BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027I16

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     156   4e-41   Nicotiana tomentosiformis
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     147   5e-38   Populus euphratica
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     145   2e-37   Nelumbo nucifera [Indian lotus]
gb|EPS62329.1|  pectinesterase                                          144   9e-37   Genlisea aurea
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     144   1e-36   Populus euphratica
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     143   2e-36   Sesamum indicum [beniseed]
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     143   2e-36   Nelumbo nucifera [Indian lotus]
gb|EYU46746.1|  hypothetical protein MIMGU_mgv1a0044632mg               136   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     142   4e-36   Vitis vinifera
emb|CBI36883.3|  unnamed protein product                                142   4e-36   Vitis vinifera
emb|CDP15270.1|  unnamed protein product                                141   1e-35   Coffea canephora [robusta coffee]
emb|CDP15269.1|  unnamed protein product                                139   1e-35   Coffea canephora [robusta coffee]
gb|AHB84678.1|  pectin methylesterase                                   140   2e-35   Citrus reticulata [mandarin orange]
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     139   6e-35   Nicotiana sylvestris
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             138   1e-34   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            137   1e-34   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    137   2e-34   Citrus sinensis [apfelsine]
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     134   2e-33   Nicotiana tomentosiformis
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    134   2e-33   Glycine max [soybeans]
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               132   1e-32   Ricinus communis
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     132   1e-32   Nicotiana tomentosiformis
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             132   2e-32   Phaseolus vulgaris [French bean]
ref|XP_010321856.1|  PREDICTED: pectinesterase                          131   2e-32   Solanum lycopersicum
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             128   3e-31   Phaseolus vulgaris [French bean]
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     129   3e-31   Nicotiana sylvestris
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    127   7e-31   Gossypium arboreum [tree cotton]
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     126   2e-30   Nicotiana sylvestris
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             125   4e-30   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     125   5e-30   Prunus mume [ume]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    124   1e-29   Glycine max [soybeans]
gb|KJB41904.1|  hypothetical protein B456_007G127000                    123   2e-29   Gossypium raimondii
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     121   1e-28   Fragaria vesca subsp. vesca
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    119   6e-28   Cicer arietinum [garbanzo]
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     118   2e-27   Eucalyptus grandis [rose gum]
gb|KJB09419.1|  hypothetical protein B456_001G140500                    118   2e-27   Gossypium raimondii
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     114   3e-26   Solanum lycopersicum
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     114   5e-26   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    112   3e-25   Solanum tuberosum [potatoes]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 110   8e-25   Medicago truncatula
gb|EPS67066.1|  pectinesterase                                          110   3e-24   Genlisea aurea
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                   104   2e-23   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     102   8e-22   Tarenaya hassleriana [spider flower]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     102   1e-21   Phoenix dactylifera
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                 97.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49889.1|  hypothetical protein B456_008G143700                  96.3    1e-19   Gossypium raimondii
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                   95.9    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                   92.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACQ85264.1|  pectin methylesterase                                 92.0    4e-18   Musa acuminata AAA Group [Cavendish banana]
gb|AGG23325.1|  pectin methylesterase 1                               91.7    5e-18   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                   89.0    5e-17   Brachypodium distachyon [annual false brome]
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                   87.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE54425.1|  hypothetical protein OsJ_01485                        85.9    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40   85.1    7e-16   Glycine soja [wild soybean]
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716  86.3    7e-16   
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                   85.1    9e-16   Eucalyptus grandis [rose gum]
