BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027L02

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006845995.1|  hypothetical protein AMTR_s00155p00051130          263   5e-85   
ref|XP_011085197.1|  PREDICTED: obg-like ATPase 1                       266   2e-84   Sesamum indicum [beniseed]
ref|XP_004293982.1|  PREDICTED: obg-like ATPase 1                       265   4e-84   Fragaria vesca subsp. vesca
gb|KDP34925.1|  hypothetical protein JCGZ_09213                         265   5e-84   Jatropha curcas
ref|XP_008445378.1|  PREDICTED: obg-like ATPase 1                       265   8e-84   Cucumis melo [Oriental melon]
ref|XP_004231561.1|  PREDICTED: obg-like ATPase 1                       265   9e-84   Solanum lycopersicum
gb|KJB69091.1|  hypothetical protein B456_011G005000                    263   9e-84   Gossypium raimondii
gb|AAF65513.1|  GTP-binding protein                                     265   9e-84   Capsicum annuum
ref|XP_009362223.1|  PREDICTED: obg-like ATPase 1                       265   9e-84   Pyrus x bretschneideri [bai li]
gb|KJB69090.1|  hypothetical protein B456_011G005000                    263   9e-84   Gossypium raimondii
ref|XP_008225608.1|  PREDICTED: obg-like ATPase 1                       264   9e-84   Prunus mume [ume]
ref|XP_006360314.1|  PREDICTED: obg-like ATPase 1-like                  264   9e-84   Solanum tuberosum [potatoes]
ref|XP_008372236.1|  PREDICTED: obg-like ATPase 1                       264   1e-83   Malus domestica [apple tree]
ref|XP_007211399.1|  hypothetical protein PRUPE_ppa006821mg             264   1e-83   Prunus persica
ref|XP_004135546.1|  PREDICTED: obg-like ATPase 1-like                  264   1e-83   Cucumis sativus [cucumbers]
ref|XP_008383389.1|  PREDICTED: obg-like ATPase 1                       264   1e-83   Malus domestica [apple tree]
gb|KJB69089.1|  hypothetical protein B456_011G005000                    264   1e-83   Gossypium raimondii
gb|KHF97630.1|  Obg-like ATPase 1                                       264   1e-83   Gossypium arboreum [tree cotton]
emb|CDP17295.1|  unnamed protein product                                264   2e-83   Coffea canephora [robusta coffee]
gb|KJB69092.1|  hypothetical protein B456_011G005000                    262   2e-83   Gossypium raimondii
gb|EPS61253.1|  hypothetical protein M569_13545                         259   2e-83   Genlisea aurea
ref|XP_002523184.1|  GTP-dependent nucleic acid-binding protein e...    263   2e-83   Ricinus communis
ref|XP_011015196.1|  PREDICTED: obg-like ATPase 1                       263   3e-83   Populus euphratica
gb|AFK48623.1|  unknown                                                 263   3e-83   Lotus japonicus
ref|XP_006377958.1|  hypothetical protein POPTR_0011s16690g             263   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_002263885.1|  PREDICTED: obg-like ATPase 1                       262   5e-83   Vitis vinifera
ref|XP_008777315.1|  PREDICTED: obg-like ATPase 1                       255   5e-83   
ref|XP_011037748.1|  PREDICTED: obg-like ATPase 1                       262   6e-83   Populus euphratica
ref|XP_003546267.1|  PREDICTED: obg-like ATPase 1-like                  262   6e-83   Glycine max [soybeans]
ref|NP_001242520.1|  uncharacterized protein LOC100793501               262   6e-83   Glycine max [soybeans]
gb|EYU43227.1|  hypothetical protein MIMGU_mgv1a007827mg                262   7e-83   Erythranthe guttata [common monkey flower]
ref|XP_010245345.1|  PREDICTED: obg-like ATPase 1                       262   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_007147477.1|  hypothetical protein PHAVU_006G127800g             261   1e-82   Phaseolus vulgaris [French bean]
ref|XP_009603694.1|  PREDICTED: obg-like ATPase 1 {ECO:0000255|HA...    261   1e-82   Nicotiana tomentosiformis
gb|KDO75238.1|  hypothetical protein CISIN_1g015465mg                   257   2e-82   Citrus sinensis [apfelsine]
ref|XP_007022926.1|  GTP binding                                        261   2e-82   Theobroma cacao [chocolate]
ref|XP_004486463.1|  PREDICTED: obg-like ATPase 1-like                  261   2e-82   Cicer arietinum [garbanzo]
gb|KCW75747.1|  hypothetical protein EUGRSUZ_D00127                     258   5e-82   Eucalyptus grandis [rose gum]
ref|XP_009803590.1|  PREDICTED: obg-like ATPase 1                       260   5e-82   Nicotiana sylvestris
ref|XP_010098556.1|  Obg-like ATPase 1                                  259   6e-82   Morus notabilis
ref|XP_002300568.1|  hypothetical protein POPTR_0001s47010g             259   7e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011039799.1|  PREDICTED: obg-like ATPase 1                       259   8e-82   Populus euphratica
ref|XP_003594539.1|  Obg-like ATPase                                    259   8e-82   Medicago truncatula
ref|XP_006448885.1|  hypothetical protein CICLE_v10015175mg             261   8e-82   
gb|KEH37060.1|  50S ribosome-binding GTPase                             252   2e-81   Medicago truncatula
gb|KDO75237.1|  hypothetical protein CISIN_1g015465mg                   256   3e-81   Citrus sinensis [apfelsine]
ref|XP_006448884.1|  hypothetical protein CICLE_v10015175mg             257   5e-81   
ref|XP_010051911.1|  PREDICTED: obg-like ATPase 1                       257   5e-81   Eucalyptus grandis [rose gum]
ref|XP_006468322.1|  PREDICTED: obg-like ATPase 1-like                  257   6e-81   Citrus sinensis [apfelsine]
ref|XP_008799072.1|  PREDICTED: obg-like ATPase 1                       256   1e-80   Phoenix dactylifera
gb|KDO75236.1|  hypothetical protein CISIN_1g015465mg                   257   1e-80   Citrus sinensis [apfelsine]
gb|ACJ85184.1|  unknown                                                 256   1e-80   Medicago truncatula
ref|XP_009412029.1|  PREDICTED: obg-like ATPase 1                       256   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK49195.1|  unknown                                                 256   2e-80   Medicago truncatula
ref|XP_010519060.1|  PREDICTED: obg-like ATPase 1                       256   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_010926935.1|  PREDICTED: obg-like ATPase 1                       255   3e-80   Elaeis guineensis
ref|XP_010687083.1|  PREDICTED: obg-like ATPase 1                       255   4e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008812127.1|  PREDICTED: obg-like ATPase 1                       254   1e-79   
ref|XP_001776504.1|  predicted protein                                  252   6e-79   
ref|XP_010941555.1|  PREDICTED: obg-like ATPase 1                       252   6e-79   
ref|XP_006415450.1|  hypothetical protein EUTSA_v10007733mg             251   3e-78   
gb|ABK25108.1|  unknown                                                 249   5e-78   Picea sitchensis
emb|CDY12460.1|  BnaC08g09490D                                          249   8e-78   Brassica napus [oilseed rape]
ref|XP_009107765.1|  PREDICTED: obg-like ATPase 1                       249   1e-77   Brassica rapa
emb|CDX98216.1|  BnaC07g08820D                                          249   1e-77   
emb|CDY02308.1|  BnaA09g25940D                                          248   3e-77   
ref|XP_006305006.1|  hypothetical protein CARUB_v10009370mg             248   3e-77   Capsella rubella
emb|CDX77584.1|  BnaA07g07220D                                          248   3e-77   
ref|XP_002893634.1|  GTP binding protein                                247   4e-77   Arabidopsis lyrata subsp. lyrata
ref|NP_174346.1|  GTP-binding protein                                   247   4e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63059.1|  putative GTP-binding protein                            247   4e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44867.1|  hypothetical protein AALP_AA1G312800                    247   7e-77   Arabis alpina [alpine rockcress]
ref|XP_009115125.1|  PREDICTED: obg-like ATPase 1                       246   2e-76   Brassica rapa
ref|XP_010478480.1|  PREDICTED: obg-like ATPase 1                       244   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010499597.1|  PREDICTED: obg-like ATPase 1                       244   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009144765.1|  PREDICTED: obg-like ATPase 1                       244   1e-75   Brassica rapa
gb|EEC83063.1|  hypothetical protein OsI_28170                          243   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_010460862.1|  PREDICTED: obg-like ATPase 1                       243   2e-75   Camelina sativa [gold-of-pleasure]
ref|NP_001061206.2|  Os08g0199300                                       242   3e-75   
ref|XP_006659204.1|  PREDICTED: obg-like ATPase 1-like                  240   2e-74   Oryza brachyantha
ref|XP_010538270.1|  PREDICTED: obg-like ATPase 1                       239   7e-74   Tarenaya hassleriana [spider flower]
emb|CDY09558.1|  BnaC05g23610D                                          238   3e-73   Brassica napus [oilseed rape]
ref|XP_003573525.1|  PREDICTED: obg-like ATPase 1                       237   5e-73   Brachypodium distachyon [annual false brome]
emb|CDM85617.1|  unnamed protein product                                235   3e-72   Triticum aestivum [Canadian hard winter wheat]
gb|EMT28525.1|  Obg-like ATPase 1                                       235   3e-72   
gb|EMS48297.1|  Obg-like ATPase 1                                       235   3e-72   Triticum urartu
ref|XP_002445191.1|  hypothetical protein SORBIDRAFT_07g005700          234   4e-72   Sorghum bicolor [broomcorn]
gb|AFW56960.1|  hypothetical protein ZEAMMB73_810066                    233   9e-72   
ref|NP_001150211.1|  GTP-binding protein PTD004                         233   1e-71   Zea mays [maize]
ref|XP_004972629.1|  PREDICTED: obg-like ATPase 1-like                  232   4e-71   Setaria italica
gb|AGF69175.1|  putative GTP-binding protein                            223   2e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005650863.1|  flagellar associated protein                       224   4e-68   Coccomyxa subellipsoidea C-169
ref|XP_002985543.1|  hypothetical protein SELMODRAFT_234816             224   5e-68   Selaginella moellendorffii
gb|EMT28526.1|  Obg-like ATPase 1                                       223   8e-68   
gb|KDO75234.1|  hypothetical protein CISIN_1g015465mg                   211   3e-63   Citrus sinensis [apfelsine]
ref|XP_002953429.1|  hypothetical protein VOLCADRAFT_105955             211   5e-63   Volvox carteri f. nagariensis
ref|XP_001699763.1|  flagellar associated protein                       206   5e-61   Chlamydomonas reinhardtii
ref|XP_005703761.1|  GTP-binding protein                                204   2e-60   Galdieria sulphuraria
ref|XP_005535678.1|  GTP-binding protein of Obg family                  201   3e-59   Cyanidioschyzon merolae strain 10D
gb|KDD75506.1|  DUF933 hypothetical protein                             197   8e-58   Helicosporidium sp. ATCC 50920
ref|XP_008397279.1|  PREDICTED: obg-like ATPase 1 isoform X2            194   2e-56   
ref|XP_008397269.1|  PREDICTED: obg-like ATPase 1 isoform X1            193   3e-56   Poecilia reticulata
ref|XP_007546548.1|  PREDICTED: obg-like ATPase 1                       193   4e-56   Poecilia formosa
ref|XP_006636566.1|  PREDICTED: obg-like ATPase 1-like isoform X1       193   4e-56   Lepisosteus oculatus
ref|XP_005716907.1|  GTP-binding protein of Obg family                  192   1e-55   Chondrus crispus [carageen]
ref|XP_010291164.1|  PREDICTED: obg-like ATPase 1                       187   1e-55   Phaethon lepturus
ref|XP_005847323.1|  hypothetical protein CHLNCDRAFT_56178              191   3e-55   Chlorella variabilis
gb|EFX64851.1|  hypothetical protein DAPPUDRAFT_333762                  191   3e-55   Daphnia pulex
ref|XP_010226941.1|  PREDICTED: obg-like ATPase 1                       186   3e-55   Tinamus guttatus
ref|XP_008297045.1|  PREDICTED: obg-like ATPase 1                       190   5e-55   Stegastes partitus
ref|XP_006788528.1|  PREDICTED: obg-like ATPase 1-like                  189   1e-54   Neolamprologus brichardi [lyretail cichlid]
gb|KFP77737.1|  Obg-like ATPase 1                                       187   1e-54   Acanthisitta chloris
ref|XP_006003587.1|  PREDICTED: obg-like ATPase 1 isoform X1            189   2e-54   Latimeria chalumnae
ref|XP_005723544.1|  PREDICTED: obg-like ATPase 1-like isoform X1       189   2e-54   Pundamilia nyererei
gb|EMS48298.1|  Obg-like ATPase 1                                       187   2e-54   Triticum urartu
gb|AAY14779.1|  unknown                                                 182   3e-54   Homo sapiens [man]
emb|CEG00523.1|  P-loop containing nucleoside triphosphate hydrolase    188   3e-54   Ostreococcus tauri
gb|KFG38985.1|  putative GTP-binding protein                            182   3e-54   Toxoplasma gondii FOU
ref|XP_009553897.1|  PREDICTED: obg-like ATPase 1                       188   3e-54   Cuculus canorus
ref|XP_002198993.1|  PREDICTED: obg-like ATPase 1 isoform 1             188   3e-54   Taeniopygia guttata
gb|EFB23886.1|  hypothetical protein PANDA_008995                       184   3e-54   Ailuropoda melanoleuca
ref|XP_004341541.1|  GTP binding protein                                188   4e-54   Acanthamoeba castellanii str. Neff
ref|XP_006683298.1|  hypothetical protein BATDEDRAFT_33861              188   4e-54   Batrachochytrium dendrobatidis JAM81
ref|XP_008933239.1|  PREDICTED: obg-like ATPase 1                       188   4e-54   Merops nubicus
ref|XP_008526497.1|  PREDICTED: obg-like ATPase 1                       182   4e-54   Equus przewalskii [Przewalski horse]
ref|XP_009680050.1|  PREDICTED: obg-like ATPase 1                       187   4e-54   Struthio camelus australis
ref|XP_008503320.1|  PREDICTED: obg-like ATPase 1                       187   4e-54   Calypte anna
ref|XP_005519864.1|  PREDICTED: obg-like ATPase 1 isoform X1            187   5e-54   
gb|KFO72251.1|  Obg-like ATPase 1                                       188   5e-54   Cuculus canorus
ref|XP_010564826.1|  PREDICTED: obg-like ATPase 1                       187   5e-54   Haliaeetus leucocephalus
ref|XP_004557801.1|  PREDICTED: obg-like ATPase 1-like isoform X1       187   5e-54   Maylandia zebra
ref|XP_009070315.1|  PREDICTED: obg-like ATPase 1                       187   5e-54   Acanthisitta chloris
ref|XP_005152654.1|  PREDICTED: obg-like ATPase 1                       187   5e-54   Melopsittacus undulatus
ref|XP_008275154.1|  PREDICTED: obg-like ATPase 1                       187   5e-54   Stegastes partitus
ref|XP_010793340.1|  PREDICTED: obg-like ATPase 1                       187   6e-54   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011488562.1|  PREDICTED: obg-like ATPase 1                       182   6e-54   
ref|XP_009639084.1|  PREDICTED: obg-like ATPase 1                       187   6e-54   Egretta garzetta
ref|XP_010159477.1|  PREDICTED: obg-like ATPase 1                       183   6e-54   Eurypyga helias
ref|XP_005049114.1|  PREDICTED: obg-like ATPase 1                       187   6e-54   Ficedula albicollis
ref|XP_005818302.1|  hypothetical protein GUITHDRAFT_159055             186   6e-54   Guillardia theta CCMP2712
ref|XP_003961956.1|  PREDICTED: obg-like ATPase 1-like                  187   7e-54   Takifugu rubripes [tiger puffer]
ref|XP_009955691.1|  PREDICTED: obg-like ATPase 1                       179   8e-54   Leptosomus discolor
ref|XP_002920288.2|  PREDICTED: obg-like ATPase 1 isoform X1            182   9e-54   Ailuropoda melanoleuca
ref|XP_004347436.1|  GTP-binding protein                                187   9e-54   Capsaspora owczarzaki ATCC 30864
ref|XP_007430998.1|  PREDICTED: obg-like ATPase 1-like isoform X1       187   1e-53   Python bivittatus
ref|XP_006003588.1|  PREDICTED: obg-like ATPase 1 isoform X2            187   1e-53   Latimeria chalumnae
ref|XP_010736092.1|  PREDICTED: obg-like ATPase 1 isoform X1            187   1e-53   Larimichthys crocea [croceine croaker]
emb|CEP19285.1|  hypothetical protein                                   186   1e-53   Parasitella parasitica
ref|XP_008310339.1|  PREDICTED: obg-like ATPase 1                       186   1e-53   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001186941.1|  PREDICTED: obg-like ATPase 1-like                  185   2e-53   
ref|XP_010884736.1|  PREDICTED: obg-like ATPase 1                       186   2e-53   
