BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027O14

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241867.1|  PREDICTED: patellin-3-like                       67.0    9e-10   
ref|XP_006356506.1|  PREDICTED: patellin-2-like                       67.0    1e-09   Solanum tuberosum [potatoes]
ref|XP_009612346.1|  PREDICTED: patellin-3-like                       67.0    1e-09   Nicotiana tomentosiformis
ref|XP_009775359.1|  PREDICTED: patellin-3-like                       66.6    1e-09   Nicotiana sylvestris
ref|XP_009617344.1|  PREDICTED: patellin-3-like                       65.9    2e-09   Nicotiana tomentosiformis
ref|XP_009774158.1|  PREDICTED: patellin-3-like                       65.9    3e-09   Nicotiana sylvestris
ref|XP_006339369.1|  PREDICTED: patellin-2-like                       64.7    6e-09   
gb|EYU28219.1|  hypothetical protein MIMGU_mgv1a004573mg              64.3    6e-09   Erythranthe guttata [common monkey flower]
ref|XP_011096139.1|  PREDICTED: patellin-3-like                       64.3    8e-09   Sesamum indicum [beniseed]
ref|XP_004250845.1|  PREDICTED: patellin-3-like                       63.2    2e-08   Solanum lycopersicum
ref|XP_011074963.1|  PREDICTED: patellin-3-like                       61.6    5e-08   Sesamum indicum [beniseed]
emb|CDP10711.1|  unnamed protein product                              61.6    6e-08   Coffea canephora [robusta coffee]
ref|XP_006473247.1|  PREDICTED: patellin-2-like                       60.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_006434672.1|  hypothetical protein CICLE_v10000682mg           60.5    1e-07   Citrus clementina [clementine]
gb|KDO84006.1|  hypothetical protein CISIN_1g008033mg                 60.1    1e-07   Citrus sinensis [apfelsine]
gb|KHG10355.1|  Patellin-5 -like protein                              58.9    4e-07   Gossypium arboreum [tree cotton]
gb|KJB60073.1|  hypothetical protein B456_009G288200                  58.9    5e-07   Gossypium raimondii
gb|KJB60074.1|  hypothetical protein B456_009G288200                  58.5    5e-07   Gossypium raimondii
gb|KJB81308.1|  hypothetical protein B456_013G138100                  58.5    5e-07   Gossypium raimondii
gb|KJB81305.1|  hypothetical protein B456_013G138100                  58.5    5e-07   Gossypium raimondii
gb|KJB81306.1|  hypothetical protein B456_013G138100                  58.5    5e-07   Gossypium raimondii
gb|KHG00007.1|  Patellin-5 -like protein                              58.5    5e-07   Gossypium arboreum [tree cotton]
gb|KJB81307.1|  hypothetical protein B456_013G138100                  58.2    6e-07   Gossypium raimondii
ref|XP_006466197.1|  PREDICTED: patellin-3-like                       58.2    8e-07   Citrus sinensis [apfelsine]
ref|XP_006426421.1|  hypothetical protein CICLE_v10025217mg           57.8    9e-07   Citrus clementina [clementine]
gb|KDO58730.1|  hypothetical protein CISIN_1g007602mg                 57.8    9e-07   Citrus sinensis [apfelsine]
ref|XP_002521801.1|  Patellin-3, putative                             57.4    1e-06   Ricinus communis
gb|KEH29319.1|  patellin-like protein                                 56.6    2e-06   Medicago truncatula
gb|KEH29320.1|  patellin-like protein                                 57.0    2e-06   Medicago truncatula
dbj|BAE71201.1|  putative cytosolic factor                            56.2    3e-06   Trifolium pratense [peavine clover]
ref|XP_011464747.1|  PREDICTED: patellin-3-like isoform X2            56.2    3e-06   Fragaria vesca subsp. vesca
ref|XP_004299816.1|  PREDICTED: patellin-3-like isoform X1            56.2    3e-06   Fragaria vesca subsp. vesca
ref|XP_010910878.1|  PREDICTED: patellin-3-like isoform X1            55.5    5e-06   Elaeis guineensis
ref|XP_010910883.1|  PREDICTED: patellin-3-like isoform X2            55.5    5e-06   Elaeis guineensis
gb|AAK82462.1|  At1g72160/T9N14_8                                     55.1    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177361.1|  patellin-3                                          55.1    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506377.1|  PREDICTED: patellin-2-like                       55.1    8e-06   Cicer arietinum [garbanzo]
ref|XP_009362426.1|  PREDICTED: patellin-3-like                       55.1    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_008361618.1|  PREDICTED: patellin-3-like                       55.1    8e-06   
ref|XP_008339156.1|  PREDICTED: patellin-3-like                       55.1    8e-06   
ref|XP_004170401.1|  PREDICTED: patellin-3-like                       54.7    9e-06   
ref|XP_006371458.1|  hypothetical protein POPTR_0019s10830g           54.7    1e-05   Populus trichocarpa [western balsam poplar]
gb|KGN52721.1|  hypothetical protein Csa_5G652260                     54.7    1e-05   Cucumis sativus [cucumbers]
ref|XP_006376222.1|  hypothetical protein POPTR_0013s11070g           54.7    1e-05   Populus trichocarpa [western balsam poplar]
gb|ACN27998.1|  unknown                                               54.3    1e-05   Zea mays [maize]
ref|XP_003540055.1|  PREDICTED: patellin-2-like isoform X1            54.7    1e-05   Glycine max [soybeans]
ref|XP_011031501.1|  PREDICTED: patellin-3                            54.7    1e-05   Populus euphratica
ref|XP_006591943.1|  PREDICTED: patellin-2-like isoform X3            54.3    1e-05   
ref|XP_006591942.1|  PREDICTED: patellin-2-like isoform X2            54.3    1e-05   Glycine max [soybeans]
ref|NP_001150957.1|  LOC100284590                                     54.3    1e-05   
gb|EYU22784.1|  hypothetical protein MIMGU_mgv1a003476mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_003526897.2|  PREDICTED: patellin-1-like                       54.3    1e-05   
ref|XP_008459681.1|  PREDICTED: patellin-3-like                       54.3    1e-05   
ref|XP_009379334.1|  PREDICTED: patellin-3-like                       54.3    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_002271899.2|  PREDICTED: patellin-3-like                       54.3    1e-05   Vitis vinifera
ref|XP_003522462.1|  PREDICTED: patellin-3-like                       54.3    1e-05   Glycine max [soybeans]
gb|KHN09674.1|  Patellin-3                                            53.9    1e-05   Glycine soja [wild soybean]
ref|XP_010095907.1|  hypothetical protein L484_008304                 53.9    2e-05   Morus notabilis