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830        84.3    2e-15   Sorghum bicolor [broomcorn]
gb|EEC70505.1|  hypothetical protein OsI_01594                        84.0    2e-15   Oryza sativa Indica Group [Indian rice]
tpg|DAA54386.1|  TPA: hypothetical protein ZEAMMB73_825660            80.9    6e-15   
ref|NP_001146685.1|  pectinesterase precursor                         81.3    2e-14   Zea mays [maize]
ref|XP_006355852.1|  PREDICTED: probable pectinesterase/pectinest...  78.6    2e-14   
ref|XP_010042403.1|  PREDICTED: probable pectinesterase/pectinest...  77.8    4e-14   Eucalyptus grandis [rose gum]
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                   80.5    4e-14   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                   79.7    4e-14   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40   77.4    3e-13   Glycine soja [wild soybean]
dbj|BAJ96804.1|  predicted protein                                    77.4    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABQ42392.1|  pectin methylesterase-like protein                    74.3    4e-12   Taiwania cryptomerioides
gb|KGN44975.1|  Pectinesterase                                        73.6    9e-12   Cucumis sativus [cucumbers]
gb|EMS68834.1|  Pectinesterase 1                                      71.6    3e-11   Triticum urartu
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...  71.2    4e-11   Cucumis sativus [cucumbers]
emb|CDX97564.1|  BnaA05g25150D                                        71.2    5e-11   
emb|CDX75765.1|  BnaC03g38480D                                        70.9    5e-11   
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...  70.9    5e-11   Brassica rapa
ref|XP_010489830.1|  PREDICTED: pectinesterase/pectinesterase inh...  68.2    5e-11   Camelina sativa [gold-of-pleasure]
gb|ACN40984.1|  unknown                                               70.9    6e-11   Picea sitchensis
ref|XP_007012502.1|  Pectin methylesterase 3                          70.5    9e-11   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...  70.1    1e-10   
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40   68.9    2e-10   Glycine soja [wild soybean]
gb|ABG46324.1|  putative pectin methylesterase                        68.9    2e-10   Picea abies
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...  69.3    2e-10   Camelina sativa [gold-of-pleasure]
gb|EMT05022.1|  Pectinesterase 3                                      68.9    2e-10   
emb|CDX98441.1|  BnaC05g39340D                                        69.3    2e-10   
emb|CDY60700.1|  BnaA01g37100D                                        68.6    3e-10   Brassica napus [oilseed rape]
gb|KDO53765.1|  hypothetical protein CISIN_1g018173mg                 67.8    3e-10   Citrus sinensis [apfelsine]
ref|XP_010273995.1|  PREDICTED: pectinesterase 1-like                 66.2    3e-10   
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...  68.6    4e-10   Brassica rapa
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                  68.2    5e-10   Arabis alpina [alpine rockcress]
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg           68.2    5e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...  67.8    5e-10   Camelina sativa [gold-of-pleasure]
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1            67.8    6e-10   Gossypium arboreum [tree cotton]
gb|KJB54564.1|  hypothetical protein B456_009G039100                  67.0    7e-10   Gossypium raimondii
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                   64.7    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                 67.4    8e-10   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...  67.4    8e-10   Citrus sinensis [apfelsine]
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...  67.4    8e-10   Citrus sinensis [apfelsine]
ref|NP_001275859.1|  pectinesterase 1 precursor                       67.4    8e-10   Citrus sinensis [apfelsine]
gb|KHG08631.1|  Pectinesterase 3                                      67.0    1e-09   Gossypium arboreum [tree cotton]
ref|XP_004298672.1|  PREDICTED: 21 kDa protein                        64.3    1e-09   Fragaria vesca subsp. vesca
gb|KJB54563.1|  hypothetical protein B456_009G039100                  67.0    1e-09   Gossypium raimondii
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1        64.3    1e-09   Camelina sativa [gold-of-pleasure]
emb|CDY67447.1|  BnaA03g57460D                                        64.3    1e-09   Brassica napus [oilseed rape]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg           66.6    1e-09   
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                   63.9    1e-09   Camelina sativa [gold-of-pleasure]
gb|ABZ89800.1|  pectin methylesterase-like protein                    66.6    1e-09   Taiwania cryptomerioides
gb|AFW03476.1|  pectin methylesterase 2                               66.6    1e-09   Gossypium barbadense [Egyptian cotton]
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                   66.6    1e-09   Eucalyptus grandis [rose gum]
gb|AFB77928.1|  pectin methylesterase                                 66.2    2e-09   Gossypium hirsutum [American cotton]
emb|CDY39109.1|  BnaA01g29470D                                        66.2    2e-09   Brassica napus [oilseed rape]
