rad23                      67.4    7e-10   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|NP_033037.2|  UV excision repair protein RAD23 homolog B          67.0    7e-10   
gb|AAH68193.1|  Rad23b protein                                        67.0    7e-10   
ref|XP_010387756.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|XP_005076549.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|NP_001020446.1|  UV excision repair protein RAD23 homolog B       67.0    7e-10   
emb|CAA63146.1|  MHR23B                                               67.0    7e-10   
gb|AAV38508.1|  RAD23 homolog B (S. cerevisiae)                       67.0    7e-10   
ref|XP_008914834.1|  UV excision repair protein Rad23                 67.4    7e-10   
ref|NP_001248717.1|  UV excision repair protein RAD23 homolog B       67.0    7e-10   
dbj|BAE34014.1|  unnamed protein product                              67.0    7e-10   
gb|AAX43553.1|  RAD23-like B                                          67.0    7e-10   
ref|XP_004462422.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
gb|AAH20973.1|  RAD23B protein                                        67.0    7e-10   
ref|XP_004848222.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|XP_005581182.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|XP_009186622.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    8e-10   
ref|XP_007631606.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  67.0    8e-10   
ref|NP_002865.1|  UV excision repair protein RAD23 homolog B isof...  67.0    8e-10   
ref|XP_007950131.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
dbj|BAD97199.1|  UV excision repair protein RAD23 homolog B variant   67.0    8e-10   
ref|XP_006985330.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_003470962.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
dbj|BAE25006.1|  unnamed protein product                              67.0    8e-10   
dbj|BAG57014.1|  unnamed protein product                              67.0    8e-10   
ref|XP_007966681.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|NP_001271836.1|  uncharacterized protein LOC101866175             67.0    8e-10   
ref|XP_010968406.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_004711018.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_006864754.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_002708173.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|NP_001158747.1|  UV excision repair protein RAD23 homolog B       63.9    8e-10   
ref|XP_010977006.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_003785253.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_004372251.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_009186620.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_006906141.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_005329791.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_004638157.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    9e-10   
ref|XP_008140049.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_008852875.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_004657041.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_010773397.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    9e-10   
ref|XP_006886977.1|  PREDICTED: UV excision repair protein RAD23 ...  66.6    1e-09   
ref|XP_010334293.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  66.6    1e-09   
ref|XP_005994202.1|  PREDICTED: UV excision repair protein RAD23 ...  65.5    1e-09   
gb|KDP41924.1|  hypothetical protein JCGZ_26942                       65.9    1e-09   
ref|XP_010766760.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    1e-09   
emb|CAF91196.1|  unnamed protein product                              65.5    1e-09   



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+KSSSGEGS +STATT      S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSSGEGSGASTATTTKAPQPSAPSAAPTATLTAPQAPIPTSA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
                       + A T    D YGQAAS+LVAG NLEG IQ
Sbjct  121  PPASVTTPAPVSSATTEVESDPYGQAASDLVAGTNLEGTIQ  161



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  440
            +NKVAEN+FVV+M++K K S+   SA+    + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLSKNKVSTSATSATQPTPSNTAQPATSTGQPTQTVTAPQATAASVAP  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
              SAP     PA  P       DVYGQAASNLVAG+ LE  +Q
Sbjct  121  AQSAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQ  163



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 103/161 (64%), Gaps = 16/161 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+                +    A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------SKAQPATSTGQPTQTVTAPQATAASVAPAQ  104

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            SAP     PA  P       DVYGQAASNLVAG+ LE  +Q
Sbjct  105  SAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQ  145



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+KSS GEGS +STAT       S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            S          + A      + YGQAAS+LVAG NLEG IQ
Sbjct  121  SPASVTTPAPVSSATMEVESNPYGQAASDLVAGTNLEGTIQ  161