gb|EPS65885.1|  hypothetical protein M569_08890                       53.9    2e-05   Genlisea aurea
ref|XP_008442083.1|  PREDICTED: patellin-3-like                       53.9    2e-05   Cucumis melo [Oriental melon]
gb|KEH35657.1|  patellin-3 protein                                    53.9    2e-05   Medicago truncatula
ref|XP_003531832.1|  PREDICTED: patellin-3-like isoform X1            53.9    2e-05   Glycine max [soybeans]
ref|XP_006585750.1|  PREDICTED: patellin-3-like isoform X2            53.5    2e-05   Glycine max [soybeans]
ref|XP_004970742.1|  PREDICTED: patellin-1-like                       53.5    2e-05   Setaria italica
gb|KHM98825.1|  Patellin-3                                            53.5    2e-05   Glycine soja [wild soybean]
ref|XP_007020115.1|  SEC14 cytosolic factor family protein / phos...  52.8    4e-05   
ref|XP_007020114.1|  SEC14 cytosolic factor family protein / phos...  52.8    4e-05   
ref|XP_002888860.1|  SEC14 cytosolic factor family protein            52.4    5e-05   Arabidopsis lyrata subsp. lyrata
dbj|BAD82082.1|  cytosolic factor-like protein                        52.0    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003948.1|  PREDICTED: patellin-3-like                       52.4    6e-05   Populus euphratica
ref|XP_011011644.1|  PREDICTED: patellin-3-like                       52.4    6e-05   Populus euphratica
ref|NP_001044958.1|  Os01g0874700                                     52.4    6e-05   
ref|XP_010244944.1|  PREDICTED: patellin-3-like                       52.4    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006384383.1|  hypothetical protein POPTR_0004s14530g           52.4    6e-05   
gb|KDP27342.1|  hypothetical protein JCGZ_20274                       52.4    6e-05   Jatropha curcas
gb|EAY76673.1|  hypothetical protein OsI_04628                        52.0    7e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004146380.1|  PREDICTED: patellin-3-like                       52.0    7e-05   Cucumis sativus [cucumbers]
ref|XP_008657015.1|  PREDICTED: patellin-3-like                       52.0    7e-05   
ref|XP_007137815.1|  hypothetical protein PHAVU_009G157900g           52.0    7e-05   Phaseolus vulgaris [French bean]
ref|XP_007224786.1|  hypothetical protein PRUPE_ppa023884mg           52.0    8e-05   
ref|XP_004173579.1|  PREDICTED: patellin-3-like                       52.0    8e-05   
ref|XP_006645095.1|  PREDICTED: patellin-1-like                       52.0    9e-05   Oryza brachyantha
gb|EAZ14338.1|  hypothetical protein OsJ_04261                        51.6    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDM85203.1|  unnamed protein product                              51.6    1e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008378750.1|  PREDICTED: patellin-3-like                       51.2    1e-04   
ref|XP_010245412.1|  PREDICTED: patellin-3-like                       51.2    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_003564746.1|  PREDICTED: patellin-3-like                       51.2    1e-04   Brachypodium distachyon [annual false brome]
ref|XP_002325736.2|  hypothetical protein POPTR_0019s00780g           51.2    1e-04   
ref|XP_010534098.1|  PREDICTED: patellin-3-like                       51.2    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_006387528.1|  hypothetical protein POPTR_0895s00200g           51.2    1e-04   
dbj|BAJ87818.1|  predicted protein                                    51.2    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABB77236.1|  patellin 1                                            51.2    2e-04   Cucurbita pepo
ref|XP_011001253.1|  PREDICTED: patellin-3-like                       51.2    2e-04   Populus euphratica
ref|XP_011015061.1|  PREDICTED: patellin-3-like                       51.2    2e-04   Populus euphratica
ref|XP_010535265.1|  PREDICTED: patellin-1-like                       50.8    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_004299815.1|  PREDICTED: patellin-3                            50.8    2e-04   Fragaria vesca subsp. vesca
ref|XP_011015062.1|  PREDICTED: patellin-1-like                       50.4    2e-04   Populus euphratica
gb|KDP31746.1|  hypothetical protein JCGZ_14978                       50.8    2e-04   Jatropha curcas
ref|XP_002456720.1|  hypothetical protein SORBIDRAFT_03g041370        50.4    2e-04   
ref|XP_010930773.1|  PREDICTED: patellin-3-like                       50.4    2e-04   Elaeis guineensis
ref|XP_008378744.1|  PREDICTED: patellin-3-like                       50.1    3e-04   
ref|XP_009362429.1|  PREDICTED: patellin-3-like                       50.1    3e-04   
gb|KHG11540.1|  Patellin-5 -like protein                              50.1    3e-04   Gossypium arboreum [tree cotton]
gb|KJB18714.1|  hypothetical protein B456_003G066500                  49.7    4e-04   Gossypium raimondii
ref|XP_009410675.1|  PREDICTED: patellin-3-like                       49.7    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909148.1|  PREDICTED: patellin-3-like isoform X2            49.7    4e-04   Elaeis guineensis
ref|XP_010909147.1|  PREDICTED: patellin-3-like isoform X1            49.7    4e-04   
ref|XP_007222319.1|  hypothetical protein PRUPE_ppa003964mg           49.7    5e-04   Prunus persica
ref|XP_002521798.1|  Patellin-5, putative                             49.7    5e-04   Ricinus communis
ref|XP_010471234.1|  PREDICTED: patellin-3                            49.7    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008219012.1|  PREDICTED: patellin-3                            49.7    5e-04   Prunus mume [ume]
ref|XP_008783367.1|  PREDICTED: patellin-3-like                       49.7    5e-04   Phoenix dactylifera
ref|XP_002525405.1|  Patellin-3, putative                             49.7    5e-04   Ricinus communis
ref|XP_007020127.1|  Sec14p-like phosphatidylinositol transfer fa...  48.9    8e-04   
ref|XP_007020120.1|  Sec14p-like phosphatidylinositol transfer fa...  48.9    8e-04   
ref|XP_011031504.1|  PREDICTED: patellin-3                            48.9    8e-04   Populus euphratica
ref|XP_008807685.1|  PREDICTED: patellin-3-like                       48.9    8e-04   Phoenix dactylifera
ref|XP_007020128.1|  Sec14p-like phosphatidylinositol transfer fa...  48.9    8e-04   
ref|XP_007049994.1|  SEC14 cytosolic factor family protein / phos...  48.9    8e-04   
gb|EMT12738.1|  hypothetical protein F775_27688                       48.9    9e-04   