gb|EGV95685.1|  Obg-like ATPase 1                                       183   2e-53   Cricetulus griseus [Chinese hamsters]
ref|XP_010712062.1|  PREDICTED: obg-like ATPase 1                       177   2e-53   Meleagris gallopavo [common turkey]
gb|ELK32737.1|  Obg-like ATPase 1                                       186   2e-53   Myotis davidii
ref|XP_008326510.1|  PREDICTED: obg-like ATPase 1 isoform X2            186   2e-53   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EET02224.1|  GTP-binding protein, putative                           186   2e-53   Giardia intestinalis ATCC 50581
gb|KGB37524.1|  Obg-like ATPase 1                                       186   2e-53   Schistosoma haematobium
gb|ESU42350.1|  GTPase, TGS domain protein                              186   2e-53   Giardia intestinalis
ref|XP_797209.1|  PREDICTED: obg-like ATPase 1-like                     186   3e-53   
gb|EFX64850.1|  hypothetical protein DAPPUDRAFT_219469                  186   3e-53   Daphnia pulex
dbj|BAG59026.1|  unnamed protein product                                182   3e-53   Homo sapiens [man]
ref|XP_010747153.1|  PREDICTED: obg-like ATPase 1                       186   3e-53   
ref|XP_005300475.1|  PREDICTED: obg-like ATPase 1 isoform X2            186   3e-53   Chrysemys picta bellii
emb|CCD81858.1|  GTP-binding protein-related                            186   3e-53   Schistosoma mansoni
ref|XP_007512524.1|  predicted protein                                  186   3e-53   Bathycoccus prasinos
gb|AAH77496.1|  Ola1 protein                                            182   3e-53   Xenopus laevis [clawed frog]
gb|KII61429.1|  Obg-like ATPase 1                                       179   3e-53   Thelohanellus kitauei
ref|NP_001158828.1|  obg-like ATPase 1                                  185   4e-53   Salmo salar
gb|AAH13925.1|  OLA1 protein                                            182   4e-53   Homo sapiens [man]
ref|NP_084367.1|  obg-like ATPase 1 isoform b                           182   4e-53   Mus musculus [mouse]
ref|XP_008397950.1|  PREDICTED: obg-like ATPase 1                       185   5e-53   Poecilia reticulata
ref|XP_006204987.1|  PREDICTED: obg-like ATPase 1-like                  177   5e-53   Vicugna pacos
ref|XP_007576845.1|  PREDICTED: obg-like ATPase 1                       185   5e-53   Poecilia formosa
ref|XP_005798398.1|  PREDICTED: obg-like ATPase 1-like                  185   5e-53   Xiphophorus maculatus
ref|XP_003442972.1|  PREDICTED: obg-like ATPase 1-like                  185   5e-53   Oreochromis niloticus
ref|XP_004004627.1|  PREDICTED: obg-like ATPase 1                       186   5e-53   
ref|XP_006798459.1|  PREDICTED: obg-like ATPase 1-like                  185   5e-53   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005723778.1|  PREDICTED: obg-like ATPase 1-like                  185   5e-53   Pundamilia nyererei
gb|ACO09273.1|  GTP-binding protein PTD004                              185   6e-53   Osmerus mordax
ref|XP_006116548.1|  PREDICTED: obg-like ATPase 1 isoform X3            185   6e-53   
ref|XP_003764019.1|  PREDICTED: obg-like ATPase 1                       184   7e-53   Sarcophilus harrisii
ref|NP_001026425.1|  obg-like ATPase 1                                  184   7e-53   Gallus gallus [bantam]
ref|XP_005452973.1|  PREDICTED: obg-like ATPase 1-like isoform X4       184   7e-53   Oreochromis niloticus
emb|CDQ57167.1|  unnamed protein product                                184   8e-53   Oncorhynchus mykiss
gb|ABG67106.1|  GTP-binding protein PTD004                              176   8e-53   Bos taurus [bovine]
ref|XP_001708009.1|  GTP-binding protein, putative                      184   8e-53   Giardia lamblia ATCC 50803
gb|ESU36180.1|  GTPase, TGS domain protein                              184   9e-53   Giardia intestinalis
ref|XP_008878070.1|  GTP-binding protein YchF, variant 2                184   9e-53   Aphanomyces invadans
gb|ETE71660.1|  Obg-like ATPase 1                                       184   9e-53   Ophiophagus hannah
ref|XP_010878191.1|  PREDICTED: obg-like ATPase 1 isoform X3            184   9e-53   Esox lucius
ref|NP_001008044.1|  obg-like ATPase 1                                  184   9e-53   Xenopus tropicalis [western clawed frog]
ref|XP_004908585.1|  PREDICTED: obg-like ATPase 1-like                  176   9e-53   
emb|CAJ83205.1|  novel protein similar to GTP-binding protein PTD004    184   1e-52   Xenopus tropicalis [western clawed frog]
ref|XP_001421839.1|  predicted protein                                  184   1e-52   Ostreococcus lucimarinus CCE9901
gb|EFO62172.1|  GTP-binding protein, putative                           184   1e-52   Giardia lamblia P15
ref|XP_006174829.1|  PREDICTED: obg-like ATPase 1 isoform X2            181   1e-52   
ref|XP_008878069.1|  GTP-binding protein YchF, variant 1                184   1e-52   Aphanomyces invadans
ref|XP_009296560.1|  PREDICTED: obg-like ATPase 1                       176   1e-52   
ref|XP_008256981.1|  PREDICTED: obg-like ATPase 1 isoform X2            182   1e-52   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008885365.1|  GTP-binding protein, putative                      184   1e-52   
emb|CDQ81805.1|  unnamed protein product                                186   1e-52   Oncorhynchus mykiss
ref|XP_008685352.1|  PREDICTED: obg-like ATPase 1                       184   1e-52   Ursus maritimus [white bear]
ref|XP_002429861.1|  conserved hypothetical protein                     181   1e-52   Pediculus humanus corporis [human body lice]
ref|XP_005723545.1|  PREDICTED: obg-like ATPase 1-like isoform X2       184   2e-52   
ref|XP_001515633.1|  PREDICTED: obg-like ATPase 1 isoform X1            184   2e-52   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_004476855.1|  PREDICTED: obg-like ATPase 1 isoform 1             184   2e-52   
ref|XP_002370768.1|  GTP binding protein, putative                      183   2e-52   Toxoplasma gondii ME49
ref|XP_010605331.1|  PREDICTED: obg-like ATPase 1 isoform X1            184   2e-52   Fukomys damarensis [Damara mole rat]
ref|XP_003962811.1|  PREDICTED: obg-like ATPase 1-like                  183   2e-52   Takifugu rubripes [tiger puffer]
ref|XP_011128728.1|  putative GTP-binding protein                       183   2e-52   Gregarina niphandrodes
gb|KFO22378.1|  Obg-like ATPase 1                                       183   2e-52   Fukomys damarensis [Damara mole rat]
ref|XP_004634806.1|  PREDICTED: obg-like ATPase 1 isoform X2            183   2e-52   
gb|AEE61569.1|  unknown                                                 183   2e-52   Dendroctonus ponderosae
ref|XP_005182762.2|  PREDICTED: obg-like ATPase 1                       183   2e-52   Musca domestica
ref|XP_004674579.1|  PREDICTED: obg-like ATPase 1 isoform X2            183   2e-52   
ref|XP_004601223.1|  PREDICTED: obg-like ATPase 1 isoform X2            183   2e-52   Sorex araneus [Eurasian shrew]
ref|XP_007430999.1|  PREDICTED: obg-like ATPase 1-like isoform X2       183   2e-52   Python bivittatus
ref|XP_005324665.1|  PREDICTED: obg-like ATPase 1 isoform X2            183   2e-52   
ref|XP_004577108.1|  PREDICTED: obg-like ATPase 1 isoform X3            181   2e-52   
dbj|BAB31566.1|  unnamed protein product                                180   2e-52   Mus musculus [mouse]
ref|XP_003225685.1|  PREDICTED: obg-like ATPase 1 isoform X1            183   2e-52   Anolis carolinensis [Carolina anole]
ref|XP_005857658.1|  PREDICTED: obg-like ATPase 1                       183   2e-52   
ref|XP_006275602.1|  PREDICTED: obg-like ATPase 1-like isoform X2       183   2e-52   Alligator mississippiensis
ref|NP_001079680.1|  obg-like ATPase 1                                  183   2e-52   Xenopus laevis [clawed frog]
ref|XP_005300476.1|  PREDICTED: obg-like ATPase 1 isoform X3            183   2e-52   Chrysemys picta bellii
dbj|GAN04407.1|  GTP-binding protein                                    183   2e-52   Mucor ambiguus
ref|XP_004409047.1|  PREDICTED: obg-like ATPase 1 isoform 2             182   2e-52   Odobenus rosmarus divergens
ref|XP_009844285.1|  GTP-binding protein YchF                           183   2e-52   Aphanomyces astaci
dbj|BAE39543.1|  unnamed protein product                                183   2e-52   Mus musculus [mouse]
emb|CDH52754.1|  gtp-binding protein                                    183   3e-52   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004375552.1|  PREDICTED: obg-like ATPase 1                       183   3e-52   
ref|XP_003884761.1|  putative GTP binding protein                       183   3e-52   Neospora caninum Liverpool
emb|CDS09858.1|  Putative GTP-binding protein YchF                      183   3e-52   Lichtheimia ramosa
ref|XP_007060593.1|  PREDICTED: obg-like ATPase 1                       183   3e-52   
ref|NP_999865.1|  obg-like ATPase 1 isoform 1                           183   3e-52   Danio rerio [leopard danio]
ref|XP_006020859.1|  PREDICTED: obg-like ATPase 1                       183   3e-52   Alligator sinensis
ref|XP_006116549.1|  PREDICTED: obg-like ATPase 1 isoform X4            183   3e-52   
ref|XP_006972493.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Peromyscus maniculatus bairdii
ref|XP_004634805.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   4e-52   Octodon degus
ref|XP_005346631.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Microtus ochrogaster [prairie voles]
ref|XP_004601222.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   4e-52   Sorex araneus [Eurasian shrew]
ref|XP_010858116.1|  PREDICTED: obg-like ATPase 1 isoform X2            182   4e-52   Bison bison bison
ref|XP_004674578.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   4e-52   Condylura cristata
ref|NP_080218.1|  obg-like ATPase 1 isoform a                           182   4e-52   Mus musculus [mouse]
ref|NP_001039510.1|  obg-like ATPase 1                                  182   4e-52   Bos taurus [bovine]
ref|XP_006878885.1|  PREDICTED: obg-like ATPase 1-like                  182   4e-52   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003406265.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Loxodonta africana [African bush elephant]
tpg|DAA13236.1|  TPA: Obg-like ATPase 1-like                            182   4e-52   Bos taurus [bovine]
ref|XP_004703788.1|  PREDICTED: obg-like ATPase 1 isoform X2            182   4e-52   Echinops telfairi [lesser hedgehog tenrec]
dbj|BAB27201.1|  unnamed protein product                                182   4e-52   Mus musculus [mouse]
ref|XP_001499403.1|  PREDICTED: Obg-like ATPase 1 isoformX1             182   4e-52   Equus caballus [domestic horse]
ref|XP_003478641.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Cavia porcellus [guinea pig]
ref|XP_003253776.1|  PREDICTED: obg-like ATPase 1 isoform 1             182   4e-52   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001029099.1|  obg-like ATPase 1                                  182   4e-52   Rattus norvegicus [brown rat]
ref|XP_007248906.1|  PREDICTED: obg-like ATPase 1-like                  182   4e-52   Astyanax mexicanus [blind cave fish]
ref|XP_008996931.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   4e-52   
ref|XP_010831175.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Bison bison bison
ref|XP_006866713.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   4e-52   Chrysochloris asiatica
ref|XP_008853504.1|  PREDICTED: obg-like ATPase 1                       182   4e-52   Nannospalax galili
ref|XP_003474516.1|  PREDICTED: obg-like ATPase 1-like                  182   4e-52   
ref|XP_850320.2|  PREDICTED: LOW QUALITY PROTEIN: Obg-like ATPase...    182   4e-52   
ref|NP_037473.3|  obg-like ATPase 1 isoform 1                           182   4e-52   Homo sapiens [man]
ref|XP_007527277.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   5e-52   Erinaceus europaeus [common hedgehog]
ref|XP_007451126.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   5e-52   Lipotes vexillifer [baiji]
ref|XP_005676004.1|  PREDICTED: obg-like ATPase 1                       182   5e-52   
ref|XP_004476856.1|  PREDICTED: obg-like ATPase 1 isoform 2             182   5e-52   Dasypus novemcinctus
emb|CAB66481.1|  hypothetical protein                                   182   5e-52   Homo sapiens [man]
ref|XP_004857751.1|  PREDICTED: obg-like ATPase 1-like                  182   5e-52   Heterocephalus glaber [naked mole rat]
ref|XP_008136765.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   5e-52   Eptesicus fuscus
ref|XP_002407922.1|  GTP-binding protein, putative                      182   5e-52   Ixodes scapularis [blacklegged tick]
gb|ERE71974.1|  obg-like ATPase 1-like protein                          184   5e-52   Cricetulus griseus [Chinese hamsters]
ref|NP_001270427.1|  uncharacterized protein LOC101926459               182   5e-52   Macaca fascicularis [crab eating macaque]
gb|EMS17306.1|  GTP-binding protein                                     182   6e-52   Entamoeba histolytica HM-3:IMSS
emb|CEG70465.1|  Putative Obg-like ATPase 1                             182   6e-52   Rhizopus microsporus
gb|KFM79040.1|  GTP-binding protein                                     181   6e-52   Stegodyphus mimosarum
ref|XP_004092019.1|  PREDICTED: obg-like ATPase 1 isoform 3             182   6e-52   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006116547.1|  PREDICTED: obg-like ATPase 1 isoform X2            183   7e-52   
ref|XP_004032861.1|  PREDICTED: obg-like ATPase 1-like isoform 1        182   7e-52   Gorilla gorilla gorilla [lowland gorilla]
emb|CAG10349.1|  unnamed protein product                                181   7e-52   Tetraodon nigroviridis
ref|XP_657513.1|  GTP-binding protein                                   182   8e-52   
ref|XP_004267372.1|  PREDICTED: obg-like ATPase 1 isoform 1             182   8e-52   
ref|XP_004703787.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   8e-52   
ref|XP_011213430.1|  PREDICTED: obg-like ATPase 1                       182   8e-52   
ref|XP_001741184.1|  hypothetical protein                               182   1e-51   
ref|XP_010988428.1|  PREDICTED: obg-like ATPase 1                       181   1e-51   
ref|XP_006116546.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   1e-51   
ref|XP_004426694.1|  PREDICTED: obg-like ATPase 1 isoform 2             181   1e-51   
ref|XP_006174828.1|  PREDICTED: obg-like ATPase 1 isoform X1            181   1e-51   
gb|EPB88277.1|  obg-like ATPase 1                                       182   1e-51   
ref|XP_008860136.1|  GTP-binding protein YchF protein                   181   1e-51   
ref|XP_004032863.1|  PREDICTED: obg-like ATPase 1-like isoform 3        182   1e-51   
ref|XP_011355667.1|  PREDICTED: obg-like ATPase 1 isoform X1            181   1e-51   
dbj|BAE35446.1|  unnamed protein product                                181   1e-51   
ref|XP_002502254.1|  predicted protein                                  181   1e-51   
emb|CBK21211.2|  unnamed protein product                                182   1e-51   
ref|XP_010180112.1|  PREDICTED: obg-like ATPase 1                       173   1e-51   
ref|XP_002953657.1|  hypothetical protein VOLCADRAFT_82356              181   1e-51   
ref|NP_001127505.1|  obg-like ATPase 1                                  181   1e-51   
ref|XP_010959009.1|  PREDICTED: obg-like ATPase 1                       181   1e-51   
ref|XP_004258887.1|  hypothetical protein EIN_380430                    175   2e-51   
gb|AAD44500.1|  homologous yeast-44.2 protein                           181   2e-51   
dbj|BAB55174.1|  unnamed protein product                                181   2e-51   
emb|CAN63158.1|  hypothetical protein VITISV_035841                     172   2e-51   
emb|CEI96573.1|  Putative Obg-like ATPase 1                             181   2e-51   
ref|XP_004426693.1|  PREDICTED: obg-like ATPase 1 isoform 1             181   2e-51   
ref|XP_515918.2|  PREDICTED: obg-like ATPase 1 isoform X1               182   2e-51   
gb|AIC56285.1|  OLA1                                                    181   2e-51   
gb|KDO26747.1|  GTP-binding protein YchF                                181   2e-51   
ref|XP_001701711.1|  predicted protein                                  181   2e-51   
ref|XP_009236111.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   2e-51   
ref|XP_003824289.1|  PREDICTED: obg-like ATPase 1 isoform X1            182   2e-51   