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K SS   S+   A + T  PA ST  +      P +  A   +
Sbjct  61   ENKVAENSFVVIMLSKNKVSSTGTSSIPAAPSNTAQPAGSTDQARQTITAPQATAALPQS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            ++    A+     A  +   DVY QAASNLVAG+NLE  +Q
Sbjct  121  ASESAPASAPVPAAAASSVTDVYDQAASNLVAGSNLETTVQ  161



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  440
            +NKVAEN+FVV+M+AK K S+   SA+  A + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLAKNKVSTSATSAAQPAPSNTAQPATSTGQPTQTVTAPQATAASLAP  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
              SAP     PA  P  +    DVYGQAASNLVAG+ LE  +Q
Sbjct  121  AQSAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQ  163



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapvp  443
            +NKVAEN+FVV+M+ K+KSS      AS+   TK   P++ ++A T     P +      
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            + A V   AP  +        + YGQAAS+LVAG NLEG IQ
Sbjct  121  SPASVTTPAPVSSATMDRVESNPYGQAASDLVAGTNLEGTIQ  162



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 101/161 (63%), Gaps = 16/161 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+                     A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------AKAQPATSTGQPTQTVTAPQATAASLAPAQ  104

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            SAP     PA  P  +    DVYGQAASNLVAG+ LE  +Q
Sbjct  105  SAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQ  145



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 108/161 (67%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+ S  GEGS +STA T      S+ + +       + APA    
Sbjct  61   ENKVAENSFVVIMLTKSTSPPGEGSGASTAATTKAPQPSAHTGAPTATLTASPAPAAAST  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
                         A T    D YGQAAS+LVAG NLEG IQ
Sbjct  121  LPASVATPAPVASATTDSQADSYGQAASDLVAGTNLEGTIQ  161



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 112/161 (70%), Gaps = 1/161 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+F+V+M+   +  S  G +++++   + A  +ST   +A  P   +    V A
Sbjct  61   ENKVAENSFIVIML-SKRKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPAVTA  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
              P   A   P   P +   D+YGQAASNLVAG+NLE  +Q
Sbjct  120  ELPQSAAESTPVVNPVSSETDIYGQAASNLVAGSNLEATVQ  160



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61   ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
              P    +      P +   DVYGQAASNLVAGNNLE  IQ
Sbjct  121  PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQ  161



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 112/164 (68%), Gaps = 0/164 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  258  TLEDNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapap  437
            TLE+NKV EN+F+V+M+ K K+S    S++S A T    P +++  +++     +  PA 
Sbjct  175  TLEENKVVENSFIVIMITKNKASPSGASSTSGAATSQAQPVTASPPASSTPSTTSETPAS  234

Query  438  vpasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            V                  +   DVYGQAASNLVAG+NLE  +Q
Sbjct  235  VAPPPQSVPEPAPAAAPTASAELDVYGQAASNLVAGSNLEATVQ  278



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  447  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQ  569
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQ  163



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  447  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQ  569
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQ  163



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+VAEN+F+V+M+  TK+ +    ASST    T     +++ ++   PV + AP    A
Sbjct  61   ENQVAENSFIVIML--TKNKASPSGASSTKGAATSQAQPASTPTSTAPPVASPAPVRAVA  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             +   V  PA      +   DVYGQAASNLVAG NLE  +Q
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQ  159



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+VAEN+F+VVM+  TK+ +    ASST    T     +++ ++   PV   AP    A
Sbjct  61   ENQVAENSFIVVML--TKNKASPSGASSTKGAATSQAQPASTPTSTTPPVATPAPVRAVA  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             +   V  PA      +   DVYGQAASNLVAG NLE  +Q
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQ  159



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIML  74



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE +FVVVM+
Sbjct  61   ENKVAEKSFVVVML  74



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 3/161 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             A     +     +      DVYGQAASNLVAG+NLEG IQ
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQ  158



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 3/161 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             A     +     +      DVYGQAASNLVAG+NLEG IQ
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQ  158



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++FVVVM+
Sbjct  61   ENKVAESSFVVVML  74



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  264  EDNKVAENNFVVVMM  308
            E+NKVAE +FVVVM+
Sbjct  125  EENKVAEKSFVVVML  139