>ref|XP_004241867.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=580

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL EFK +VQEALN H+FT
Sbjct  63   SNSFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFT  101



>ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=577

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL EFK +VQEALN H+FT
Sbjct  62   SNSFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFT  100



>ref|XP_009612346.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=569

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL EFK L+QEALN H+FT
Sbjct  64   STSFKEESNKVEELPNPEQKALAEFKQLIQEALNTHEFT  102



>ref|XP_009775359.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=566

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL EFK L+QEALN H+FT
Sbjct  64   STSFKEESNKVEELPNPEQKALAEFKQLIQEALNKHEFT  102



>ref|XP_009617344.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=629

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL E K LVQEALN H+FT
Sbjct  72   SASFKEESNKVEELPNPEQKALAELKQLVQEALNKHEFT  110



>ref|XP_009774158.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=631

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL E K LVQEALN H+FT
Sbjct  72   SASFKEESNKVEELPNPEQKALAELKQLVQEALNKHEFT  110



>ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=616

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKVEELPNPE+KAL E K LVQ+ALN H+FT
Sbjct  71   SASFKEESNKVEELPNPEQKALAELKQLVQDALNKHEFT  109



>gb|EYU28219.1| hypothetical protein MIMGU_mgv1a004573mg [Erythranthe guttata]
Length=520

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKV++L +PEKKALDEFK L+QEALN H+FT
Sbjct  63   SASFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFT  101



>ref|XP_011096139.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=601

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKV++L +PEKKALDEFK L+QEALN H+FT
Sbjct  77   SASFKEESNKVDDLIDPEKKALDEFKKLIQEALNKHEFT  115



>ref|XP_004250845.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=589

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKV+ELPNPE+KAL E K LVQ+ALN H+FT
Sbjct  63   SASFKEESNKVDELPNPEQKALAELKELVQDALNKHEFT  101



>ref|XP_011074963.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=581

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKV++L +PEKKALDEFK L++EALN H+FT
Sbjct  70   SASFKEESNKVDDLIDPEKKALDEFKLLIREALNKHEFT  108



>emb|CDP10711.1| unnamed protein product [Coffea canephora]
Length=620

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N VEELP+P+KKA+DEFK L++EAL+ H+FT
Sbjct  73   SASFKEETNVVEELPDPQKKAIDEFKKLIREALDKHEFT  111



>ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis]
 gb|KDO84005.1| hypothetical protein CISIN_1g008033mg [Citrus sinensis]
Length=580

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V ELP+P+KKALDE K L+Q+ALN H+FT
Sbjct  71   SASFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFT  109



>ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
 gb|ESR47912.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
Length=582