ref|XP_007183357.1|  PREDICTED: obg-like ATPase 1                       181   3e-51   
gb|EIE82570.1|  GTP-binding protein YchF                                181   3e-51   
dbj|GAM19309.1|  hypothetical protein SAMD00019534_024840               180   3e-51   
ref|XP_008615675.1|  GTP-binding protein YchF                           180   3e-51   
ref|NP_001040339.1|  GTP binding protein                                180   3e-51   
ref|XP_969865.2|  PREDICTED: obg-like ATPase 1                          180   3e-51   
ref|XP_008326509.1|  PREDICTED: obg-like ATPase 1 isoform X1            181   4e-51   
ref|XP_011148752.1|  PREDICTED: obg-like ATPase 1                       180   4e-51   
gb|ELR47977.1|  Obg-like ATPase 1                                       180   4e-51   
ref|XP_003064009.1|  predicted protein                                  180   4e-51   
gb|AEH16630.1|  GTPase                                                  180   4e-51   
ref|XP_008216612.1|  PREDICTED: obg-like ATPase 1                       180   5e-51   
ref|XP_003447358.1|  PREDICTED: obg-like ATPase 1-like isoform X1       180   5e-51   
ref|XP_010878192.1|  PREDICTED: obg-like ATPase 1 isoform X4            180   5e-51   
ref|XP_011488211.1|  PREDICTED: obg-like ATPase 1                       172   6e-51   
ref|XP_003372802.1|  GTP-dependent nucleic acid-binding protein EngD    179   6e-51   
ref|XP_008861782.1|  GTP-binding protein YchF, variant                  179   6e-51   
ref|XP_005907299.1|  PREDICTED: obg-like ATPase 1                       179   6e-51   
ref|XP_008861781.1|  GTP-binding protein YchF                           179   6e-51   
gb|AAY18927.1|  DKFZp761C10121                                          180   6e-51   
ref|XP_001368232.1|  PREDICTED: Obg-like ATPase 1                       179   7e-51   
ref|XP_003388006.1|  PREDICTED: obg-like ATPase 1                       180   7e-51   
ref|XP_003062163.1|  predicted protein                                  179   7e-51   
ref|XP_010878189.1|  PREDICTED: obg-like ATPase 1 isoform X1            180   7e-51   
ref|XP_011063638.1|  PREDICTED: obg-like ATPase 1 isoform X1            179   8e-51   
ref|XP_011307687.1|  PREDICTED: obg-like ATPase 1                       179   8e-51   
ref|XP_011063639.1|  PREDICTED: obg-like ATPase 1 isoform X2            179   8e-51   
gb|EKC37590.1|  Obg-like ATPase 1                                       179   8e-51   
ref|XP_010878190.1|  PREDICTED: obg-like ATPase 1 isoform X2            180   8e-51   
ref|XP_011162955.1|  PREDICTED: obg-like ATPase 1                       179   1e-50   
ref|XP_007513696.1|  predicted protein                                  180   1e-50   
ref|XP_003695060.1|  PREDICTED: GTP-binding protein CG1354-like         179   1e-50   
ref|XP_004832851.1|  GTP-binding protein family member protein          179   1e-50   
ref|XP_006616484.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    179   1e-50   
ref|XP_003704224.1|  PREDICTED: GTP-binding protein CG1354-like         179   1e-50   
ref|XP_396711.3|  PREDICTED: obg-like ATPase 1-like isoformX1           179   1e-50   
gb|ERE71973.1|  obg-like ATPase 1-like protein                          185   2e-50   
ref|XP_011267424.1|  PREDICTED: obg-like ATPase 1                       178   2e-50   
ref|XP_011185359.1|  PREDICTED: obg-like ATPase 1                       178   2e-50   
ref|XP_002142230.1|  GTP-binding protein                                178   2e-50   
ref|XP_003400207.1|  PREDICTED: GTP-binding protein CG1354-like         178   2e-50   
dbj|BAM19435.1|  GTP-binding protein                                    178   2e-50   
ref|XP_003494408.1|  PREDICTED: GTP-binding protein CG1354-like         178   2e-50   
ref|XP_628099.1|  yyaF/YCHF TRANSFAC/OBG family small GTpase plus...    178   2e-50   
ref|XP_004521628.1|  PREDICTED: obg-like ATPase 1-like isoform X1       178   3e-50   
ref|XP_011329428.1|  PREDICTED: obg-like ATPase 1                       178   3e-50   
ref|XP_011498533.1|  PREDICTED: obg-like ATPase 1                       178   3e-50   
gb|ESA10852.1|  hypothetical protein GLOINDRAFT_348023                  178   3e-50   
ref|XP_002499572.1|  predicted protein                                  178   3e-50   
ref|XP_011436819.1|  PREDICTED: obg-like ATPase 1                       177   3e-50   
ref|XP_668381.1|  GTP-binding protein                                   177   3e-50   
gb|EHH54959.1|  hypothetical protein EGM_04072                          178   3e-50   
gb|KDO21130.1|  GTP-binding protein YchF                                177   3e-50   
ref|XP_005416153.1|  PREDICTED: obg-like ATPase 1                       182   3e-50   
ref|XP_009827549.1|  GTP-binding protein YchF                           177   4e-50   
ref|XP_010350251.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    179   4e-50   
ref|XP_008616943.1|  GTP-binding protein YchF                           177   4e-50   
gb|EST45054.1|  GTP-binding protein                                     177   4e-50   
ref|XP_005452971.1|  PREDICTED: obg-like ATPase 1-like isoform X2       179   5e-50   
gb|KIY97505.1|  hypothetical protein MNEG_10457                         173   5e-50   
ref|XP_007888200.1|  PREDICTED: obg-like ATPase 1                       177   6e-50   
gb|EFA85891.1|  GTP-binding protein                                     177   6e-50   
ref|NP_001153863.1|  Obg-like ATPase 1                                  177   7e-50   
emb|CDW53501.1|  GTP binding protein CG1354                             176   9e-50   
ref|XP_009351070.1|  PREDICTED: obg-like ATPase 1                       176   1e-49   
ref|XP_003292793.1|  hypothetical protein DICPUDRAFT_83396              176   1e-49   
ref|XP_001611354.1|  GTP-binding protein YchF domain containing p...    176   1e-49   
dbj|GAA29126.2|  GTP-binding protein-related K06942                     177   1e-49   
ref|XP_001728946.1|  hypothetical protein MGL_3940                      177   1e-49   
ref|XP_001454300.1|  hypothetical protein                               176   1e-49   
emb|CAG09966.1|  unnamed protein product                                175   1e-49   
ref|XP_001462345.1|  hypothetical protein                               176   1e-49   
emb|CDR96464.1|  GTP-binding protein YchF domain containing prote...    176   2e-49   
ref|XP_646933.1|  hypothetical protein DDB_G0268758                     175   2e-49   
ref|XP_001654823.1|  AAEL002160-PA                                      175   3e-49   
ref|XP_009035196.1|  hypothetical protein AURANDRAFT_23601              175   3e-49   
emb|CEI98922.1|  Putative GTP-binding protein YchF                      175   3e-49   
gb|EPZ35678.1|  Beta-grasp domain-containing protein                    175   3e-49   
ref|XP_311198.2|  AGAP000672-PA                                         175   4e-49   
gb|EUD71003.1|  GTP-binding protein YchF                                174   4e-49   
gb|EJY78341.1|  putative GTPase, probable translation factor            174   4e-49   
emb|CDH53583.1|  gtp-binding protein                                    176   5e-49   
emb|CDR11783.1|  GTP-binding protein, putative                          174   5e-49   
ref|XP_008625563.1|  GTP-binding protein YchF                           174   5e-49   
emb|CBY37922.1|  unnamed protein product                                174   5e-49   
ref|XP_009050807.1|  hypothetical protein LOTGIDRAFT_151663             174   5e-49   
ref|XP_001354398.2|  GA12352                                            174   6e-49   
ref|XP_004220982.1|  GTP-binding protein                                174   6e-49   
emb|CDW82130.1|  gtp-binding protein                                    174   7e-49   
emb|CDJ01997.1|  GTP binding protein CG1354                             174   7e-49   
ref|XP_008818190.1|  GTP-binding protein YchF                           174   7e-49   
emb|CEF98921.1|  P-loop containing nucleoside triphosphate hydrolase    174   7e-49   
ref|XP_002055571.1|  GJ18714                                            174   8e-49   
ref|XP_001612801.1|  GTP-binding protein                                174   8e-49   
ref|XP_010793747.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    174   8e-49   
ref|XP_009024324.1|  hypothetical protein HELRODRAFT_187336             174   1e-48   
emb|CCA15473.1|  Rab1 family GTPase (PiYpt1) putative                   179   1e-48   
emb|CEF67024.1|  Obg-like ATPase 1                                      174   1e-48   
ref|XP_002076931.1|  GD24779                                            173   1e-48   
ref|XP_001977300.1|  GG18324                                            173   1e-48   
ref|XP_002261143.1|  GTP-binding protein                                173   1e-48   
ref|NP_572580.1|  CG1354, isoform A                                     173   1e-48   
ref|XP_002010541.1|  GI15984                                            173   1e-48   
ref|XP_002041803.1|  GM11387                                            173   1e-48   
gb|ELU09460.1|  hypothetical protein CAPTEDRAFT_174827                  173   2e-48   
ref|XP_002646525.1|  C. briggsae CBR-TAG-210 protein                    173   2e-48   
dbj|BAN66077.1|  GTP-binding protein YchF domain containing protein     173   2e-48   
gb|ETB58464.1|  GTP-binding protein YchF                                173   2e-48   
ref|XP_003115069.1|  CRE-TAG-210 protein                                173   2e-48   
ref|XP_676964.1|  GTP-binding protein                                   172   2e-48   
ref|NP_001254006.1|  Protein OLA-1, isoform a                           172   3e-48   
ref|XP_955300.1|  GTP-binding protein                                   173   3e-48   
gb|ETN73871.1|  GTP-binding protein YchF                                172   3e-48   
gb|KFB40079.1|  AGAP000672-PA-like protein                              172   4e-48   
emb|CDJ43406.1|  GTP binding protein, putative                          171   5e-48   
ref|XP_730137.1|  hypothetical protein                                  173   5e-48   
gb|KFD67365.1|  hypothetical protein M514_20401                         172   5e-48   
emb|CEJ02012.1|  Putative GTP-binding protein YchF                      168   6e-48   
ref|XP_006678054.1|  hypothetical protein BATDEDRAFT_36811              172   6e-48   
emb|CDJ65501.1|  GTP binding protein, putative                          171   6e-48   
gb|KIH55129.1|  GTP-binding protein YchF                                172   6e-48   
ref|XP_002163078.2|  PREDICTED: obg-like ATPase 1-like                  172   7e-48   
gb|KHJ90518.1|  GTP-binding protein YchF                                171   7e-48   
ref|XP_001748154.1|  hypothetical protein                               171   7e-48   
ref|XP_001956259.1|  GF25119                                            171   7e-48   
emb|CBN75206.1|  OLA1, Obg-like ATPase 1 (YchF-related GTPase)          171   7e-48   
ref|XP_005827580.1|  hypothetical protein GUITHDRAFT_75397              171   8e-48   
ref|XP_002605213.1|  hypothetical protein BRAFLDRAFT_114616             171   8e-48   
gb|EGT58351.1|  hypothetical protein CAEBREN_10889                      171   8e-48   
gb|KHJ93893.1|  GTP-binding protein YchF                                171   9e-48   
emb|CDS18927.1|  GTP binding protein CG1354                             171   1e-47   
emb|CDI77391.1|  GTP binding protein, putative                          171   1e-47   
ref|XP_002124995.1|  PREDICTED: obg-like ATPase 1                       171   1e-47   
ref|XP_008472913.1|  PREDICTED: obg-like ATPase 1 isoform X2            171   1e-47   
ref|XP_001991915.1|  GH11803                                            170   2e-47   
emb|CEP12926.1|  hypothetical protein                                   171   2e-47   
emb|CDS05214.1|  hypothetical protein LRAMOSA07743                      171   2e-47   
ref|XP_005099946.1|  PREDICTED: obg-like ATPase 1-like isoform X1       170   2e-47   
ref|XP_001450494.1|  hypothetical protein                               169   2e-47   
gb|KFH65596.1|  GTP-binding protein YchF                                170   2e-47   
ref|XP_004351942.1|  hypothetical protein DFA_10052                     177   3e-47   
emb|CCV00472.1|  unnamed protein product                                170   3e-47   
ref|XP_001452953.1|  hypothetical protein                               169   3e-47   
ref|XP_005792577.1|  hypothetical protein EMIHUDRAFT_422986             170   3e-47   
ref|XP_008083454.1|  P-loop containing nucleoside triphosphate hy...    169   3e-47   
gb|ERG79748.1|  gtp-binding protein                                     169   3e-47   
ref|XP_003083821.1|  GTP-binding protein (ISS)                          174   4e-47   
gb|KFW61884.1|  Obg-like ATPase 1                                       169   4e-47   
ref|XP_002071025.1|  GK25358                                            169   5e-47   
gb|KFH72536.1|  GTP-binding protein YchF                                169   5e-47   
gb|EYC24730.1|  hypothetical protein Y032_0013g2079                     169   6e-47   
ref|XP_009515545.1|  hypothetical protein PHYSODRAFT_551993             169   6e-47   
ref|XP_007916609.1|  hypothetical protein UCRPA7_5873                   167   6e-47   
ref|XP_008909588.1|  obg-like ATPase 1, variant                         169   7e-47   
gb|ETL87338.1|  obg-like ATPase 1, variant                              169   7e-47   
ref|XP_003745114.1|  PREDICTED: GTP-binding protein CG1354-like         169   7e-47   
emb|CDO63681.1|  GTP-binding protein, putative                          169   7e-47   
ref|XP_004032339.1|  hypothetical protein IMG5_124180                   167   9e-47   
ref|XP_001349125.1|  conserved GTP-binding protein, putative            168   1e-46   
ref|XP_743834.1|  GTP-binding protein                                   168   1e-46   
ref|XP_002906493.1|  GTPase, putative                                   168   1e-46   
emb|CCX06388.1|  Similar to Putative GTP-binding protein tag-210;...    168   1e-46   
ref|XP_008909587.1|  obg-like ATPase 1                                  169   2e-46   
gb|ETL87337.1|  obg-like ATPase 1                                       169   2e-46   
ref|XP_002023062.1|  GL16374                                            168   2e-46   
emb|CDS32165.1|  Ribosomal protein L34a                                 168   2e-46   
gb|KHN83895.1|  Obg-like ATPase 1                                       169   2e-46   
emb|CEG64981.1|  Putative GTP-binding protein YchF                      168   2e-46   
gb|KGG52785.1|  hypothetical protein DI09_135p20                        167   2e-46   
gb|KIL85972.1|  gtp-binding protein                                     167   3e-46   
ref|XP_004991763.1|  obg-like ATPase 1                                  169   3e-46   
gb|EKG17715.1|  GTP-binding domain HSR1-related protein                 167   3e-46   
ref|XP_007877623.1|  hypothetical protein PFL1_01921                    167   4e-46   
emb|CDI56682.1|  related to YLF2-putative glycogen phosphorylase,...    168   4e-46   
gb|EXA34992.1|  GTP-binding protein YchF                                167   4e-46   
ref|XP_003049235.1|  predicted protein                                  167   5e-46   
ref|XP_001901357.1|  GTP-binding protein W08E3.3                        167   5e-46   
emb|CDQ02627.1|  Protein BM-TAG-210, isoform c                          167   5e-46   
gb|EWZ85259.1|  GTP-binding protein YchF                                167   5e-46   
gb|EXL51862.1|  GTP-binding protein YchF                                166   6e-46   
gb|EWY82830.1|  GTP-binding protein YchF                                166   6e-46   
gb|EMT72022.1|  hypothetical protein FOC4_g10003869                     166   6e-46   
gb|KFY67733.1|  hypothetical protein V496_01433                         166   7e-46   
gb|KGO46293.1|  Conserved hypothetical protein CHP00092                 166   8e-46   
ref|XP_008472912.1|  PREDICTED: obg-like ATPase 1 isoform X1            167   9e-46   
gb|EGU78059.1|  hypothetical protein FOXB_11445                         166   1e-45   
gb|EJW81490.1|  GTP-binding protein YchF                                166   1e-45   
gb|EPB92271.1|  GTP-binding protein YchF                                166   1e-45   
ref|XP_001880771.1|  predicted protein                                  165   1e-45   