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 112/161 (70%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E++F VVM++K+K SS   S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
                   +            ++YGQAASNLVAG+NLE  IQ
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQ  161



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            ++KVAEN+F+VVM++K+K SSG  S ++ A      P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVVMLSKSKVSSGGPSTATAAPPTLAQPTSSLPSNVTQPSSTAQAAVPAAV  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
                  ++PA   +  +   D+YGQAASNLVAG+NLE  IQ
Sbjct  121  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQ  161



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E++F VVM++K+K SSG  S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSGGPSTAPAAPASQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
                   +            ++YGQAASNLVAG+NLE  IQ
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQ  161



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAE +FVV+M+
Sbjct  61   ANNVAEKSFVVIML  74



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKVAENNF+V+M+ KTK+ +G G++++++ T  + P SS+  +   +  PA   A    
Sbjct  61   DNKVAENNFLVIMLTKTKAPAGGGTSTTSSATAQVQPPSSSPPNPPTSAPPAQTAATPSP  120

Query  447  sapvpvaapaptpaptagsgD--VYGQAASNLVAGNNLEGAIQ  569
                              SGD  VYGQAASNLVAG+NLE AIQ
Sbjct  121  PVAAAPTTVNQPATALLSSGDADVYGQAASNLVAGSNLEQAIQ  163



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
             N VAEN+F+V+M+ K K+S    S+   A T    PAS+   S AP P   +    +  
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPASTAPTSAAPPPAAPAPAPALLQ  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
              P P    A   APT    DVYGQAASNLVAG  LE  +Q
Sbjct  121  LLPQPXXQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQ  161



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE +F+V+M+
Sbjct  61   ENKVAEKSFIVIML  74



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN F+V+M+
Sbjct  61   ENKVAENTFIVIML  74



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIMI  74



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAE++FVV+M+
Sbjct  61   ENQVAESSFVVIML  74



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  267  DNKVAENNFVVVMM  308
            D+KVAEN+FVV+M+
Sbjct  61   DSKVAENSFVVIML  74



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+VVM+
Sbjct  61   ENKVAENSFIVVML  74



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
            MK+FVKTLKGT+FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  264  EDNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            +++KVAEN+F+VVM++K+K SSG  S ++ A     +   ST+ +  P  V A   + +P
Sbjct  61   DESKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLP  120

Query  444  asapvpvaapaptpapta-gsgDVYGQAASNLVAGNNLEGAIQ  569
            ++   P +         A    D+YGQAASNLVAG+NLE  IQ
Sbjct  121  SNVTQPSSTSQAAVPAAAFSDADMYGQAASNLVAGSNLEATIQ  163



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+ENNF+++M+
Sbjct  61   DNKVSENNFIIIML  74



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 103/161 (64%), Gaps = 8/161 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+        +  AS +  +   APA S + S     V     +    
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQSQPAQTVATPQVSAPTV  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            S P P +  A   A  +   DVYGQAASNLVAG  LE  +Q
Sbjct  113  SVPEPTSVTAAPAAAASVQTDVYGQAASNLVAGTVLESTVQ  153



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   ANNVAENSFIVIML  74



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  267  DNKVAENNFVVVMM  308
            +N VAE +FVV+M+
Sbjct  59   ENNVAEKSFVVIML  72



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIE  PE +VA+VKK IET QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
             MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTL
Sbjct  3    RMKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTL  62

Query  264  EDNKVAENNFVVVMM  308
            E NKVAEN+F+V+M+
Sbjct  63   EHNKVAENSFIVIML  77



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
             MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTL
Sbjct  3    RMKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTL  62

Query  264  EDNKVAENNFVVVMM  308
            E NKVAEN+F+V+M+
Sbjct  63   EHNKVAENSFIVIML  77



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
             MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTL
Sbjct  3    RMKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTL  62