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V ELP+P+KKALDE K L+Q+ALN H+FT
Sbjct  70   SASFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFT  108



>gb|KDO84006.1| hypothetical protein CISIN_1g008033mg [Citrus sinensis]
Length=454

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V ELP+P+KKALDE K L+Q+ALN H+FT
Sbjct  71   SASFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFT  109



>gb|KHG10355.1| Patellin-5 -like protein [Gossypium arboreum]
Length=600

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP P+KKALDE K L+QEALNNH+FT
Sbjct  78   SVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT  116



>gb|KJB60073.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=598

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP P+KKALDE K L+QEALNNH+FT
Sbjct  78   SVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT  116



>gb|KJB60074.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=467

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP P+KKALDE K L+QEALNNH+FT
Sbjct  78   SVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT  116



>gb|KJB81308.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=590

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP+P+KKALDE K L+QEALN H+FT
Sbjct  64   SASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT  102



>gb|KJB81305.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=591

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP+P+KKALDE K L+QEALN H+FT
Sbjct  64   SASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT  102



>gb|KJB81306.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=573

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP+P+KKALDE K L+QEALN H+FT
Sbjct  64   SASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT  102



>gb|KHG00007.1| Patellin-5 -like protein [Gossypium arboreum]
Length=521

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP+P+KKALDE K L+QEALN H+FT
Sbjct  64   SASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT  102



>gb|KJB81307.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=465

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N   ELP+P+KKALDE K L+QEALN H+FT
Sbjct  64   SASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT  102



>ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis]
Length=594

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES +V +LP+ EKKALDE K +VQEALN H+F+
Sbjct  77   SGSFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFS  115



>ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
 gb|ESR39661.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
Length=596

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES +V +LP+ EKKALDE K +VQEALN H+F+
Sbjct  77   SGSFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFS  115



>gb|KDO58730.1| hypothetical protein CISIN_1g007602mg [Citrus sinensis]
Length=596

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES +V +LP+ EKKALDE K +VQEALN H+F+
Sbjct  77   SGSFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFS  115



>ref|XP_002521801.1| Patellin-3, putative [Ricinus communis]
 gb|EEF40611.1| Patellin-3, putative [Ricinus communis]
Length=627

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKALDEFK L+QEALN H+FT
Sbjct  85   SVSFKEETNVVGELPEAQKKALDEFKQLIQEALNKHEFT  123



>gb|KEH29319.1| patellin-like protein [Medicago truncatula]
Length=464

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP+ +KKALDE K L+QEALN H+FT
Sbjct  86   SVSFKEETNVVSELPDVQKKALDELKQLIQEALNKHEFT  124



>gb|KEH29320.1| patellin-like protein [Medicago truncatula]
Length=595

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP+ +KKALDE K L+QEALN H+FT
Sbjct  86   SVSFKEETNVVSELPDVQKKALDELKQLIQEALNKHEFT  124



>dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense]
Length=607

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKALDE K L+QEALN H+FT
Sbjct  77   SVSFKEETNVVSELPESQKKALDELKQLIQEALNKHEFT  115



>ref|XP_011464747.1| PREDICTED: patellin-3-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=588

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKALDE K L+QEALN H+FT
Sbjct  71   SVSFKEESYVVGELPEPQKKALDELKQLIQEALNKHEFT  109



>ref|XP_004299816.1| PREDICTED: patellin-3-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=603

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKALDE K L+QEALN H+FT
Sbjct  71   SVSFKEESYVVGELPEPQKKALDELKQLIQEALNKHEFT  109



>ref|XP_010910878.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=576

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEESN V +L +PEKKALDE K LVQ AL N++FT
Sbjct  72   SGSFKEESNVVGDLQDPEKKALDEIKQLVQAALANNEFT  110



>ref|XP_010910883.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=575

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEESN V +L +PEKKALDE K LVQ AL N++FT
Sbjct  72   SGSFKEESNVVGDLQDPEKKALDEIKQLVQAALANNEFT  110



>gb|AAK82462.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
 gb|AAM91383.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
Length=390

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEES+K+ +L N EKK+LDE K LV+EAL+NH FT
Sbjct  7    GSFKEESSKLSDLSNSEKKSLDELKHLVREALDNHQFT  44



>ref|NP_177361.1| patellin-3 [Arabidopsis thaliana]
 sp|Q56Z59.2|PATL3_ARATH RecName: Full=Patellin-3 [Arabidopsis thaliana]
 gb|AAG51796.1|AC067754_12 cytosolic factor, putative; 19554-17768 [Arabidopsis thaliana]
 gb|AEE35283.1| patellin-3 [Arabidopsis thaliana]
Length=490

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEES+K+ +L N EKK+LDE K LV+EAL+NH FT
Sbjct  107  GSFKEESSKLSDLSNSEKKSLDELKHLVREALDNHQFT  144



>ref|XP_004506377.1| PREDICTED: patellin-2-like [Cicer arietinum]
Length=612

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            S SFKEE+N V ELP P+KKALDE K L+QEAL+ H+F
Sbjct  83   SVSFKEETNVVSELPEPQKKALDELKLLIQEALSKHEF  120



>ref|XP_009362426.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=610

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKAL+E K L+QEALN H+FT
Sbjct  79   SVSFKEESYVVSELPEPQKKALEELKVLIQEALNKHEFT  117