>ref|XP_006845995.1| hypothetical protein AMTR_s00155p00051130 [Amborella trichopoda]
 gb|ERN07670.1| hypothetical protein AMTR_s00155p00051130 [Amborella trichopoda]
Length=248

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K K+ PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKAKDTPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_011085197.1| PREDICTED: obg-like ATPase 1 [Sesamum indicum]
Length=394

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLK+GIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKVGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQLYKPKSE+SAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLYKPKSEISAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_004293982.1| PREDICTED: obg-like ATPase 1 [Fragaria vesca subsp. vesca]
Length=394

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AKGKE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKGKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KDP34925.1| hypothetical protein JCGZ_09213 [Jatropha curcas]
Length=394

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008445378.1| PREDICTED: obg-like ATPase 1 [Cucumis melo]
Length=395

 Score =   265 bits (676),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLC LYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCNLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_004231561.1| PREDICTED: obg-like ATPase 1 [Solanum lycopersicum]
Length=394

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEV+AFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVAAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KJB69091.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=357

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|AAF65513.1| GTP-binding protein [Capsicum annuum]
Length=394

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEV+AFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVAAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009362223.1| PREDICTED: obg-like ATPase 1 [Pyrus x bretschneideri]
Length=394

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KJB69090.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=361

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008225608.1| PREDICTED: obg-like ATPase 1 [Prunus mume]
Length=394

 Score =   264 bits (675),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKAKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006360314.1| PREDICTED: obg-like ATPase 1-like [Solanum tuberosum]
Length=394

 Score =   264 bits (675),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEV+AFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVAAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008372236.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_007211399.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
 gb|EMJ12598.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
Length=394

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_004135546.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 ref|XP_004158075.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 gb|KGN65918.1| hypothetical protein Csa_1G538160 [Cucumis sativus]
Length=395

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLC LYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCNLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008383389.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KJB69089.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=394

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KHF97630.1| Obg-like ATPase 1 [Gossypium arboreum]
Length=394

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>emb|CDP17295.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KJB69092.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=354

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|EPS61253.1| hypothetical protein M569_13545, partial [Genlisea aurea]
Length=250

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK AK KE  AERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKGAKSKEGVAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHV+RAFE
Sbjct  121  GIFHVIRAFE  130



>ref|XP_002523184.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
 gb|EEF39215.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
Length=394

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_011015196.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=392

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|AFK48623.1| unknown [Lotus japonicus]
Length=394

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006377958.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
 gb|ERP55755.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
Length=394

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_002263885.1| PREDICTED: obg-like ATPase 1 [Vitis vinifera]
 emb|CBI31027.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK++K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKSSKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008777315.1| PREDICTED: obg-like ATPase 1, partial [Phoenix dactylifera]
Length=190

 Score =   255 bits (652),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR NVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARTNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_011037748.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_003546267.1| PREDICTED: obg-like ATPase 1-like [Glycine max]
 gb|KHN14324.1| Obg-like ATPase 1 [Glycine soja]
Length=394

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|NP_001242520.1| uncharacterized protein LOC100793501 [Glycine max]
 gb|ACU21485.1| unknown [Glycine max]
Length=394

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|EYU43227.1| hypothetical protein MIMGU_mgv1a007827mg [Erythranthe guttata]
Length=394

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQL+KPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLFKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010245345.1| PREDICTED: obg-like ATPase 1 [Nelumbo nucifera]
Length=394

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK K+ PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKDAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR+NVPD RFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARINVPDVRFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_007147477.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
 gb|ESW19471.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
Length=394

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPI GRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPIFGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009603694.1| PREDICTED: obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167} 
[Nicotiana tomentosiformis]
Length=394

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKGKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEV+AFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVAAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KDO75238.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=263

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_007022926.1| GTP binding [Theobroma cacao]
 gb|EOY25548.1| GTP binding [Theobroma cacao]
Length=394

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPD RF+WLCQLYKPK+EVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDGRFDWLCQLYKPKNEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_004486463.1| PREDICTED: obg-like ATPase 1-like [Cicer arietinum]
Length=394

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KCW75747.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=322

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLC L+KPKSEV AFLEIHDIAGLV+GAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCNLFKPKSEVPAFLEIHDIAGLVKGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009803590.1| PREDICTED: obg-like ATPase 1 [Nicotiana sylvestris]
Length=394

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA KGKE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKATKGKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERFEWLCQLYKPKSEV+AFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVHVPDERFEWLCQLYKPKSEVAAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010098556.1| Obg-like ATPase 1 [Morus notabilis]
 gb|EXB75216.1| Obg-like ATPase 1 [Morus notabilis]
Length=394

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKGKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEV AFLEIHDIAGLVRGAH+GQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLHKPKSEVPAFLEIHDIAGLVRGAHQGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_002300568.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
 gb|EEE85373.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
Length=394

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK+SIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_011039799.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   259 bits (663),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK+SIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHAGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_003594539.1| Obg-like ATPase [Medicago truncatula]
 gb|AES64790.1| GTP-binding protein [Medicago truncatula]
Length=394

 Score =   259 bits (662),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006448885.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62125.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=460

 Score =   261 bits (668),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  150  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPF  329
            ++K+MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPF
Sbjct  63   SSKQMPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPF  122

Query  330  CTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  509
            CTIEPNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHI
Sbjct  123  CTIEPNEARVNIPDERFEWLCQLFKPKSTVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  182

Query  510  RAVDGIFHVLRAFE  551
            RAVDGIFHVLRAFE
Sbjct  183  RAVDGIFHVLRAFE  196



>gb|KEH37060.1| 50S ribosome-binding GTPase [Medicago truncatula]
Length=209

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLR  542
            GIFHVL+
Sbjct  121  GIFHVLQ  127



>gb|KDO75237.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=350

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006448884.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62124.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=394

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSTVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010051911.1| PREDICTED: obg-like ATPase 1 [Eucalyptus grandis]
 gb|KCW75746.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=394

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLC L+KPKSEV AFLEIHDIAGLV+GAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCNLFKPKSEVPAFLEIHDIAGLVKGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006468322.1| PREDICTED: obg-like ATPase 1-like [Citrus sinensis]
 gb|KDO75235.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=394

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_008799072.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799073.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799075.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799076.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799077.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=394

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR NVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARTNVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KDO75236.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=406

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|ACJ85184.1| unknown [Medicago truncatula]
Length=394

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHV RAFE
Sbjct  121  GIFHVPRAFE  130



>ref|XP_009412029.1| PREDICTED: obg-like ATPase 1 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKDAVTERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WL QLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLSQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|AFK49195.1| unknown [Medicago truncatula]
Length=401

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTK++IPAENFPFCTIE
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKMAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERFEWLCQL+KPKSEVSAFLEIHDIAGLVRGAH+GQGLGNSFLSHIRAVD
Sbjct  61   PNEARVNVPDERFEWLCQLFKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNSFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHV RAFE
Sbjct  121  GIFHVPRAFE  130



>ref|XP_010519060.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 1/131 (1%)
 Frame = +3

Query  162  MPPKAAKGKEV-PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            MPPKAAK K+  PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI
Sbjct  1    MPPKAAKSKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  60

Query  339  EPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAV  518
            EPNEARVNVPDERF+WLCQLYKPK+EVSAFLEIHDIAGLVRGAH+GQGLGN+FLSHIRAV
Sbjct  61   EPNEARVNVPDERFDWLCQLYKPKNEVSAFLEIHDIAGLVRGAHQGQGLGNNFLSHIRAV  120

Query  519  DGIFHVLRAFE  551
            DGIFHVLRAF+
Sbjct  121  DGIFHVLRAFD  131



>ref|XP_010926935.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926936.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926937.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK++K K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSSKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR+NVPDERF+WLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARINVPDERFDWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010687083.1| PREDICTED: obg-like ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK K+ PAERP+LGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAKSKDAPAERPVLGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WL QLYKPKSEVSAFLEIHDIAGLVRGAH+GQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLLQLYKPKSEVSAFLEIHDIAGLVRGAHQGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAF+
Sbjct  121  GIFHVLRAFD  130



>ref|XP_008812127.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=412

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKASKSKEAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR+N+PDE+F+WLCQLYKPKSEV+A+LEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARINIPDEKFDWLCQLYKPKSEVAAYLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_001776504.1| predicted protein [Physcomitrella patens]
 gb|EDQ58637.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAKGKE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPA NFPFCTIE
Sbjct  1    MPPKAAKGKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAMNFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV VPDERF+WLCQL+KPKSEV+AFLEI+DIAGLVRGA+EGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVYVPDERFDWLCQLFKPKSEVAAFLEINDIAGLVRGANEGQGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAF+
Sbjct  121  GIFHVLRAFD  130



>ref|XP_010941555.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR+N+PD+RF+WLCQLYKPKSEV A+LEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARINIPDKRFDWLCQLYKPKSEVMAYLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006415450.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
 gb|ESQ33803.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
Length=419

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 2/140 (1%)
 Frame = +3

Query  138  LIFSAA--KEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIP  311
            L+F A   ++MPPK+      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIP
Sbjct  16   LLFQARHWRKMPPKSKAKDGAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIP  75

Query  312  AENFPFCTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGN  491
            AENFPFCTIEPNEARVN+PDERF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN
Sbjct  76   AENFPFCTIEPNEARVNIPDERFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGN  135

Query  492  SFLSHIRAVDGIFHVLRAFE  551
            +FLSHIRAVDGIFHVLRAFE
Sbjct  136  NFLSHIRAVDGIFHVLRAFE  155



>gb|ABK25108.1| unknown [Picea sitchensis]
Length=392

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK+AK KE PAER ILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKSAK-KEAPAERAILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLC LYKPKSEVSAFLE+HDIAGLVRGAH+GQGLGN+FLSHIRAVD
Sbjct  60   PNEARVNVPDERFDWLCSLYKPKSEVSAFLEVHDIAGLVRGAHQGQGLGNNFLSHIRAVD  119

Query  522  GIFHVLRAFE  551
            GIFHV RAF+
Sbjct  120  GIFHVCRAFD  129



>emb|CDY12460.1| BnaC08g09490D [Brassica napus]
Length=394

 Score =   249 bits (636),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009107765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
 emb|CDY47157.1| BnaA08g05260D [Brassica napus]
Length=394

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>emb|CDX98216.1| BnaC07g08820D [Brassica napus]
Length=394

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>emb|CDY02308.1| BnaA09g25940D [Brassica napus]
Length=394

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQLYKPK+E+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLYKPKAEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006305006.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
 gb|EOA37904.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
Length=394

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ YKPKSEV AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTYKPKSEVPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>emb|CDX77584.1| BnaA07g07220D [Brassica napus]
Length=394

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PD+RF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDDRFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_002893634.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69893.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ YKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|NP_174346.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAD25745.1|AC007060_3 Similar to WO8E3.3 gi|3880615 putative GTP-binding protein from 
C. elegans cosmid gb|Z92773. EST gb|AA597331 comes from this 
gene [Arabidopsis thaliana]
 gb|ABG25054.1| At1g30580 [Arabidopsis thaliana]
 gb|AEE31246.1| GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ YKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|AAM63059.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ YKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|KFK44867.1| hypothetical protein AALP_AA1G312800 [Arabis alpina]
Length=394

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDGAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQL KPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQLNKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009115125.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=395

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  162  MPPKA-AKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            MPPKA AK    P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI
Sbjct  1    MPPKAKAKDAAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  60

Query  339  EPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAV  518
            EPNEARVN+PD+RF+WLCQLYKPK+E+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAV
Sbjct  61   EPNEARVNIPDDRFDWLCQLYKPKAEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAV  120

Query  519  DGIFHVLRAFE  551
            DGIFHVLRAFE
Sbjct  121  DGIFHVLRAFE  131



>ref|XP_010478480.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA   +  P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKEAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ  KPKSEV AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTLKPKSEVPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010499597.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ  KPKSEV AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTLKPKSEVPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_009144765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=394

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA      P ERPILGRFSS LKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSLLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PD+RF+WLCQLYKPKSE+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDDRFDWLCQLYKPKSEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|EEC83063.1| hypothetical protein OsI_28170 [Oryza sativa Indica Group]
Length=394

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTI+
Sbjct  1    MPPKASKKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV VPDERF+WLCQLYKPKSEVSA+LEI+DIAGLVRGAH G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRGAHAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010460862.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK       P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE
Sbjct  1    MPPKGKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVN+PDERF+WLCQ  KPKSEV AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVD
Sbjct  61   PNEARVNIPDERFDWLCQTLKPKSEVPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|NP_001061206.2| Os08g0199300 [Oryza sativa Japonica Group]
 dbj|BAD03576.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAG88257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68206.1| hypothetical protein OsJ_26368 [Oryza sativa Japonica Group]
 dbj|BAF23120.2| Os08g0199300 [Oryza sativa Japonica Group]
Length=394

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTI+
Sbjct  1    MPPKASKKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV VPDERF+WLCQLYKPKSEVSA+LEI+DIAGLVRGAH G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRGAHAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_006659204.1| PREDICTED: obg-like ATPase 1-like [Oryza brachyantha]
Length=394

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERP+LGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIE
Sbjct  1    MPPKASKKDAAPAERPLLGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQL+KPK+EV A+LEI+DIAGLVRGAH G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVNVPDERFDWLCQLHKPKNEVCAYLEINDIAGLVRGAHAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_010538270.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +3

Query  201  ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDERF  380
            ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDERF
Sbjct  15   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDERF  74

Query  381  EWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            +WLCQLYKPK+EVSAFLEIHDIAGLVRGAH+GQGLGN+FLSHIRAVDGIFHVLRAF+
Sbjct  75   DWLCQLYKPKNEVSAFLEIHDIAGLVRGAHQGQGLGNNFLSHIRAVDGIFHVLRAFD  131



>emb|CDY09558.1| BnaC05g23610D [Brassica napus]
Length=397

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +3

Query  195  PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDE  374
            P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVN+PDE
Sbjct  15   PVERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNIPDE  74

Query  375  RFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            RF+WLC+LYKPK+E+ AFLEIHDIAGLVRGAHEGQGLGN+FLSHIRAVDGIFHVLRAFE
Sbjct  75   RFDWLCRLYKPKAEIPAFLEIHDIAGLVRGAHEGQGLGNNFLSHIRAVDGIFHVLRAFE  133



>ref|XP_003573525.1| PREDICTED: obg-like ATPase 1 [Brachypodium distachyon]
Length=394

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK++K    P ERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIE
Sbjct  1    MPPKSSKKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV VPDERF+WLCQLYKPKSEVSA+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>emb|CDM85617.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIE
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERF++LCQL+KPKSEV+A+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVHVPDERFDYLCQLFKPKSEVAAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|EMT28525.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=397

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIE
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERF++LCQL+KPKSEV+A+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVHVPDERFDYLCQLFKPKSEVAAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>gb|EMS48297.1| Obg-like ATPase 1 [Triticum urartu]
Length=397

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIE
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV+VPDERF++LCQL+KPKSEV+A+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVD
Sbjct  61   PNEARVHVPDERFDYLCQLFKPKSEVAAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVD  120

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  121  GIFHVLRAFE  130



>ref|XP_002445191.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
 gb|EES14686.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
Length=393

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKL+IPAENFPFCTIE
Sbjct  1    MPPKAKKDA-APAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLC+LYKPKSEV A+LE+ DIAGL+RGAH G GLGN+FLSHIRAVD
Sbjct  60   PNEARVNVPDERFDWLCKLYKPKSEVPAYLEVTDIAGLIRGAHAGDGLGNAFLSHIRAVD  119

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  120  GIFHVLRAFE  129



>gb|AFW56960.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=369

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA K    P+ERPILGRFSSHLKIGIVGLPNVGKST FN +TKL+IPAENFPFCTIE
Sbjct  1    MPPKAKKDA-APSERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLC+LYKPKSEV A+LE+ DIAGL+RGAH G GLGN+FLSHIRAVD
Sbjct  60   PNEARVNVPDERFDWLCKLYKPKSEVPAYLEVTDIAGLIRGAHAGDGLGNAFLSHIRAVD  119

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  120  GIFHVLRAFE  129



>ref|NP_001150211.1| GTP-binding protein PTD004 [Zea mays]
 gb|ACF85733.1| unknown [Zea mays]
 gb|ACG38260.1| GTP-binding protein PTD004 [Zea mays]
 gb|AFW56961.1| GTP-binding protein PTD004 [Zea mays]
Length=393

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA K    P+ERPILGRFSSHLKIGIVGLPNVGKST FN +TKL+IPAENFPFCTIE
Sbjct  1    MPPKAKKDA-APSERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLC+LYKPKSEV A+LE+ DIAGL+RGAH G GLGN+FLSHIRAVD
Sbjct  60   PNEARVNVPDERFDWLCKLYKPKSEVPAYLEVTDIAGLIRGAHAGDGLGNAFLSHIRAVD  119