Query  264  EDNKVAENNFVVVMM  308
            E NKVAEN+F+V+M+
Sbjct  63   EHNKVAENSFIVIML  77



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
             MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTL
Sbjct  3    RMKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTL  62

Query  264  EDNKVAENNFVVVMM  308
            E NKVAEN+F+V+M+
Sbjct  63   EHNKVAENSFIVIML  77



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            ++ V EN+F+V+M+
Sbjct  61   ESSVTENSFIVIML  74



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIHQGKVLNDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNFVV+M+
Sbjct  61   ENKVVENNFVVIML  74



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVNENSFIVIML  74



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   QNNVAENSFIVIML  74



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+FVV+M+
Sbjct  61   ENQVAENSFVVIML  74



>ref|NP_001130219.1| uncharacterized protein LOC100191313 [Zea mays]
 gb|ACF78374.1| unknown [Zea mays]
 tpg|DAA61377.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
 tpg|DAA61378.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=225

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +      A A      +   D YGQA SNLVAG+NLEG I+
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIK  161



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +      A A      +   D YGQA SNLVAG+NLEG I+
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIK  161



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   GNNVAENSFLVIML  74



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  60   ENNVAENSFIVIML  73



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +      A A      +   D YGQA SNLVAG+NLEG I+
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIK  161



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAE++FVV+M+
Sbjct  61   ENNVAEDSFVVIML  74



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  440
            +NKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             ++      A        +   D YGQA SNLVAG+NLE  IQ
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQ  163



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  440
            +NKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
             ++      A        +   D YGQA SNLVAG+NLE  IQ
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQ  163



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V E +F+V+M+
Sbjct  60   ENNVVEKSFIVIML  73



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74



>gb|KJB69953.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=330

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 88/161 (55%), Gaps = 18/161 (11%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +           PA  +   D Y QAASNLVAGNNLE  IQ
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQ  143



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>dbj|BAJ97496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ FEIEV P D V+DVKK IET QG NVYPA Q MLI+QG VLKD TTLE
Sbjct  1    MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIYQGSVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVVENNFLVIML  74



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 88/161 (55%), Gaps = 18/161 (11%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +           PA  +   D Y QAASNLVAGNNLE  IQ
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQ  143



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 88/161 (55%), Gaps = 18/161 (11%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +           PA  +   D Y QAASNLVAGNNLE  IQ
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQ  143



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIHQG VLKD TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIHQGTVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            ++KV ENNF+V+M+
Sbjct  61   ESKVLENNFLVIML  74



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 97/161 (60%), Gaps = 7/161 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEVPAQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +        A   A      D Y QAASNLVAG+NLE  IQ
Sbjct  114  APDSKSGTSASDAATANPDTDTYSQAASNLVAGSNLEQTIQ  154



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 98/161 (61%), Gaps = 7/161 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEIPAQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +        A   A    + D Y QAASNLVAG+NLE  IQ
Sbjct  114  APDSKSGTSASDAATANPNTDTYSQAASNLVAGSNLEQTIQ  154



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+   +DTVADVKKSIE +QG+  YPA+  MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIDANIDDTVADVKKSIEKIQGAETYPANLQMLIHQGKVLKDTTTLG  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFLVIML  74



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGKVLSDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A +TA                 A   A AP    +
Sbjct  61   ENQVTENNFLVIMLRQNKGSSSAAPAKTTANQAPPTQTVPVVPPQTSAAPAAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +      A A      +   D YGQAASNLVAG+NLEG IQ
Sbjct  121  ALAATATASAAPAVAVSTEADSYGQAASNLVAGSNLEGTIQ  161



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+V ENNF+V+M+
Sbjct  61   ENQVLENNFLVIML  74



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+V ENNF+V+M+
Sbjct  61   ENQVLENNFLVIML  74



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_006427691.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
 gb|ESR40931.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
Length=76

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 88/161 (55%), Gaps = 18/161 (11%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIIKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +           PA  +   + Y QAASNLVAGNNLE  IQ
Sbjct  103  APSSNSTPATGAPAQASQQTNTYSQAASNLVAGNNLEQTIQ  143