>ref|XP_008361618.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKAL+E K L+QEALN H+FT
Sbjct  79   SVSFKEESYVVSELPEPQKKALEELKVLIQEALNKHEFT  117



>ref|XP_008339156.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008368133.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKAL+E K L+QEALN H+FT
Sbjct  79   SVSFKEESYVVSELPEPQKKALEELKVLIQEALNKHEFT  117



>ref|XP_004170401.1| PREDICTED: patellin-3-like [Cucumis sativus]
Length=606

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  ++KAL + K L+QEALNNHDFT
Sbjct  70   SVSFKEETNVVSELPESQRKALADLKLLIQEALNNHDFT  108



>ref|XP_006371458.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
 gb|ERP49255.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
Length=623

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKALD+ K L+QEALN H+FT
Sbjct  83   SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEFT  121



>gb|KGN52721.1| hypothetical protein Csa_5G652260 [Cucumis sativus]
Length=606

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  ++KAL + K L+QEALNNHDFT
Sbjct  70   SVSFKEETNVVSELPESQRKALADLKLLIQEALNNHDFT  108



>ref|XP_006376222.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
 gb|ERP54019.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
Length=623

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKALD+ K L+QEALN H+FT
Sbjct  84   SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEFT  122



>gb|ACN27998.1| unknown [Zea mays]
 tpg|DAA56595.1| TPA: putative patellin family protein [Zea mays]
Length=571

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN VE+LP+PEKKALDEFK L+  AL   +F
Sbjct  62   TGSFKEESNLVEDLPDPEKKALDEFKQLIAAALAAGEF  99



>ref|XP_003540055.1| PREDICTED: patellin-2-like isoform X1 [Glycine max]
Length=606

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  +KKALDE K LVQEALNNH+ T
Sbjct  47   SVSFKEETNVVGDLPEAQKKALDELKKLVQEALNNHELT  85



>ref|XP_011031501.1| PREDICTED: patellin-3 [Populus euphratica]
Length=619

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKALD+ K L+QEALN H+FT
Sbjct  83   SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEFT  121



>ref|XP_006591943.1| PREDICTED: patellin-2-like isoform X3 [Glycine max]
Length=587

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  +KKALDE K LVQEALNNH+ T
Sbjct  47   SVSFKEETNVVGDLPEAQKKALDELKKLVQEALNNHELT  85



>ref|XP_006591942.1| PREDICTED: patellin-2-like isoform X2 [Glycine max]
Length=596

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  +KKALDE K LVQEALNNH+ T
Sbjct  47   SVSFKEETNVVGDLPEAQKKALDELKKLVQEALNNHELT  85



>ref|NP_001150957.1| LOC100284590 [Zea mays]
 gb|ACG41076.1| patellin-1 [Zea mays]
Length=567

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN VE+LP+PEKKALDEFK L+  AL   +F
Sbjct  62   TGSFKEESNLVEDLPDPEKKALDEFKQLIAAALAAGEF  99



>gb|EYU22784.1| hypothetical protein MIMGU_mgv1a003476mg [Erythranthe guttata]
Length=583

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNKV++L +PEKKALDE K L+ EAL   +FT
Sbjct  75   SASFKEESNKVDDLIDPEKKALDELKKLIHEALCKREFT  113



>ref|XP_003526897.2| PREDICTED: patellin-1-like [Glycine max]
Length=606

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES  V +LP  EKKAL E K L+QEALNNH+ +
Sbjct  128  SGSFKEESTIVSDLPETEKKALQELKQLIQEALNNHELS  166



>ref|XP_008459681.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=603

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  ++KAL + K L+QEALNNHDFT
Sbjct  72   SVSFKEETNVVAELPESQRKALADLKLLIQEALNNHDFT  110



>ref|XP_009379334.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=616

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKALDE K L++EALN H+FT
Sbjct  79   SVSFKEESYVVGELPEPQKKALDELKQLIKEALNKHEFT  117



>ref|XP_002271899.2| PREDICTED: patellin-3-like [Vitis vinifera]
Length=576

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES +V +LP  EKKAL+E K LVQ+ALN+H FT
Sbjct  77   SDSFKEESTRVSDLPETEKKALEELKQLVQDALNHHQFT  115



>ref|XP_003522462.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN31218.1| Patellin-5 [Glycine soja]
Length=557

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES  V +LP  EKKAL E K L+QEALN H+F+
Sbjct  79   SGSFKEESTIVSDLPETEKKALQELKQLIQEALNKHEFS  117



>gb|KHN09674.1| Patellin-3 [Glycine soja]
Length=557

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES  V +LP  EKKAL E K L+QEALNNH+ +
Sbjct  79   SGSFKEESTIVSDLPETEKKALQELKQLIQEALNNHELS  117



>ref|XP_010095907.1| hypothetical protein L484_008304 [Morus notabilis]
 gb|EXB62501.1| hypothetical protein L484_008304 [Morus notabilis]
Length=635

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP  +KKALDEFK L+QEAL+ H+FT
Sbjct  84   SVSFKEESYVVSELPEAQKKALDEFKQLIQEALSKHEFT  122



>gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlisea aurea]
Length=554

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESNK+E+L +PEKKALDE K L+QEAL+  +F+
Sbjct  70   SFKEESNKIEDLVDPEKKALDELKLLIQEALDKREFS  106