Query  522  GIFHVLRAFE  551
            GIFHVLRAFE
Sbjct  120  GIFHVLRAFE  129



>ref|XP_004972629.1| PREDICTED: obg-like ATPase 1-like [Setaria italica]
Length=393

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKL+IPAENFPFCTIE
Sbjct  1    MPPKAKKDA-APAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARVNVPDERF+WLCQL+KPKS V A+LEI DIAGL+RGAH G GLGN+FLSHIRAVD
Sbjct  60   PNEARVNVPDERFDWLCQLFKPKSSVPAYLEITDIAGLIRGAHAGDGLGNAFLSHIRAVD  119

Query  522  GIFHVLRAFE  551
            GIFHVLRAF+
Sbjct  120  GIFHVLRAFD  129



>gb|AGF69175.1| putative GTP-binding protein, partial [Triticum aestivum]
Length=257

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  195  PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDE  374
            PAERPILGRFSSHLKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIEPNEARV+VPDE
Sbjct  6    PAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIEPNEARVHVPDE  65

Query  375  RFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            RF++LCQL+KPKSEV+A+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVDGIFHVLRAFE
Sbjct  66   RFDYLCQLFKPKSEVAAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVDGIFHVLRAFE  124



>ref|XP_005650863.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26319.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=392

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K KE P ERPILGRF ++LKIGIVGLPNVGKSTLFNTLTK+ IPAENFPFCTIE
Sbjct  1    MPPK--KAKEEPKERPILGRFRTNLKIGIVGLPNVGKSTLFNTLTKMGIPAENFPFCTIE  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARVNVPD+RF+WLC LYKPKSEV AFLEI DIAGLVRGA +G+GLGNSFLSHI AVD
Sbjct  59   PNNARVNVPDDRFKWLCNLYKPKSEVPAFLEIVDIAGLVRGAADGEGLGNSFLSHIAAVD  118

Query  522  GIFHVLRAFE  551
            GIFHV RAFE
Sbjct  119  GIFHVCRAFE  128



>ref|XP_002985543.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
 ref|XP_002987026.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ11869.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ13417.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
Length=389

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  198  AERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDER  377
            AER ILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARV+VPDER
Sbjct  16   AERQILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVSVPDER  75

Query  378  FEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            + WL Q +KPKSEVSAFLE+HDIAGLVRGA+EGQGLGN+FLSHIRAVDGIFHV+RAF+
Sbjct  76   YNWLVQHHKPKSEVSAFLEVHDIAGLVRGANEGQGLGNNFLSHIRAVDGIFHVIRAFD  133



>gb|EMT28526.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=377

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  171  KAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNE  350
            KA+K    PAERPILGRFSS LKIGIVGLPNVGKST FN +TKLSIPAENFPFCTIEPNE
Sbjct  62   KASKKDGEPAERPILGRFSSPLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIEPNE  121

Query  351  ARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIF  530
            ARV+VPDERF++LCQL+KPKSEV+A+LEI+DIAGLVRGA  G+GLGN+FLSHIRAVDGIF
Sbjct  122  ARVHVPDERFDYLCQLFKPKSEVAAYLEINDIAGLVRGASAGEGLGNAFLSHIRAVDGIF  181

Query  531  HVLRAFE  551
            HVLRAFE
Sbjct  182  HVLRAFE  188



>gb|KDO75234.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=374

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKL+IPAENFPFCTIE
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIE  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQG  482
            PNEARVN+PDERFEWLCQL+KPKS V AFLEIHDIAGLVRGAHEGQG
Sbjct  61   PNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQG  107



>ref|XP_002953429.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
 gb|EFJ45402.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
Length=391

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K +E P ERP+LGRF S+LK+GIVG+PNVGKSTLFN LTK+ +PAENFPFCTI+PN A
Sbjct  2    APKKQEAPKERPLLGRFKSNLKMGIVGMPNVGKSTLFNLLTKVGVPAENFPFCTIDPNAA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            RVNVPDERF WLC LYKPKS VSAFL++ DIAGLVRGA +G+GLGN+FLSHI AVDGI+H
Sbjct  62   RVNVPDERFNWLCSLYKPKSAVSAFLDVVDIAGLVRGAAQGEGLGNAFLSHIAAVDGIYH  121

Query  534  VLRAFE  551
            V RAFE
Sbjct  122  VCRAFE  127



>ref|XP_001699763.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP07459.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=391

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K +E P ERP+LGRF S+LKIG+VG+PNVGKSTLFN LTK+ +PAENFPFCTI+PN A
Sbjct  2    APKKQEAPKERPLLGRFKSNLKIGLVGMPNVGKSTLFNLLTKVGVPAENFPFCTIDPNNA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            RVNVPD+RF WLC +YKPKS V AFL++ DIAGLVRGA  G+GLGN+FLSHI AVDGIFH
Sbjct  62   RVNVPDDRFNWLCSVYKPKSSVPAFLDVVDIAGLVRGAATGEGLGNAFLSHIAAVDGIFH  121

Query  534  VLRAFE  551
            V RAFE
Sbjct  122  VCRAFE  127



>ref|XP_005703761.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME27241.1| GTP-binding protein [Galdieria sulphuraria]
Length=398

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K KE   +R +LGRFS +LK+GI+GLPNVGKST FNTLTKLS+ AEN+PFCTI+PNEA
Sbjct  2    APKKKEEEPQRAVLGRFSHNLKMGILGLPNVGKSTFFNTLTKLSVSAENYPFCTIDPNEA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            R+ VPDERFEWLC++YKP S+V  FL+I DIAGLV+GAHEGQGLGN+FLSHI AVDG+FH
Sbjct  62   RIPVPDERFEWLCEVYKPASKVPGFLDIWDIAGLVKGAHEGQGLGNAFLSHIMAVDGLFH  121

Query  534  VLRAFE  551
            V RAFE
Sbjct  122  VCRAFE  127



>ref|XP_005535678.1| GTP-binding protein of Obg family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79392.1| GTP-binding protein of Obg family [Cyanidioschyzon merolae strain 
10D]
Length=400

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  K  +    RPILGRFS +LK+GIVGLPNVGKST FNTL+KL++ AEN+PFCTIE
Sbjct  1    MAPK--KRTDEGERRPILGRFSHNLKMGIVGLPNVGKSTFFNTLSKLNVAAENYPFCTIE  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEARV +PDER++WLC+LY+P S V AFLE+ DIAGLVRGAHEGQGLGN+FLS+I+AVD
Sbjct  59   PNEARVPLPDERYDWLCELYRPTSRVPAFLEVWDIAGLVRGAHEGQGLGNAFLSNIQAVD  118

Query  522  GIFHVLRAFE  551
            GI+HV RAF+
Sbjct  119  GIYHVCRAFD  128



>gb|KDD75506.1| DUF933 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=398

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = +3

Query  153  AKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFC  332
             ++MPPK    KE   ERPILGRF S+LK+GIVGLPNVGKSTLFN+L +LSIPAENFPFC
Sbjct  5    GEDMPPKK---KEEVKERPILGRFKSNLKVGIVGLPNVGKSTLFNSLGQLSIPAENFPFC  61

Query  333  TIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIR  512
            TI+PN ARVN+PD+RF WL   YKPKS V AF++I DIAGLV+GA +G+GLGN+FLSHI 
Sbjct  62   TIDPNTARVNIPDDRFTWLTNQYKPKSTVPAFIDIVDIAGLVKGAAQGEGLGNAFLSHIT  121

Query  513  AVDGIFHVLRAF  548
            +VDGIFHV R F
Sbjct  122  SVDGIFHVCRCF  133



>ref|XP_008397279.1| PREDICTED: obg-like ATPase 1 isoform X2 [Poecilia reticulata]
Length=391

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN LTK   PAENFPFCTI+
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHLTRAFE  130



>ref|XP_008397269.1| PREDICTED: obg-like ATPase 1 isoform X1 [Poecilia reticulata]
Length=398

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN LTK   PAENFPFCTI+
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHLTRAFE  130



>ref|XP_007546548.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=398

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN LTK   PAENFPFCTI+
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTALKIGIVGLPNVGKSTFFNVLTKSQAPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHLTRAFE  130



>ref|XP_006636566.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Lepisosteus oculatus]
Length=401

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  150  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPF  329
            A K+MPPK  KG E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPF
Sbjct  2    APKKMPPK--KGGEAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPF  59

Query  330  CTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  509
            CTI+PNE+RV +PDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI
Sbjct  60   CTIDPNESRVPIPDERFDYLCQFHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHI  119

Query  510  RAVDGIFHVLRAFE  551
             A D IFH+ RAFE
Sbjct  120  NACDAIFHMTRAFE  133



>ref|XP_005716907.1| GTP-binding protein of Obg family [Chondrus crispus]
 emb|CDF37088.1| GTP-binding protein of Obg family [Chondrus crispus]
Length=398

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKG-KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            MPPK   G  + P+ER +LGRF+ +LK+GIVG+PNVGKST FNTLTK ++PAENFPFCTI
Sbjct  1    MPPKKKGGASDAPSERLMLGRFTHNLKMGIVGMPNVGKSTFFNTLTKCNVPAENFPFCTI  60

Query  339  EPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAV  518
            EPNEARV VPDERF+WL   +KP S+VSA+L++ DIAGLV+ A +G+GLGN+FLS+I+AV
Sbjct  61   EPNEARVPVPDERFDWLVDHWKPGSKVSAYLDVWDIAGLVKNASQGEGLGNAFLSNIQAV  120

Query  519  DGIFHVLRAF  548
            DGIFH+ RAF
Sbjct  121  DGIFHMCRAF  130



>ref|XP_010291164.1| PREDICTED: obg-like ATPase 1 [Phaethon lepturus]
 gb|KFQ80651.1| Obg-like ATPase 1 [Phaethon lepturus]
Length=243

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005847323.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
 gb|EFN55221.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
Length=390

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  210  ILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDERFEWL  389
            ILGRF ++LK+GIVGLPNVGKSTLFNTLT+LSIPAENFPFCTI+PN ARV VPD RF+WL
Sbjct  14   ILGRFRTNLKMGIVGLPNVGKSTLFNTLTRLSIPAENFPFCTIDPNNARVVVPDPRFDWL  73

Query  390  CQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            C+  +PK+ V A+LE+ DIAGLV+GA EGQGLGNSFLSHI AVDGIFHV RAF+
Sbjct  74   CEKVQPKATVPAYLEVCDIAGLVKGAAEGQGLGNSFLSHISAVDGIFHVCRAFD  127



>gb|EFX64851.1| hypothetical protein DAPPUDRAFT_333762 [Daphnia pulex]
Length=398

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +  P  +P++GR  + LKIGIVGLPNVGKST FN LTK + PAENFPFCTI+
Sbjct  1    MPPKK---EAAPEPKPLIGRVGTSLKIGIVGLPNVGKSTFFNILTKSAAPAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE +V VPD+RF+WLC+ YKP S+V A+L I DIAGLV+GAHEGQGLGN+FLSHIR+VD
Sbjct  58   PNENKVAVPDDRFDWLCEHYKPASKVQAYLNIVDIAGLVKGAHEGQGLGNAFLSHIRSVD  117

Query  522  GIFHVLRAFE  551
             IFH+ R FE
Sbjct  118  AIFHLCRTFE  127



>ref|XP_010226941.1| PREDICTED: obg-like ATPase 1 [Tinamus guttatus]
 gb|KGL72436.1| Obg-like ATPase 1 [Tinamus guttatus]
Length=243

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_008297045.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=398

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHMTRAFE  130



>ref|XP_006788528.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=398

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGADAPKSPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHINACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  121  GIFHMTRAFD  130



>gb|KFP77737.1| Obg-like ATPase 1, partial [Acanthisitta chloris]
Length=322

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_006003587.1| PREDICTED: obg-like ATPase 1 isoform X1 [Latimeria chalumnae]
Length=401

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  156  KEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCT  335
            K+MPPK  K  + P + PI+GRF + L+IGIVGLPNVGKST FN LTK    AENFPFCT
Sbjct  4    KKMPPK--KADDGPKQHPIIGRFGTSLRIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCT  61

Query  336  IEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRA  515
            I+PNE+RV VPD R+E+LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A
Sbjct  62   IDPNESRVPVPDARYEYLCQHHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISA  121

Query  516  VDGIFHVLRAFE  551
             DGIFH+ RAFE
Sbjct  122  CDGIFHLTRAFE  133



>ref|XP_005723544.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Pundamilia nyererei]
 ref|XP_005921547.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Haplochromis burtoni]
Length=398

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGADAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHINACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  121  GIFHMTRAFD  130



>gb|EMS48298.1| Obg-like ATPase 1 [Triticum urartu]
Length=347

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  249  VGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARVNVPDERFEWLCQLYKPKSEVSAF  428
            VGLPNVGKST FN +TKLSIPAENFPFCTIEPNEARV+VPDERF++LCQL+KPKSEV+A+
Sbjct  22   VGLPNVGKSTFFNIVTKLSIPAENFPFCTIEPNEARVHVPDERFDYLCQLFKPKSEVAAY  81

Query  429  LEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFE  551
            LEI+DIAGLVRGA  G+GLGN+FLSHIRAVDGIFHVLRAFE
Sbjct  82   LEINDIAGLVRGASAGEGLGNAFLSHIRAVDGIFHVLRAFE  122



>gb|AAY14779.1| unknown [Homo sapiens]
Length=183

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>emb|CEG00523.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=398

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +EV      LGRFSS+LK+GIVG+PNVGKSTL+N LT  +IPAENFPFCTIE
Sbjct  1    MPPKKQVEEEVLGPWS-LGRFSSNLKVGIVGMPNVGKSTLYNALTNCAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN  RVNVPDERF+WL  ++KPKS V  FLEI DIAGLV+GA +G GLGN+FLSHI+AVD
Sbjct  60   PNSTRVNVPDERFDWLVDMHKPKSVVQPFLEIVDIAGLVKGAADGAGLGNAFLSHIKAVD  119

Query  522  GIFHVLRAFE  551
            GI HV+R FE
Sbjct  120  GILHVMRCFE  129



>gb|KFG38985.1| putative GTP-binding protein, partial [Toxoplasma gondii FOU]
 gb|KFG41733.1| putative GTP-binding protein, partial [Toxoplasma gondii p89]
 gb|KFH07791.1| putative GTP-binding protein, partial [Toxoplasma gondii VAND]
 gb|KFH16384.1| putative GTP-binding protein, partial [Toxoplasma gondii MAS]
Length=203

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K KE   E+ +LGR  + LK+G+VGLPNVGKST FN L K ++PAEN+PFCTI+P+EA
Sbjct  2    APKKKEQAEEKILLGRPKNTLKMGLVGLPNVGKSTTFNLLCKQAVPAENYPFCTIDPHEA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            R+NVPD+RF+WLC  + PKSEVSA L I DIAGLV GAH+G+GLGN+FLSHI+AVDGI+H
Sbjct  62   RMNVPDDRFKWLCTHFHPKSEVSATLAIFDIAGLVPGAHKGEGLGNAFLSHIQAVDGIYH  121

Query  534  VLRAFE  551
            V+RAFE
Sbjct  122  VVRAFE  127



>ref|XP_009553897.1| PREDICTED: obg-like ATPase 1 [Cuculus canorus]
Length=396

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGSDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_002198993.1| PREDICTED: obg-like ATPase 1 isoform 1 [Taeniopygia guttata]
 ref|XP_004176777.1| PREDICTED: obg-like ATPase 1 isoform 2 [Taeniopygia guttata]
Length=396

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGSDGIKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>gb|EFB23886.1| hypothetical protein PANDA_008995 [Ailuropoda melanoleuca]
Length=245

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +3

Query  159  EMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI
Sbjct  2    QMPPK--KGGDAIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTI  59

Query  339  EPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAV  518
            +PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A 
Sbjct  60   DPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISAC  119

Query  519  DGIFHVLRAFE  551
            DGIFH+ RAFE
Sbjct  120  DGIFHLTRAFE  130



>ref|XP_004341541.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
 gb|ELR19455.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
Length=395

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  KGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEARV  359
            KGKE    +P+LGR +++LK+GIVGLPNVGKSTL+N LTKLS+PAEN+PFCTI+PNEARV
Sbjct  3    KGKEDATPKPLLGRPTANLKMGIVGLPNVGKSTLYNALTKLSVPAENYPFCTIDPNEARV  62

Query  360  NVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVL  539
             VPD RF+WL  ++KP S V A L I DIAGLV+GA  G+GLGN+FLSHIRAVDGIFHV+
Sbjct  63   PVPDRRFDWLVDVFKPASVVPASLAITDIAGLVKGAASGEGLGNAFLSHIRAVDGIFHVV  122