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVVENNFIVIML  74



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVVENNFIVIML  74



>ref|XP_010268454.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nelumbo 
nucifera]
Length=344

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE++VA+VKK IET QG  VYPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEASPEESVAEVKKIIETTQGE-VYPADQQMLIYQGKILKDDTTLE  59

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  60   SNKVAENSFLVIML  73



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|KDO46132.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=197

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|ACU20959.1| unknown [Glycine max]
Length=363

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 91/161 (57%), Gaps = 8/161 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +     +  +     T  S D YG AASNLVAG+NLE  IQ
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQ  153



>ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max]
 gb|ACU24437.1| unknown [Glycine max]
Length=363

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 91/161 (57%), Gaps = 8/161 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +     +  +     T  S D YG AASNLVAG+NLE  IQ
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQ  153



>ref|XP_003529480.1| PREDICTED: ubiquitin receptor RAD23b-like isoform 1 [Glycine 
max]
 gb|KHN39368.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=363

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 92/161 (57%), Gaps = 8/161 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S  A+T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPATTVSMSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +     +  +     T  S D YG AASNLVAG+NLE  IQ
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQ  153



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG HF+IEV+P DTV +VKK IE VQG+  YP+ Q +LI+QGKVLKD TT+E
Sbjct  1    MKVSVKTLKGNHFDIEVQPTDTVLNVKKQIEQVQGAQTYPSEQQLLIYQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+VVM+
Sbjct  61   ENKVTENTFLVVML  74



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEV   DT++DVKKSIET+ G   YPA+Q MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIEVNETDTISDVKKSIETIHGEQ-YPAAQQMLIHQGKVLKDETTLA  59

Query  267  DNKVAENNFVVVMM  308
            +N V E +F+V+M+
Sbjct  60   ENNVVEKSFIVIML  73



>ref|XP_001763027.1| predicted protein [Physcomitrella patens]
 gb|EDQ72232.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG HF++EV P DTV +VK+ IE  QG   +P SQ +LIHQGKVLKD TT+E
Sbjct  1    MKISVKTLKGNHFDLEVSPADTVLNVKRQIEDSQGKESFPCSQQLLIHQGKVLKDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN FVVVM+
Sbjct  61   ENKVSENGFVVVML  74



>gb|KJB67005.1| hypothetical protein B456_010G170000 [Gossypium raimondii]
Length=371

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 96/161 (60%), Gaps = 7/161 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HF+I V P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFQITVNPNDTVMAVKKNIEGIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E++F+VVM+        +  +  +A   +  PASST ++ AP   P   P     
Sbjct  61   DNKVSEDSFLVVML-------SKSKSLGSAGASSAQPASSTPSTIAPVSNPTPTPEAPTQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQ  569
            +        A   A    + + Y QAASNLVAG+NLE  IQ
Sbjct  114  APASMGTTSASDAATANPNTNTYSQAASNLVAGSNLEQTIQ  154



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG+ FEIEV P   V D+KK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIEVDPTSKVVDLKKLIENTQGQNVYPADQQMLIHQGNVLKNDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVLENNFIVIML  74



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG+ FEIEV P   V D+KK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIEVDPTSKVVDLKKLIENTQGQNVYPADQQMLIHQGNVLKNDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVLENNFIVIML  74



>gb|KDO46130.1| hypothetical protein CISIN_1g0198171mg, partial [Citrus sinensis]
Length=260

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|KDO46129.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=274

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGTHFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTVMAVKKNIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKV+E+ F+VVM+
Sbjct  61   QNKVSEDGFLVVML  74



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTT  260
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETT  58



>gb|ACJ84340.1| unknown [Medicago truncatula]
Length=110

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V P D++  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVHPSDSIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+FEIE  P+ +VA+VK+ IET QG + YPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVAEVKRIIETTQGQSTYPADQQMLIYQGKILKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   SNGVAENSFLVIML  74



>gb|KDO46131.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=267

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960