>ref|XP_008442083.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=570

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L + EKKAL+EFK L+QEALN H+FT
Sbjct  62   SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEFT  98



>gb|KEH35657.1| patellin-3 protein [Medicago truncatula]
Length=573

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES  V ELP  EKKAL E K L+QEALN H+F+
Sbjct  70   SGSFKEESTIVGELPEAEKKALAELKQLIQEALNKHEFS  108



>ref|XP_003531832.1| PREDICTED: patellin-3-like isoform X1 [Glycine max]
Length=576

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  ++KALDE K LVQEALNNH+ T
Sbjct  97   SVSFKEETNVVGDLPEAQRKALDELKRLVQEALNNHELT  135



>ref|XP_006585750.1| PREDICTED: patellin-3-like isoform X2 [Glycine max]
 ref|XP_006585751.1| PREDICTED: patellin-3-like isoform X3 [Glycine max]
Length=540

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  ++KALDE K LVQEALNNH+ T
Sbjct  61   SVSFKEETNVVGDLPEAQRKALDELKRLVQEALNNHELT  99



>ref|XP_004970742.1| PREDICTED: patellin-1-like [Setaria italica]
Length=597

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN VE+LP+PEKKALDEFK L+  AL   +F
Sbjct  62   AGSFKEESNLVEDLPDPEKKALDEFKQLIVAALAAGEF  99



>gb|KHM98825.1| Patellin-3 [Glycine soja]
Length=638

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  ++KALDE K LVQEALNNH+ T
Sbjct  95   SVSFKEETNVVGDLPEAQRKALDELKRLVQEALNNHELT  133



>ref|XP_007020115.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
 gb|EOY17340.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
Length=626

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKAL+E K L+QEALN H+FT
Sbjct  81   SVSFKEETNIVGELPESQKKALEELKQLIQEALNKHEFT  119



>ref|XP_007020114.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
 gb|EOY17339.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
Length=625

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V ELP  +KKAL+E K L+QEALN H+FT
Sbjct  81   SVSFKEETNIVGELPESQKKALEELKQLIQEALNKHEFT  119



>ref|XP_002888860.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65119.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEES+K+ +L N EKK+LDE K LV++AL+NH F+
Sbjct  105  GSFKEESSKLSDLSNSEKKSLDELKHLVRDALDNHQFS  142



>dbj|BAD82082.1| cytosolic factor-like protein [Oryza sativa Japonica Group]
Length=331

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  72   TGSFKEESNLVADLPDPEKKALDEFKQLIAAALAACEF  109



>ref|XP_011003948.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=629

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            S SFKEE+N V ELP  +KKALD+ K L+QEALN H+F
Sbjct  84   SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEF  121



>ref|XP_011011644.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=608

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L + EKKAL EFK LVQEALN H+F+
Sbjct  83   SFKEESTKVADLLDSEKKALQEFKQLVQEALNKHEFS  119



>ref|NP_001044958.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAB86220.1| P0648C09.9 [Oryza sativa Japonica Group]
 dbj|BAB92436.1| cytosolic factor-like protein [Oryza sativa Japonica Group]
 dbj|BAF06872.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAG93276.1| unnamed protein product [Oryza sativa Japonica Group]
Length=613

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  72   TGSFKEESNLVADLPDPEKKALDEFKQLIAAALAACEF  109



>ref|XP_010244944.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=578

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V +LP  EKKAL+EFK L+Q+AL  H+FT
Sbjct  61   SVSFKEESNVVADLPENEKKALEEFKQLIQQALEKHEFT  99



>ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
 gb|ERP62180.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
Length=583

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L + EKKAL EFK LVQEALN H+F+
Sbjct  76   SFKEESTKVADLLDSEKKALQEFKQLVQEALNKHEFS  112



>gb|KDP27342.1| hypothetical protein JCGZ_20274 [Jatropha curcas]
Length=589

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESNKV +L + E+KAL+E K LVQEALNNH F+
Sbjct  133  SFKEESNKVADLSDFERKALEELKHLVQEALNNHKFS  169



>gb|EAY76673.1| hypothetical protein OsI_04628 [Oryza sativa Indica Group]
Length=610

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  69   TGSFKEESNLVADLPDPEKKALDEFKQLIAAALAACEF  106



>ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus]
 gb|KGN54828.1| Patellin-3 [Cucumis sativus]
Length=568

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            SFKEES KV +L + EKKAL+EFK L+QEALN H+F
Sbjct  62   SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEF  97



>ref|XP_008657015.1| PREDICTED: patellin-3-like [Zea mays]
 gb|AFW84436.1| putative patellin family protein [Zea mays]
Length=556

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN VE+LP+PEKK LDEFK L+  AL   +F
Sbjct  59   TGSFKEESNLVEDLPDPEKKVLDEFKHLIAAALAAGEF  96



>ref|XP_007137815.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
 gb|ESW09809.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
Length=558

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SGSFKEES  V +LP  EKKAL E K L+QEAL+ H+F+
Sbjct  64   SGSFKEESTIVSDLPETEKKALQELKQLIQEALHKHEFS  102



>ref|XP_007224786.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
 gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
Length=584

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            S SFKEES  V ELP P+KKAL+E K L+QEALN H+F
Sbjct  40   SVSFKEESYVVGELPEPQKKALEELKQLIQEALNKHEF  77