Query  540  RAFE  551
            R FE
Sbjct  123  RIFE  126



>ref|XP_006683298.1| hypothetical protein BATDEDRAFT_33861 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76081.1| hypothetical protein BATDEDRAFT_33861 [Batrachochytrium dendrobatidis 
JAM81]
Length=406

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  +      ERP+LGR S++LK+GIVGLPNVGKS+ FN+LT  S+P+ENFPFCTI+
Sbjct  1    MPPKKIQ----VTERPLLGRPSNNLKMGIVGLPNVGKSSFFNSLTNSSVPSENFPFCTID  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P EARV VPD RF+WLC  YKP S++ A+L + DIAGLV+GA EGQGLGN+FLSHI+AVD
Sbjct  57   PAEARVAVPDTRFDWLCDFYKPASKIPAYLTVIDIAGLVKGAAEGQGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  117  GIFHLCRAFD  126



>ref|XP_008933239.1| PREDICTED: obg-like ATPase 1 [Merops nubicus]
 gb|KFQ24822.1| Obg-like ATPase 1 [Merops nubicus]
Length=396

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSFPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RFE+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFEFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_008526497.1| PREDICTED: obg-like ATPase 1 [Equus przewalskii]
Length=200

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_009680050.1| PREDICTED: obg-like ATPase 1 [Struthio camelus australis]
 gb|KFV84859.1| Obg-like ATPase 1 [Struthio camelus australis]
Length=396

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_008503320.1| PREDICTED: obg-like ATPase 1 [Calypte anna]
 gb|KFO97058.1| Obg-like ATPase 1 [Calypte anna]
Length=396

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005519864.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pseudopodoces humilis]
 ref|XP_005519865.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_005519866.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pseudopodoces humilis]
 ref|XP_008632970.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 ref|XP_008632971.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 gb|KFO59967.1| Obg-like ATPase 1 [Corvus brachyrhynchos]
Length=396

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>gb|KFO72251.1| Obg-like ATPase 1 [Cuculus canorus]
Length=404

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGSDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_010564826.1| PREDICTED: obg-like ATPase 1 [Haliaeetus leucocephalus]
Length=396

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_004557801.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
Length=398

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN LTK   PAENFPFCTI+
Sbjct  1    MAPKKGKGADALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHINACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  121  GIFHMTRAFD  130



>ref|XP_009070315.1| PREDICTED: obg-like ATPase 1 [Acanthisitta chloris]
Length=396

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005152654.1| PREDICTED: obg-like ATPase 1 [Melopsittacus undulatus]
 ref|XP_009086251.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009086252.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009460338.1| PREDICTED: obg-like ATPase 1 [Nipponia nippon]
 ref|XP_009703255.1| PREDICTED: obg-like ATPase 1 [Cariama cristata]
 ref|XP_009863599.1| PREDICTED: obg-like ATPase 1 [Apaloderma vittatum]
 ref|XP_009904955.1| PREDICTED: obg-like ATPase 1 [Picoides pubescens]
 ref|XP_009994461.1| PREDICTED: obg-like ATPase 1 [Chaetura pelagica]
 gb|KFP67376.1| Obg-like ATPase 1 [Cariama cristata]
 gb|KFP84928.1| Obg-like ATPase 1 [Apaloderma vittatum]
 gb|KFQ94658.1| Obg-like ATPase 1 [Nipponia nippon]
 gb|KFU88570.1| Obg-like ATPase 1 [Chaetura pelagica]
 gb|KFV72142.1| Obg-like ATPase 1 [Picoides pubescens]
Length=396

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_008275154.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=395

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKG---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL I DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERFDFLCQYHKPASKVPAFLNIVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_010793340.1| PREDICTED: obg-like ATPase 1 [Notothenia coriiceps]
Length=397

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKP---EAPKQPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSLAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDER+++LCQ +KP S+V AFL + DIAGLV+GAHEGQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERYDFLCQYHKPLSKVPAFLNVTDIAGLVKGAHEGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_011488562.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
 ref|XP_011488563.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
Length=219

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERYDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAF+
Sbjct  118  AIFHMTRAFD  127



>ref|XP_009639084.1| PREDICTED: obg-like ATPase 1 [Egretta garzetta]
 gb|KFP17586.1| Obg-like ATPase 1 [Egretta garzetta]
Length=396

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_010159477.1| PREDICTED: obg-like ATPase 1 [Eurypyga helias]
Length=243

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LC  +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCLYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005049114.1| PREDICTED: obg-like ATPase 1 [Ficedula albicollis]
Length=396

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005818302.1| hypothetical protein GUITHDRAFT_159055 [Guillardia theta CCMP2712]
 gb|EKX31322.1| hypothetical protein GUITHDRAFT_159055 [Guillardia theta CCMP2712]
Length=339

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 108/140 (77%), Gaps = 14/140 (10%)
 Frame = +3

Query  162  MPPKAAKGKEVPAER---PILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFC  332
            MPPK    KE   ER     LGRFS+ LK+GIVGLPNVGKSTL+NTLTK +IPAENFPFC
Sbjct  1    MPPK----KEETTERLGAWALGRFSNRLKVGIVGLPNVGKSTLYNTLTKCAIPAENFPFC  56

Query  333  TIEPNEARVNVPDERFEWLCQLYKP-------KSEVSAFLEIHDIAGLVRGAHEGQGLGN  491
            TI+PNE RVNVPDERF+WL + Y P       KS V  +LEI DIAGLV+GA +G GLGN
Sbjct  57   TIDPNETRVNVPDERFDWLVKTYTPQAPDSHCKSIVHPWLEICDIAGLVKGAAQGAGLGN  116

Query  492  SFLSHIRAVDGIFHVLRAFE  551
            +FLSHIRAVDGI HVLRAFE
Sbjct  117  AFLSHIRAVDGIMHVLRAFE  136



>ref|XP_003961956.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=398

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG++ P   P++GRF + LKIG+VGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGEDAPKPAPLIGRFGTSLKIGVVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PD+R+++LC+ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDQRYDFLCRFHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSHIGACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHMTRAFE  130



>ref|XP_009955691.1| PREDICTED: obg-like ATPase 1, partial [Leptosomus discolor]
 ref|XP_010143384.1| PREDICTED: obg-like ATPase 1, partial [Buceros rhinoceros silvestris]
 ref|XP_010203828.1| PREDICTED: obg-like ATPase 1, partial [Colius striatus]
Length=124

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVL  539
            GIFH++
Sbjct  119  GIFHLM  124



>ref|XP_002920288.2| PREDICTED: obg-like ATPase 1 isoform X1 [Ailuropoda melanoleuca]
Length=243

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDAIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004347436.1| GTP-binding protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93979.1| GTP-binding protein [Capsaspora owczarzaki ATCC 30864]
Length=393

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK A+ +E+     +LGR  ++L+ GIVGLPNVGKST FN LTK S  AENFPFCTIE
Sbjct  1    MPPKKAEEEEIV----LLGRVGTNLRCGIVGLPNVGKSTFFNVLTKSSAAAENFPFCTIE  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR  VPDERF+WLC  +KP S+V A+L+I DIAGLV+GA EGQGLGN+FLSHI+AVD
Sbjct  57   PNEARCPVPDERFDWLCAHHKPASKVPAYLQITDIAGLVKGAAEGQGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
            GIFH+LR FE
Sbjct  117  GIFHMLRTFE  126



>ref|XP_007430998.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Python bivittatus]
Length=401

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  150  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPF  329
            A K+MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPF
Sbjct  2    APKKMPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPF  59

Query  330  CTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  509
            CTI+PNE+RV VPD+R+E+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI
Sbjct  60   CTIDPNESRVPVPDDRYEFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHI  119

Query  510  RAVDGIFHVLRAFE  551
             A DGIFH+LR+F+
Sbjct  120  SACDGIFHLLRSFD  133



>ref|XP_006003588.1| PREDICTED: obg-like ATPase 1 isoform X2 [Latimeria chalumnae]
 ref|XP_006003589.1| PREDICTED: obg-like ATPase 1 isoform X3 [Latimeria chalumnae]
 ref|XP_006003590.1| PREDICTED: obg-like ATPase 1 isoform X4 [Latimeria chalumnae]
Length=396

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K  + P + PI+GRF + L+IGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLRIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD R+E+LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDARYEYLCQHHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_010736092.1| PREDICTED: obg-like ATPase 1 isoform X1 [Larimichthys crocea]
Length=398

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIG+VGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGDDASKPPPLIGRFGTSLKIGVVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHMTRAFE  130



>emb|CEP19285.1| hypothetical protein [Parasitella parasitica]
Length=382

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    K V  E+ +LGR S++LKIG+VGLPNVGKST FN LT  S  AEN+PFCTI+
Sbjct  1    MPPK----KAVQEEKTMLGRPSNNLKIGVVGLPNVGKSTFFNALTNASAAAENYPFCTID  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P E+RV VPDERF+WLCQ YKPK E+ AFL + DIAGLV+GA  G GLGN+FLSHI+AVD
Sbjct  57   PEESRVAVPDERFDWLCQHYKPKKEIPAFLTVIDIAGLVKGASSGAGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
             IFHV+RAF+
Sbjct  117  AIFHVVRAFD  126



>ref|XP_008310339.1| PREDICTED: obg-like ATPase 1 [Cynoglossus semilaevis]
Length=396

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK A   E P   P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKA---EAPTAPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQASAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDDRFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_001186941.1| PREDICTED: obg-like ATPase 1-like [Strongylocentrotus purpuratus]
Length=353

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KGKE P ++ + GR  + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGKEAPPKKVLFGRVGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE +V VPD+RF++LC+ +KP S+V AFL + DIAGLV GAHEGQGLGN+FLSHI+A D
Sbjct  59   PNENKVPVPDDRFDFLCEFHKPLSKVPAFLNVTDIAGLVAGAHEGQGLGNAFLSHIKACD  118

Query  522  GIFHVLRAFE  551
             IFHV RAFE
Sbjct  119  AIFHVCRAFE  128



>ref|XP_010884736.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
 ref|XP_010884737.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
 ref|XP_010884739.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
Length=397

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGEGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+ +LC  +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPIPDERYNYLCDFHKPLSKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHMTRAFE  128



>gb|EGV95685.1| Obg-like ATPase 1 [Cricetulus griseus]
Length=290

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  147  SAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFP  326
            SA   MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFP
Sbjct  62   SALCTMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFP  119

Query  327  FCTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSH  506
            FCTI+PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSH
Sbjct  120  FCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSH  179

Query  507  IRAVDGIFHVLRAFE  551
            I A DGIFH+ RAFE
Sbjct  180  ISACDGIFHLTRAFE  194



>ref|XP_010712062.1| PREDICTED: obg-like ATPase 1 [Meleagris gallopavo]
Length=126

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK A G  V A  PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKA-GDGVKAH-PIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRA  545
            GIFH++R 
Sbjct  119  GIFHLMRT  126



>gb|ELK32737.1| Obg-like ATPase 1 [Myotis davidii]
Length=408

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  135  LLIFSAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPA  314
            + IF    +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     A
Sbjct  4    VYIFVLIFQMPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASA  61

Query  315  ENFPFCTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNS  494
            ENFPFCTI+PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH+GQGLGN+
Sbjct  62   ENFPFCTIDPNESRVPVPDERFDFLCQYHKPVSKIPAFLNVVDIAGLVKGAHQGQGLGNA  121

Query  495  FLSHIRAVDGIFHVLRAFE  551
            FLSHI A DGIFH+ RAFE
Sbjct  122  FLSHISACDGIFHLTRAFE  140



>ref|XP_008326510.1| PREDICTED: obg-like ATPase 1 isoform X2 [Cynoglossus semilaevis]
Length=398

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MSPKKGKGDDALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQYHKPASKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHLTRAFE  130



>gb|EET02224.1| GTP-binding protein, putative [Giardia intestinalis ATCC 50581]
Length=406

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K ++      +LGR  + L +GIVGLPNVGKS  F+TLTK+ +P+EN+PFCTI+
Sbjct  1    MPPKGKKEEDESKVIALLGRAKNSLSMGIVGLPNVGKSLTFSTLTKVQVPSENYPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARV VPD+RFEWLC+ +KPKSEVS FL+I DIAGL++GA EG GLGN+FLSHI+AVD
Sbjct  61   PNHARVAVPDKRFEWLCEHFKPKSEVSTFLDITDIAGLIKGASEGNGLGNAFLSHIKAVD  120

Query  522  GIFHVLRAF  548
            GI+HV+R F
Sbjct  121  GIYHVVRVF  129



>gb|KGB37524.1| Obg-like ATPase 1 [Schistosoma haematobium]
Length=396

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            + K  +VP +  +LGR  ++LK G+VGLPNVGKST FN LTK  +PAENFPFCTI PNE+
Sbjct  2    SKKKGDVPKKAVLLGRIGTNLKCGVVGLPNVGKSTFFNILTKSQVPAENFPFCTINPNES  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            RV VPDERF+WLC+ ++P S V A+L + DIAGLV+GAHEGQGLGN+FLSHIR+VD IFH
Sbjct  62   RVAVPDERFDWLCEYHQPVSRVPAYLNVVDIAGLVKGAHEGQGLGNAFLSHIRSVDAIFH  121

Query  534  VLRAFE  551
            +LR FE
Sbjct  122  MLRLFE  127



>gb|ESU42350.1| GTPase, TGS domain protein [Giardia intestinalis]
Length=406

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K ++      +LGR  + L +GIVGLPNVGKS  F+TLTK+ +P+EN+PFCTI+
Sbjct  1    MPPKGKKEEDESKVIALLGRAKNSLSMGIVGLPNVGKSLTFSTLTKVQVPSENYPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARV VPD+RFEWLC+ +KPKSEVS FL+I DIAGL++GA EG GLGN+FLSHI+AVD
Sbjct  61   PNHARVAVPDKRFEWLCEHFKPKSEVSTFLDITDIAGLIKGASEGNGLGNAFLSHIKAVD  120

Query  522  GIFHVLRAF  548
            GI+HV+R F
Sbjct  121  GIYHVVRVF  129



>ref|XP_797209.1| PREDICTED: obg-like ATPase 1-like [Strongylocentrotus purpuratus]
Length=394

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KGKE P ++ + GR  + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGKEAPPKKVLFGRVGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE +V VPD+RF++LC+ +KP S+V AFL + DIAGLV GAHEGQGLGN+FLSHI+A D
Sbjct  59   PNENKVPVPDDRFDFLCEFHKPLSKVPAFLNVTDIAGLVAGAHEGQGLGNAFLSHIKACD  118

Query  522  GIFHVLRAFE  551
             IFHV RAFE
Sbjct  119  AIFHVCRAFE  128



>gb|EFX64850.1| hypothetical protein DAPPUDRAFT_219469 [Daphnia pulex]
Length=399

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 6/132 (5%)
 Frame = +3

Query  162  MPPKAAKGKEVPAE-RPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            MPPK    KE   E +P++GR  + LKIGIVGLPNVGKST FN LTK + PAENFPFCTI
Sbjct  1    MPPK----KETALEPKPLIGRIGTSLKIGIVGLPNVGKSTFFNVLTKSAAPAENFPFCTI  56

Query  339  EPNEARVNVPDERFEWLCQLYKPKS-EVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRA  515
            +PNE++V VPDERF+WL Q YKP S ++ A+L I DIAGLV+GAHEGQGLGN+FLSHIR+
Sbjct  57   DPNESKVGVPDERFDWLLQHYKPSSPKIQAYLNIVDIAGLVKGAHEGQGLGNAFLSHIRS  116

Query  516  VDGIFHVLRAFE  551
            VD IFH+ R FE
Sbjct  117  VDAIFHLCRTFE  128



>dbj|BAG59026.1| unnamed protein product [Homo sapiens]
Length=273

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_010747153.1| PREDICTED: obg-like ATPase 1 [Larimichthys crocea]
Length=404

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKV---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDDRFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_005300475.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chrysemys picta bellii]
Length=402

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  150  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPF  329
            A ++MPPK   G +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPF
Sbjct  2    APRKMPPKKG-GDDGVKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPF  60

Query  330  CTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  509
            CTI+PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI
Sbjct  61   CTIDPNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHI  120

Query  510  RAVDGIFHVLRAFE  551
             A DGIFH++R+FE
Sbjct  121  SACDGIFHLMRSFE  134



>emb|CCD81858.1| GTP-binding protein-related [Schistosoma mansoni]
Length=396

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            + K  +VP +  +LGR  ++LK G+VGLPNVGKST FN LTK  +PAENFPFCTI PNE+
Sbjct  2    SKKKGDVPKKTVLLGRIGTNLKCGVVGLPNVGKSTFFNILTKSQVPAENFPFCTINPNES  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            RV VPDERF+WLC+ ++P S V A+L + DIAGLV+GAHEGQGLGN+FLSHIR VD IFH
Sbjct  62   RVAVPDERFDWLCEYHQPVSRVPAYLNVVDIAGLVKGAHEGQGLGNAFLSHIRGVDAIFH  121

Query  534  VLRAFE  551
            +LR FE
Sbjct  122  MLRLFE  127



>ref|XP_007512524.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17124.1| predicted protein [Bathycoccus prasinos]
Length=400

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  + +E P     LGRFSS+LK+GIVG+PNVGKSTL+N LT  +IPAENFPFCTI+
Sbjct  1    MPPKKKEVEEEPLGPWSLGRFSSNLKVGIVGMPNVGKSTLYNALTNCAIPAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN  RVNVPDERF+WL   +KPKS V  +LE+ DIAGLV+GA +G GLGN+FLSHI+A D
Sbjct  61   PNNTRVNVPDERFDWLVNTHKPKSVVQPYLEVVDIAGLVKGAADGAGLGNAFLSHIKATD  120

Query  522  GIFHVLRAFE  551
            G+ H LRAF+
Sbjct  121  GVIHCLRAFD  130



>gb|AAH77496.1| Ola1 protein [Xenopus laevis]
Length=281

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN LTK    AENFPFCTI 
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTIN  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RFE+LC+ +KP S+V AFL + DIAGLV+GA  GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFEFLCEHHKPASKVPAFLNVVDIAGLVKGASAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAF+
Sbjct  119  GIFHLMRAFD  128



>gb|KII61429.1| Obg-like ATPase 1 [Thelohanellus kitauei]
Length=184

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K K V  + P+LGRF++ LKIGIVGLPNVGKS+ FNTLTK S+PAEN+PFCTI+P ++
Sbjct  2    ATKSKTVEEDLPLLGRFTTQLKIGIVGLPNVGKSSFFNTLTKSSVPAENYPFCTIDPCKS  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            RV VPD RF++L + +KP S V AFL + DIAGLV GA EGQGLGN+FLSHI+  D IFH
Sbjct  62   RVAVPDPRFDYLVEHFKPNSSVPAFLNVVDIAGLVAGASEGQGLGNAFLSHIKECDAIFH  121

Query  534  VLRAFE  551
            ++RAF+
Sbjct  122  MIRAFD  127



>ref|NP_001158828.1| obg-like ATPase 1 [Salmo salar]
 gb|ACN10563.1| Obg-like ATPase 1 [Salmo salar]
 emb|CDQ78712.1| unnamed protein product [Oncorhynchus mykiss]
Length=397

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  +G   P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKGEG---PKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LC  +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPIPDERYDYLCTFHKPLSKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  118  GIFHMTRAFE  127



>gb|AAH13925.1| OLA1 protein [Homo sapiens]
 gb|EAX11149.1| GTP-binding protein PTD004, isoform CRA_a [Homo sapiens]
 gb|AIC60032.1| OLA1, partial [synthetic construct]
Length=278

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|NP_084367.1| obg-like ATPase 1 isoform b [Mus musculus]
Length=270

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_008397950.1| PREDICTED: obg-like ATPase 1 [Poecilia reticulata]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    A+NFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAADNFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERFDYLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAF+
Sbjct  118  AIFHMTRAFD  127



>ref|XP_006204987.1| PREDICTED: obg-like ATPase 1-like [Vicugna pacos]
Length=139

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGSDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLR  542
            GIFH+ R
Sbjct  119  GIFHLTR  125



>ref|XP_007576845.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    A+NFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAADNFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERFDYLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAF+
Sbjct  118  AIFHMTRAFD  127



>ref|XP_005798398.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    A+NFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAADNFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERFDYLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAF+
Sbjct  118  AIFHMTRAFD  127



>ref|XP_003442972.1| PREDICTED: obg-like ATPase 1-like [Oreochromis niloticus]
 ref|XP_004540365.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
 ref|XP_004540366.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLS+I A D
Sbjct  58   PNESRVPVPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSNISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_004004627.1| PREDICTED: obg-like ATPase 1 [Ovis aries]
Length=425

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 105/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  156  KEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCT  335
            +EMPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCT
Sbjct  28   REMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCT  85

Query  336  IEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRA  515
            I+PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A
Sbjct  86   IDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISA  145

Query  516  VDGIFHVLRAFE  551
             DGIFH+ RAFE
Sbjct  146  CDGIFHLTRAFE  157



>ref|XP_006798459.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLS+I A D
Sbjct  58   PNESRVPVPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSNISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_005723778.1| PREDICTED: obg-like ATPase 1-like [Pundamilia nyererei]
 ref|XP_005934395.1| PREDICTED: obg-like ATPase 1-like [Haplochromis burtoni]
Length=395

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLS+I A D
Sbjct  58   PNESRVPVPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSNISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>gb|ACO09273.1| GTP-binding protein PTD004 [Osmerus mordax]
Length=395

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK +   + P + P++GRF + LKIGIVG+PNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKS---DAPKQPPLIGRFGTSLKIGIVGIPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPIPDERYDYLCQFHKPLSKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  118  GIFHMTRAFD  127



>ref|XP_006116548.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pelodiscus sinensis]
Length=425

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  150  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPF  329
            A ++MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN LTK    AENFPF
Sbjct  20   ARRKMPPK--KGVDGVKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVLTKSQAAAENFPF  77

Query  330  CTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHI  509
            CTI+PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI
Sbjct  78   CTIDPNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHI  137

Query  510  RAVDGIFHVLRAFE  551
             A DGIFH++R+FE
Sbjct  138  SACDGIFHLMRSFE  151



>ref|XP_003764019.1| PREDICTED: obg-like ATPase 1 [Sarcophilus harrisii]
Length=396

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG E     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGEGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++R+FE
Sbjct  119  GIFHLMRSFE  128



>ref|NP_001026425.1| obg-like ATPase 1 [Gallus gallus]
 sp|Q5ZM25.1|OLA1_CHICK RecName: Full=Obg-like ATPase 1 [Gallus gallus]
 emb|CAG31218.1| hypothetical protein RCJMB04_3f20 [Gallus gallus]
Length=396

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK A G  V A  PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKA-GDGVKA-HPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGNSFLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAFE
Sbjct  119  GIFHLMRAFE  128



>ref|XP_005452973.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Oreochromis niloticus]
Length=398

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKGKGADALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHINACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  121  GIFHMTRAFD  130



>emb|CDQ57167.1| unnamed protein product [Oncorhynchus mykiss]
Length=399

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKQKGGDGQQPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPVSKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHMTRAFE  130



>gb|ABG67106.1| GTP-binding protein PTD004 [Bos taurus]
Length=133

 Score =   176 bits (447),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLR  542
            GIFH+ R
Sbjct  119  GIFHLTR  125



>ref|XP_001708009.1| GTP-binding protein, putative [Giardia lamblia ATCC 50803]
 gb|EDO80335.1| GTP-binding protein, putative [Giardia lamblia ATCC 50803]
Length=406

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K ++      +LGR  + L +GIVGLPNVGKS  F+TLTK+ +P+EN+PFCTI+
Sbjct  1    MPPKGKKEEDDSKVIALLGRAKNSLSMGIVGLPNVGKSLTFSTLTKVQVPSENYPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARV VPD+RFEWLC  +KPKSEVS FL+I DIAGL++GA EG GLGN+FLSHI+AVD
Sbjct  61   PNHARVAVPDKRFEWLCGHFKPKSEVSTFLDITDIAGLIKGASEGNGLGNAFLSHIKAVD  120

Query  522  GIFHVLRAF  548
            GI+HV+R F
Sbjct  121  GIYHVVRVF  129



>gb|ESU36180.1| GTPase, TGS domain protein [Giardia intestinalis]
Length=406

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K ++      +LGR  + L +GIVGLPNVGKS  F+TLTK+ +P+EN+PFCTI+
Sbjct  1    MPPKGKKEEDDSKVIALLGRAKNSLSMGIVGLPNVGKSLTFSTLTKVQVPSENYPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARV VPD+RFEWLC  +KPKSEVS FL+I DIAGL++GA EG GLGN+FLSHI+AVD
Sbjct  61   PNHARVAVPDKRFEWLCGHFKPKSEVSTFLDITDIAGLIKGASEGNGLGNAFLSHIKAVD  120

Query  522  GIFHVLRAF  548
            GI+HV+R F
Sbjct  121  GIYHVVRVF  129



>ref|XP_008878070.1| GTP-binding protein YchF, variant 2 [Aphanomyces invadans]
 ref|XP_008878071.1| GTP-binding protein YchF, variant 3 [Aphanomyces invadans]
 gb|ETV93236.1| GTP-binding protein YchF, variant 2 [Aphanomyces invadans]
 gb|ETV93237.1| GTP-binding protein YchF, variant 3 [Aphanomyces invadans]
Length=397

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +E  A R   GR  ++LK+G+VGLPNVGKS+LFN LT  S+ AENFPFCTI+
Sbjct  1    MPPKKQGAEESAAAR--FGRVRNNLKMGLVGLPNVGKSSLFNLLTAQSVAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR  VPDER+EWLC++++P SE  A+L+  DIAGL+RGA EG GLGN+FLSHI+AVD
Sbjct  59   PNEARCAVPDERYEWLCKVWQPPSEYPAYLQCTDIAGLIRGASEGAGLGNAFLSHIQAVD  118

Query  522  GIFHVLRAFE  551
            GIFHV+RAFE
Sbjct  119  GIFHVIRAFE  128



>gb|ETE71660.1| Obg-like ATPase 1, partial [Ophiophagus hannah]
Length=369

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+R+E+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRYEFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+LR+F+
Sbjct  119  GIFHLLRSFD  128



>ref|XP_010878191.1| PREDICTED: obg-like ATPase 1 isoform X3 [Esox lucius]
Length=399

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPKKQKGGDGQQPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  61   PNESRVPIPDERYDFLCQFHKPVSKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  120

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  121  GIFHLARAFE  130



>ref|NP_001008044.1| obg-like ATPase 1 [Xenopus (Silurana) tropicalis]
 sp|Q66JG0.1|OLA1_XENTR RecName: Full=Obg-like ATPase 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80929.1| MGC79585 protein [Xenopus (Silurana) tropicalis]
Length=396

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN LTK    AENFPFCTI 
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTIN  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERFE+LCQ +KP S+V AFL + DIAGLV+GA  GQGLGN+FLS+I A D
Sbjct  59   PNESRVPVPDERFEFLCQYHKPASKVPAFLNVVDIAGLVKGASTGQGLGNAFLSNISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAF+
Sbjct  119  GIFHLMRAFD  128



>ref|XP_004908585.1| PREDICTED: obg-like ATPase 1-like [Heterocephalus glaber]
Length=142

 Score =   176 bits (447),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAF  548
            GIFH+ R +
Sbjct  119  GIFHLTRQW  127



>emb|CAJ83205.1| novel protein similar to GTP-binding protein PTD004 [Xenopus 
(Silurana) tropicalis]
Length=396

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN LTK    AENFPFCTI 
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTIN  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERFE+LCQ +KP S+V AFL + DIAGLV+GA  GQGLGN+FLS+I A D
Sbjct  59   PNESRVPVPDERFEFLCQYHKPASKVPAFLNVVDIAGLVKGASTGQGLGNAFLSNISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAF+
Sbjct  119  GIFHLMRAFD  128



>ref|XP_001421839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00133.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=400

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +EV      LGRFSS+LK+GIVG+PNVGKSTL+N LT  +IPAENFPFCTIE
Sbjct  1    MPPKKVVQEEVLGPWS-LGRFSSNLKVGIVGMPNVGKSTLYNALTNCAIPAENFPFCTIE  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN  RVNVPD RF+WL +  KPKS V+ +LEI DIAGLV+GA  G GLGNSFLSHI+AVD
Sbjct  60   PNSTRVNVPDARFDWLVEQNKPKSVVAPYLEIVDIAGLVKGASTGAGLGNSFLSHIKAVD  119

Query  522  GIFHVLRAFE  551
            GI HV+R FE
Sbjct  120  GIAHVMRCFE  129



>gb|EFO62172.1| GTP-binding protein, putative [Giardia lamblia P15]
Length=406

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K ++      +LGR  + L +GIVGLPNVGKS  F+TLTK+ +P+EN+PFCTI+
Sbjct  1    MPPKGKKEEDDSKIIALLGRAKNSLSMGIVGLPNVGKSLTFSTLTKVQVPSENYPFCTID  60

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PN ARV VPD+RFEWLC  +KPKSEVS FL+I DIAGL++GA EG GLGN+FLSHI+AVD
Sbjct  61   PNHARVAVPDKRFEWLCGHFKPKSEVSTFLDITDIAGLIKGASEGNGLGNAFLSHIKAVD  120

Query  522  GIFHVLRAF  548
            GI+HV+R F
Sbjct  121  GIYHVVRVF  129



>ref|XP_006174829.1| PREDICTED: obg-like ATPase 1 isoform X2 [Camelus ferus]
Length=278

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LK GIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGSDGIKPPPIIGRFGTSLKTGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_008878069.1| GTP-binding protein YchF, variant 1 [Aphanomyces invadans]
 ref|XP_008878072.1| GTP-binding protein YchF [Aphanomyces invadans]
 gb|ETV93234.1| GTP-binding protein YchF [Aphanomyces invadans]
 gb|ETV93235.1| GTP-binding protein YchF, variant 1 [Aphanomyces invadans]
Length=411

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +E  A R   GR  ++LK+G+VGLPNVGKS+LFN LT  S+ AENFPFCTI+
Sbjct  1    MPPKKQGAEESAAAR--FGRVRNNLKMGLVGLPNVGKSSLFNLLTAQSVAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR  VPDER+EWLC++++P SE  A+L+  DIAGL+RGA EG GLGN+FLSHI+AVD
Sbjct  59   PNEARCAVPDERYEWLCKVWQPPSEYPAYLQCTDIAGLIRGASEGAGLGNAFLSHIQAVD  118

Query  522  GIFHVLRAFE  551
            GIFHV+RAFE
Sbjct  119  GIFHVIRAFE  128



>ref|XP_009296560.1| PREDICTED: obg-like ATPase 1, partial [Danio rerio]
Length=124

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG + P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLS+I A D
Sbjct  59   PNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACD  118

Query  522  GIFHV  536
             IFH+
Sbjct  119  AIFHM  123



>ref|XP_008256981.1| PREDICTED: obg-like ATPase 1 isoform X2 [Oryctolagus cuniculus]
Length=327

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_008885365.1| GTP-binding protein, putative [Hammondia hammondi]
 gb|KEP63833.1| GTP-binding protein, putative [Hammondia hammondi]
Length=396

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K +E   E+ +LGR  + LK+G+VGLPNVGKST FN L K ++PAEN+PFCTI+P+EA
Sbjct  2    APKKREQAEEKILLGRPKNTLKMGLVGLPNVGKSTTFNLLCKQAVPAENYPFCTIDPHEA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            R+NVPD+RF+WLC  ++PKSEVSA L I DIAGLV GAH+G+GLGN+FLSHI+AVDGI+H
Sbjct  62   RMNVPDDRFKWLCTHFRPKSEVSATLAIFDIAGLVPGAHKGEGLGNAFLSHIQAVDGIYH  121

Query  534  VLRAFE  551
            V+RAFE
Sbjct  122  VVRAFE  127



>emb|CDQ81805.1| unnamed protein product [Oncorhynchus mykiss]
Length=473

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = +3

Query  159  EMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTI  338
            +MPPK  +G   P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI
Sbjct  76   KMPPKKGEG---PKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTI  132

Query  339  EPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAV  518
            +PNE+RV +PDER+++LC  +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A 
Sbjct  133  DPNESRVPIPDERYDYLCTFHKPLSKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISAC  192

Query  519  DGIFHVLRAFE  551
            DGIFH+ RAFE
Sbjct  193  DGIFHMTRAFE  203



>ref|XP_008685352.1| PREDICTED: obg-like ATPase 1 [Ursus maritimus]
Length=396

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDAIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_002429861.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB17123.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=308

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P ++P++GR  ++LK+GIVG+PNVGKST FN LTK S  AENFPFCTI+
Sbjct  1    MPPKKT---EEPEKKPLIGRVGTNLKVGIVGIPNVGKSTFFNVLTKSSAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE +V VPDERF++LC  +KP S+V AFL + DIAGLV+GA EGQGLGN+FLSHI+A D
Sbjct  58   PNENKVPVPDERFDFLCDYFKPLSKVPAFLNVVDIAGLVKGAAEGQGLGNAFLSHIKACD  117

Query  522  GIFHVLRAFE  551
             IFH+LRAFE
Sbjct  118  AIFHLLRAFE  127



>ref|XP_005723545.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Pundamilia nyererei]
 ref|XP_005921548.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Haplochromis burtoni]
Length=396