>ref|XP_004173579.1| PREDICTED: patellin-3-like, partial [Cucumis sativus]
Length=468

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            SFKEES KV +L + EKKAL+EFK L+QEALN H+F
Sbjct  62   SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEF  97



>ref|XP_006645095.1| PREDICTED: patellin-1-like [Oryza brachyantha]
Length=605

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  67   TGSFKEESNLVADLPDPEKKALDEFKQLIAAALAAGEF  104



>gb|EAZ14338.1| hypothetical protein OsJ_04261 [Oryza sativa Japonica Group]
Length=595

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  72   TGSFKEESNLVADLPDPEKKALDEFKQLIAAALAACEF  109



>emb|CDM85203.1| unnamed protein product [Triticum aestivum]
Length=578

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  58   TGSFKEESNLVADLPDPEKKALDEFKELIVAALAAGEF  95



>ref|XP_008378750.1| PREDICTED: patellin-3-like [Malus domestica]
Length=615

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES  V ELP P+KKALDE K  + EALN H+FT
Sbjct  79   SVSFKEESYVVGELPEPQKKALDELKQXIXEALNKHEFT  117



>ref|XP_010245412.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=561

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEE+N V +LP  EKKAL+EFK L+Q+AL  H+FT
Sbjct  58   SVSFKEETNVVADLPENEKKALEEFKQLIQKALQKHEFT  96



>ref|XP_003564746.1| PREDICTED: patellin-3-like [Brachypodium distachyon]
Length=585

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  61   TGSFKEESNLVADLPDPEKKALDEFKQLIVAALAAGEF  98



>ref|XP_002325736.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
 gb|EEF00118.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
Length=605

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L   EKKAL EFK LVQEALN H+F+
Sbjct  81   SFKEESTKVADLLESEKKALQEFKKLVQEALNKHEFS  117



>ref|XP_010534098.1| PREDICTED: patellin-3-like [Tarenaya hassleriana]
Length=518

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            GSFKEESNK  +L + E K+LDE K LV++ALNNH F
Sbjct  127  GSFKEESNKPSDLSDSESKSLDELKQLVRDALNNHQF  163



>ref|XP_006387528.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
 gb|ERP46442.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
Length=605

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L   EKKAL EFK LVQEALN H+F+
Sbjct  81   SFKEESTKVADLLESEKKALQEFKKLVQEALNKHEFS  117



>dbj|BAJ87818.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN V +LP+PEKKALDEFK L+  AL   +F
Sbjct  57   TGSFKEESNLVADLPDPEKKALDEFKELIVAALAAGEF  94



>gb|ABB77236.1| patellin 1 [Cucurbita pepo]
Length=604

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V ELP  ++KAL + K L+QEALN H+FT
Sbjct  79   SVSFKEESNVVGELPESQRKALADLKVLIQEALNKHEFT  117



>ref|XP_011001253.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L   EKKAL EFK LVQEALN H+F+
Sbjct  81   SFKEESTKVADLLESEKKALQEFKQLVQEALNKHEFS  117



>ref|XP_011015061.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L   EKKAL EFK LVQEALN H+F+
Sbjct  81   SFKEESTKVADLLESEKKALQEFKQLVQEALNKHEFS  117



>ref|XP_010535265.1| PREDICTED: patellin-1-like [Tarenaya hassleriana]
Length=615

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES    ELP P++KAL+EFK LV+EALN  +FT
Sbjct  90   SDSFKEESYVASELPEPQRKALEEFKELVREALNKREFT  128



>ref|XP_004299815.1| PREDICTED: patellin-3 [Fragaria vesca subsp. vesca]
Length=542

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL EFK LVQEALN H F+
Sbjct  100  SFKEESNVVADLSDSERKALQEFKQLVQEALNTHQFS  136



>ref|XP_011015062.1| PREDICTED: patellin-1-like [Populus euphratica]
Length=427

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L   EKKAL EFK LVQEALN H+F+
Sbjct  81   SFKEESTKVADLLESEKKALQEFKQLVQEALNKHEFS  117



>gb|KDP31746.1| hypothetical protein JCGZ_14978 [Jatropha curcas]
Length=603

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESNK+ +L   EKKAL+EF+ LV EALN H+F+
Sbjct  90   SVSFKEESNKIADLLESEKKALEEFRQLVHEALNKHEFS  128



>ref|XP_002456720.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
 gb|EES01840.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
Length=580

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            +GSFKEESN VE+LP+PEKKALDEFK L+  AL    F
Sbjct  65   TGSFKEESNLVEDLPDPEKKALDEFKQLIAAALAAGGF  102



>ref|XP_010930773.1| PREDICTED: patellin-3-like [Elaeis guineensis]
Length=486

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            +F EESN V +L +PEKKALDE K LVQ AL NH+F+
Sbjct  64   TFTEESNLVTDLEDPEKKALDEIKQLVQAALANHEFS  100



>ref|XP_008378744.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008347858.1| PREDICTED: patellin-3-like [Malus domestica]
Length=515

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL E K LVQEALN H FT
Sbjct  82   SFKEESNVVADLSDSERKALQELKQLVQEALNTHQFT  118