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MAPK--KGADAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDER+++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPIPDERYDFLCQFHKPASKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHINACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAF+
Sbjct  119  GIFHMTRAFD  128



>ref|XP_001515633.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669441.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669442.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ornithorhynchus anatinus]
Length=396

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++R+FE
Sbjct  119  GIFHLMRSFE  128



>ref|XP_004476855.1| PREDICTED: obg-like ATPase 1 isoform 1 [Dasypus novemcinctus]
Length=403

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 108/141 (77%), Gaps = 6/141 (4%)
 Frame = +3

Query  129  LCLLIFSAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSI  308
            + LL F    +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT    
Sbjct  1    MFLLTF----QMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQA  54

Query  309  PAENFPFCTIEPNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLG  488
             AENFPFCTI+PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLG
Sbjct  55   SAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLG  114

Query  489  NSFLSHIRAVDGIFHVLRAFE  551
            N+FLSHI A DGIFH+ RAFE
Sbjct  115  NAFLSHISACDGIFHLTRAFE  135



>ref|XP_002370768.1| GTP binding protein, putative [Toxoplasma gondii ME49]
 gb|EPR60171.1| putative GTP-binding protein [Toxoplasma gondii GT1]
 gb|EPT26550.1| GTP-binding protein, putative [Toxoplasma gondii ME49]
 gb|ESS31143.1| putative GTP-binding protein [Toxoplasma gondii VEG]
 gb|KFG35914.1| putative GTP-binding protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG62279.1| putative GTP-binding protein [Toxoplasma gondii RUB]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K KE   E+ +LGR  + LK+G+VGLPNVGKST FN L K ++PAEN+PFCTI+P+EA
Sbjct  2    APKKKEQAEEKILLGRPKNTLKMGLVGLPNVGKSTTFNLLCKQAVPAENYPFCTIDPHEA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            R+NVPD+RF+WLC  + PKSEVSA L I DIAGLV GAH+G+GLGN+FLSHI+AVDGI+H
Sbjct  62   RMNVPDDRFKWLCTHFHPKSEVSATLAIFDIAGLVPGAHKGEGLGNAFLSHIQAVDGIYH  121

Query  534  VLRAFE  551
            V+RAFE
Sbjct  122  VVRAFE  127



>ref|XP_010605331.1| PREDICTED: obg-like ATPase 1 isoform X1 [Fukomys damarensis]
Length=397

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  2    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERFE+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  60   PNESRVPVPDERFEFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  119

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  120  GIFHLTRAFE  129



>ref|XP_003962811.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKG---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDER+++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERYDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSHINACD  117

Query  522  GIFHVLRAFE  551
             IFH+ R+F+
Sbjct  118  AIFHMTRSFD  127



>ref|XP_011128728.1| putative GTP-binding protein [Gregarina niphandrodes]
 gb|EZG86972.1| putative GTP-binding protein [Gregarina niphandrodes]
Length=382

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    KE  A R +LGR    LK+G+VGLPNVGKST FN L K ++PAENFPFCTI+
Sbjct  1    MPPKK---KEAEASRILLGRPKGTLKMGLVGLPNVGKSTTFNLLCKQAVPAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P+EAR++VPDERF WL + YKPKSE SA L I DIAGLV GA EG+GLGN+FLSHI+AVD
Sbjct  58   PHEARMSVPDERFSWLAEYYKPKSEQSATLAIFDIAGLVPGAAEGEGLGNAFLSHIQAVD  117

Query  522  GIFHVLRAFE  551
            GI+HV+RAFE
Sbjct  118  GIYHVVRAFE  127



>gb|KFO22378.1| Obg-like ATPase 1 [Fukomys damarensis]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERFE+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFEFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004634806.1| PREDICTED: obg-like ATPase 1 isoform X2 [Octodon degus]
Length=375

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>gb|AEE61569.1| unknown [Dendroctonus ponderosae]
Length=399

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK     + P  +P++GR  ++LK+GIVG+PNVGKST FN LTK S PAENFPFCTI+
Sbjct  1    MPPKKV---QEPERKPMIGRVGTNLKVGIVGVPNVGKSTFFNVLTKSSAPAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LC+ +KP S+V AFL I DIAGLV+GA EGQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDDRFDYLCEYFKPLSKVPAFLNIVDIAGLVKGASEGQGLGNAFLSHISACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAFE
Sbjct  118  AIFHLCRAFE  127



>ref|XP_005182762.2| PREDICTED: obg-like ATPase 1 [Musca domestica]
Length=397

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    +E P  +P++GR  ++L+IGIVG+PNVGKST FN LTK + PAENFPFCTI+
Sbjct  1    MPPKK---QEEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTKSAAPAENFPFCTID  57

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LC+ +KP S+V A+L + DIAGLV+GA EGQGLGN+FLSHI A D
Sbjct  58   PNESRVPVPDERFDYLCEYHKPASKVPAYLNVVDIAGLVKGAAEGQGLGNAFLSHINACD  117

Query  522  GIFHVLRAFE  551
             IFH+ RAFE
Sbjct  118  AIFHLCRAFE  127



>ref|XP_004674579.1| PREDICTED: obg-like ATPase 1 isoform X2 [Condylura cristata]
Length=375

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004601223.1| PREDICTED: obg-like ATPase 1 isoform X2 [Sorex araneus]
Length=375

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_007430999.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Python bivittatus]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+R+E+LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRYEFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+LR+F+
Sbjct  119  GIFHLLRSFD  128



>ref|XP_005324665.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ictidomys tridecemlineatus]
Length=375

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004577108.1| PREDICTED: obg-like ATPase 1 isoform X3 [Ochotona princeps]
Length=321

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>dbj|BAB31566.1| unnamed protein product [Mus musculus]
Length=270

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIF++ RAFE
Sbjct  119  GIFYLTRAFE  128



>ref|XP_003225685.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
 ref|XP_008116319.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+LR+F+
Sbjct  119  GIFHLLRSFD  128



>ref|XP_005857658.1| PREDICTED: obg-like ATPase 1 [Myotis brandtii]
 ref|XP_006083169.1| PREDICTED: obg-like ATPase 1 isoform X1 [Myotis lucifugus]
 ref|XP_006083170.1| PREDICTED: obg-like ATPase 1 isoform X2 [Myotis lucifugus]
 ref|XP_006083171.1| PREDICTED: obg-like ATPase 1 isoform X3 [Myotis lucifugus]
 ref|XP_006760667.1| PREDICTED: obg-like ATPase 1 isoform X1 [Myotis davidii]
 ref|XP_006760668.1| PREDICTED: obg-like ATPase 1 isoform X2 [Myotis davidii]
 ref|XP_006760669.1| PREDICTED: obg-like ATPase 1 isoform X3 [Myotis davidii]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH+GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPVSKIPAFLNVVDIAGLVKGAHQGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_006275602.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Alligator mississippiensis]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDEAKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GI H+ RAFE
Sbjct  119  GILHLTRAFE  128



>ref|NP_001079680.1| obg-like ATPase 1 [Xenopus laevis]
 sp|Q7ZWM6.1|OLA1_XENLA RecName: Full=Obg-like ATPase 1 [Xenopus laevis]
 gb|AAH46937.1| Ola1 protein [Xenopus laevis]
Length=396

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN LTK    AENFPFCTI 
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTIN  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RFE+LC+ +KP S+V AFL + DIAGLV+GA  GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFEFLCEHHKPASKVPAFLNVVDIAGLVKGASAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++RAF+
Sbjct  119  GIFHLMRAFD  128



>ref|XP_005300476.1| PREDICTED: obg-like ATPase 1 isoform X3 [Chrysemys picta bellii]
Length=397

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK   G +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKG-GDDGVKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  60   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  119

Query  522  GIFHVLRAFE  551
            GIFH++R+FE
Sbjct  120  GIFHLMRSFE  129



>dbj|GAN04407.1| GTP-binding protein [Mucor ambiguus]
Length=401

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    K V  E+ +LGR S++LKIG+VGLPNVGKST FN LT  S  AEN+PFCTI+
Sbjct  1    MPPK----KAVKEEKAMLGRPSNNLKIGVVGLPNVGKSTFFNALTNASAAAENYPFCTID  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P E+RV VPDERF+WLCQ YKP  E+ A+L + DIAGLV+GA  G GLGN+FLSHI+AVD
Sbjct  57   PEESRVAVPDERFDWLCQHYKPAKEIPAYLTVIDIAGLVKGAASGAGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
             IFHV+RAF+
Sbjct  117  AIFHVVRAFD  126



>ref|XP_004409047.1| PREDICTED: obg-like ATPase 1 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004577107.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ochotona princeps]
Length=375

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_009844285.1| GTP-binding protein YchF [Aphanomyces astaci]
 gb|ETV66216.1| GTP-binding protein YchF [Aphanomyces astaci]
Length=397

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK    ++  A R   GR  ++LK+G+VGLPNVGKS+LFN LT  S+ AENFPFCTI+
Sbjct  1    MPPKKQATEDSAAAR--FGRVRNNLKMGLVGLPNVGKSSLFNLLTAQSVAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNEAR  VPDER+EWLC++++P SE  A+L+  DIAGL+RGA EG GLGN+FLSHI+AVD
Sbjct  59   PNEARCAVPDERYEWLCKVWQPPSEYPAYLQCTDIAGLIRGASEGAGLGNAFLSHIQAVD  118

Query  522  GIFHVLRAFE  551
            GIFHV+RAFE
Sbjct  119  GIFHVIRAFE  128



>dbj|BAE39543.1| unnamed protein product [Mus musculus]
Length=396

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP+S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPESKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>emb|CDH52754.1| gtp-binding protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=399

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK A    V  E+ +LGR S++LKIG+VGLPNVGKST FN LTK S  AEN+PFCTI+
Sbjct  1    MPPKKA----VKEEKLLLGRPSNNLKIGVVGLPNVGKSTFFNALTKSSAAAENYPFCTID  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P E+RV VPDERF+WLCQ YKP  E+ AFL + DIAGLV+GA  G GLGN+FLSHI+AVD
Sbjct  57   PEESRVAVPDERFDWLCQHYKPAKEIPAFLTVIDIAGLVKGAASGAGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
             I+HV+RAF+
Sbjct  117  AIYHVVRAFD  126



>ref|XP_004375552.1| PREDICTED: obg-like ATPase 1 [Trichechus manatus latirostris]
Length=396

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKAPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_003884761.1| putative GTP binding protein [Neospora caninum Liverpool]
 emb|CBZ54733.1| putative GTP binding protein [Neospora caninum Liverpool]
Length=396

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIEPNEA  353
            A K KE   E+ +LGR  + LK+G+VGLPNVGKST FN L K ++PAEN+PFCTI+P+EA
Sbjct  2    APKKKEQAEEKILLGRPRNTLKMGLVGLPNVGKSTTFNLLCKQAVPAENYPFCTIDPHEA  61

Query  354  RVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFH  533
            R+NVPD+RF+WLC  + PKSEVSA L I DIAGLV GAH G+GLGN+FLSHI+AVDGI+H
Sbjct  62   RMNVPDDRFKWLCNHFHPKSEVSATLAIFDIAGLVPGAHRGEGLGNAFLSHIQAVDGIYH  121

Query  534  VLRAFE  551
            V+RAFE
Sbjct  122  VVRAFE  127



>emb|CDS09858.1| Putative GTP-binding protein YchF [Absidia idahoensis var. thermophila]
Length=399

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK A    V  E+ +LGR S++LKIG+VGLPNVGKST FN LTK S  AEN+PFCTI+
Sbjct  1    MPPKKA----VKEEKLLLGRPSNNLKIGVVGLPNVGKSTFFNALTKSSAAAENYPFCTID  56

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            P E+RV VPDERF+WLCQ YKP  E+ AFL + DIAGLV+GA  G GLGN+FLSHI+AVD
Sbjct  57   PEESRVAVPDERFDWLCQHYKPAKEIPAFLTVIDIAGLVKGAASGAGLGNAFLSHIKAVD  116

Query  522  GIFHVLRAFE  551
             I+HV+RAF+
Sbjct  117  AIYHVVRAFD  126



>ref|XP_007060593.1| PREDICTED: obg-like ATPase 1 [Chelonia mydas]
 gb|EMP35100.1| Obg-like ATPase 1, partial [Chelonia mydas]
Length=397

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK   G +     PI+GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPKKG-GDDGVKPHPIVGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  59

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  60   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  119

Query  522  GIFHVLRAFE  551
            GIFH++R+FE
Sbjct  120  GIFHLMRSFE  129



>ref|NP_999865.1| obg-like ATPase 1 isoform 1 [Danio rerio]
 sp|Q7ZU42.1|OLA1_DANRE RecName: Full=Obg-like ATPase 1 [Danio rerio]
 gb|AAH51155.1| Zgc:55768 [Danio rerio]
 gb|AAH67579.1| Zgc:55768 [Danio rerio]
Length=396

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG + P + P++GRF + LKIGIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV +PDERF++LCQ +KP S+V AFL + DIAGLV+GAH GQGLGN+FLS+I A D
Sbjct  59   PNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACD  118

Query  522  GIFHVLRAFE  551
             IFH+ RAFE
Sbjct  119  AIFHMTRAFE  128



>ref|XP_006020859.1| PREDICTED: obg-like ATPase 1 [Alligator sinensis]
Length=396

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGGDEAKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GI H+ RAFE
Sbjct  119  GILHLTRAFE  128



>ref|XP_006116549.1| PREDICTED: obg-like ATPase 1 isoform X4 [Pelodiscus sinensis]
Length=402

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN LTK    AENFPFCTI+
Sbjct  1    MPPK--KGVDGVKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH++R+FE
Sbjct  119  GIFHLMRSFE  128



>ref|XP_006972493.1| PREDICTED: obg-like ATPase 1 [Peromyscus maniculatus bairdii]
 ref|XP_008062942.1| PREDICTED: obg-like ATPase 1 [Tarsius syrichta]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK A     P   PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPKKAGDGIKPP--PIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004634805.1| PREDICTED: obg-like ATPase 1 isoform X1 [Octodon degus]
 ref|XP_005393249.1| PREDICTED: obg-like ATPase 1 [Chinchilla lanigera]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGVKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_005346631.1| PREDICTED: obg-like ATPase 1 [Microtus ochrogaster]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004601222.1| PREDICTED: obg-like ATPase 1 isoform X1 [Sorex araneus]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQAAAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_010858116.1| PREDICTED: obg-like ATPase 1 isoform X2 [Bison bison bison]
Length=389

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004674578.1| PREDICTED: obg-like ATPase 1 isoform X1 [Condylura cristata]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHSGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|NP_080218.1| obg-like ATPase 1 isoform a [Mus musculus]
 sp|Q9CZ30.1|OLA1_MOUSE RecName: Full=Obg-like ATPase 1; AltName: Full=GTP-binding protein 
9 [Mus musculus]
 dbj|BAB28624.1| unnamed protein product [Mus musculus]
 gb|AAH11318.1| Obg-like ATPase 1 [Mus musculus]
 gb|AAH29207.1| Obg-like ATPase 1 [Mus musculus]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|NP_001039510.1| obg-like ATPase 1 [Bos taurus]
 ref|XP_010858115.1| PREDICTED: obg-like ATPase 1 isoform X1 [Bison bison bison]
 sp|Q2HJ33.1|OLA1_BOVIN RecName: Full=Obg-like ATPase 1 [Bos taurus]
 gb|AAI13337.1| Obg-like ATPase 1 [Bos taurus]
 tpg|DAA32812.1| TPA: Obg-like ATPase 1 [Bos taurus]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_006878885.1| PREDICTED: obg-like ATPase 1-like [Elephantulus edwardii]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_003406265.1| PREDICTED: obg-like ATPase 1 [Loxodonta africana]
 ref|XP_007938890.1| PREDICTED: obg-like ATPase 1 isoform X1 [Orycteropus afer afer]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>tpg|DAA13236.1| TPA: Obg-like ATPase 1-like [Bos taurus]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>ref|XP_004703788.1| PREDICTED: obg-like ATPase 1 isoform X2 [Echinops telfairi]
Length=375

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPD+RF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDDRFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



>dbj|BAB27201.1| unnamed protein product [Mus musculus]
Length=396

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLSIPAENFPFCTIE  341
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN LT     AENFPFCTI+
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTID  58

Query  342  PNEARVNVPDERFEWLCQLYKPKSEVSAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVD  521
            PNE+RV VPDERF++LCQ +KP S++ AFL + DIAGLV+GAH GQGLGN+FLSHI A D
Sbjct  59   PNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACD  118

Query  522  GIFHVLRAFE  551
            GIFH+ RAFE
Sbjct  119  GIFHLTRAFE  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760