>ref|XP_009362429.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=527

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL E K LVQEALN H FT
Sbjct  86   SFKEESNVVADLSDSERKALQELKQLVQEALNTHQFT  122



>gb|KHG11540.1| Patellin-5 -like protein [Gossypium arboreum]
Length=544

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            SGSFKEES +V +L + EKKAL + K LVQEALN H+F
Sbjct  71   SGSFKEESTRVVDLLDNEKKALQQLKQLVQEALNKHEF  108



>gb|KJB18714.1| hypothetical protein B456_003G066500 [Gossypium raimondii]
Length=573

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            SGSFKEES +V +L + EKKAL + K LVQEALN H+F
Sbjct  71   SGSFKEESTRVVDLLDIEKKALQQLKQLVQEALNKHEF  108



>ref|XP_009410675.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=564

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            S SFKEESN V +L +PEKKALDE K LVQ AL N++F
Sbjct  66   SVSFKEESNVVADLVDPEKKALDELKQLVQAALANNEF  103



>ref|XP_010909148.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=588

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V +L + EKKALDE K LVQ AL N+DFT
Sbjct  79   STSFKEESNVVGDLQDLEKKALDELKQLVQAALVNNDFT  117



>ref|XP_010909147.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=589

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEESN V +L + EKKALDE K LVQ AL N+DFT
Sbjct  79   STSFKEESNVVGDLQDLEKKALDELKQLVQAALVNNDFT  117



>ref|XP_007222319.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
 gb|EMJ23518.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
Length=537

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL E K LVQEALN H FT
Sbjct  100  SFKEESNIVADLSDSERKALQELKQLVQEALNGHQFT  136



>ref|XP_002521798.1| Patellin-5, putative [Ricinus communis]
 gb|EEF40608.1| Patellin-5, putative [Ricinus communis]
Length=587

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            SFKEESN V +L   EKKAL EFK LVQEALN H F
Sbjct  131  SFKEESNIVADLSESEKKALHEFKNLVQEALNTHQF  166



>ref|XP_010471234.1| PREDICTED: patellin-3 [Camelina sativa]
Length=524

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            GSFKEES+K+ +L   EKK+LDE K LV++AL+NH F
Sbjct  129  GSFKEESSKLSDLSESEKKSLDELKRLVRDALDNHQF  165



>ref|XP_008219012.1| PREDICTED: patellin-3 [Prunus mume]
Length=538

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL E K LVQEALN H FT
Sbjct  100  SFKEESNIVADLSDSERKALQELKQLVQEALNGHQFT  136



>ref|XP_008783367.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=581

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            S SFKEES+ V +L +PEKKALDE K LVQ AL N++FT
Sbjct  69   SVSFKEESSVVGDLQDPEKKALDEIKQLVQAALANNEFT  107



>ref|XP_002525405.1| Patellin-3, putative [Ricinus communis]
 gb|EEF36972.1| Patellin-3, putative [Ricinus communis]
Length=606

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEES KV +L + EKKA++E + LVQEALN H+FT
Sbjct  94   SFKEESTKVADLLDSEKKAVEELRQLVQEALNKHEFT  130



>ref|XP_007020127.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
8 [Theobroma cacao]
 gb|EOY17352.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
8 [Theobroma cacao]
Length=553

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEESNKV +L + E+KAL+E K  VQEA++ H FT
Sbjct  209  GSFKEESNKVADLSDFERKALEELKHFVQEAIDTHLFT  246



>ref|XP_007020120.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020121.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020122.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020123.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020124.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020125.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020126.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17345.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17346.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17347.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17348.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17349.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17350.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17351.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=611

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEESNKV +L + E+KAL+E K  VQEA++ H FT
Sbjct  209  GSFKEESNKVADLSDFERKALEELKHFVQEAIDTHLFT  246



>ref|XP_011031504.1| PREDICTED: patellin-3 [Populus euphratica]
 ref|XP_011031505.1| PREDICTED: patellin-3 [Populus euphratica]
Length=589

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  SFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            SFKEESN V +L + E+KAL+E K LVQEALN+H F+
Sbjct  135  SFKEESNLVSDLSDIERKALEELKQLVQEALNSHQFS  171



>ref|XP_008807685.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=559

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDF  364
            S SF+EESN+V  L  PEKKALDE K LVQ AL N +F
Sbjct  77   SVSFEEESNRVAALDGPEKKALDELKQLVQAALANREF  114



>ref|XP_007020128.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
 gb|EOY17353.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
Length=611

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  254  GSFKEESNKVEELPNPEKKALDEFKALVQEALNNHDFT  367
            GSFKEESNKV +L + E+KAL+E K  VQEA++ H FT
Sbjct  209  GSFKEESNKVADLSDFERKALEELKHFVQEAIDTHLFT  246



>ref|XP_007049994.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
 gb|EOX94151.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
Length=612

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQEALNNHD  361
            SGSFKEES++V +L   EKKAL+E K LVQEALN H+
Sbjct  79   SGSFKEESSRVADLLENEKKALEELKQLVQEALNKHE  115



>gb|EMT12738.1| hypothetical protein F775_27688 [Aegilops tauschii]
Length=424

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  SGSFKEESNKVEELPNPEKKALDEFKALVQ  340
            +GSFKEESN V +LP+PEKKALDEFK L++
Sbjct  59   TGSFKEESNLVADLPDPEKKALDEFKELIR  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720