ref|NP_188048.1|  pectin methylesterase 3                             66.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33228.1|  BnaC01g37010D                                        65.9    2e-09   Brassica napus [oilseed rape]
ref|XP_002891774.1|  ATPME2                                           65.9    2e-09   Arabidopsis lyrata subsp. lyrata
gb|AFW03480.1|  pectin methylesterase 1                               65.9    3e-09   Gossypium hirsutum [American cotton]
gb|AER38243.1|  PME2                                                  65.5    3e-09   Gossypium barbadense [Egyptian cotton]
gb|AAC72288.1|  putative pectin methylesterase                        65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg           63.2    3e-09   Capsella rubella
gb|AFW03475.1|  pectin methylesterase 1                               65.5    4e-09   Gossypium barbadense [Egyptian cotton]
gb|KJB57093.1|  hypothetical protein B456_009G147900                  65.5    4e-09   Gossypium raimondii
gb|AFB77929.1|  pectin methylesterase                                 65.5    4e-09   Gossypium hirsutum [American cotton]
emb|CDY33229.1|  BnaC01g37020D                                        65.1    4e-09   Brassica napus [oilseed rape]
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                   65.1    4e-09   Vitis vinifera
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  62.4    5e-09   Arabidopsis lyrata subsp. lyrata
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                 62.4    6e-09   Citrus sinensis [apfelsine]
gb|AAC05147.1|  21 kD protein precursor                               62.0    7e-09   Pinus radiata
gb|KDP33985.1|  hypothetical protein JCGZ_07556                       63.9    9e-09   Jatropha curcas
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g           63.9    1e-08   Phaseolus vulgaris [French bean]
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...  63.9    1e-08   Nicotiana tomentosiformis
emb|CAB95025.1|  pectin methylesterase                                63.9    1e-08   Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...  63.9    1e-08   Nicotiana sylvestris
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                   61.2    1e-08   Citrus sinensis [apfelsine]
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...  63.5    1e-08   Brassica rapa
gb|AAC50023.1|  ATPME2 precursor                                      63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg           61.2    1e-08   Citrus clementina [clementine]
ref|NP_175786.1|  pectin methylesterase 2                             63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...  63.5    2e-08   Brassica rapa
gb|KJB19687.1|  hypothetical protein B456_003G114500                  61.2    2e-08   Gossypium raimondii
ref|XP_002324773.2|  hypothetical protein POPTR_0018s05360g           62.8    2e-08   
ref|XP_002885033.1|  ATPME3                                           63.2    2e-08   
gb|ABK24883.1|  unknown                                               62.8    2e-08   Picea sitchensis
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative             62.8    2e-08   Ricinus communis
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                   62.8    2e-08   Eucalyptus grandis [rose gum]
ref|XP_007038418.1|  DC1.2-like, putative                             60.5    2e-08   
ref|NP_001060620.1|  Os07g0675100                                     62.4    3e-08   
gb|EEC82670.1|  hypothetical protein OsI_27314                        62.4    3e-08   Oryza sativa Indica Group [Indian rice]
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                  60.1    3e-08   Arabis alpina [alpine rockcress]
emb|CBI27756.3|  unnamed protein product                              62.4    3e-08   Vitis vinifera
gb|KDP33984.1|  hypothetical protein JCGZ_07555                       62.4    3e-08   Jatropha curcas
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                   60.5    3e-08   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg           60.1    4e-08   Citrus clementina [clementine]
ref|XP_002277473.1|  PREDICTED: pectinesterase                        62.4    4e-08   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                   62.0    4e-08   Populus euphratica
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  59.7    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60276.1|  unknown                                               59.7    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                        59.7    4e-08   Brassica rapa
emb|CDY08206.1|  BnaA05g14130D                                        62.0    5e-08   Brassica napus [oilseed rape]
emb|CDY51798.1|  BnaC06g41940D                                        62.0    5e-08   Brassica napus [oilseed rape]
gb|KHN32444.1|  21 kDa protein                                        59.3    6e-08   Glycine soja [wild soybean]
ref|XP_004245727.1|  PREDICTED: 21 kDa protein-like                   59.3    6e-08   Solanum lycopersicum
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                   61.6    7e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002265171.1|  PREDICTED: pectinesterase                        61.2    7e-08   Vitis vinifera
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                   61.2    7e-08   Elaeis guineensis
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...  61.2    7e-08   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                   61.2    7e-08   Sesamum indicum [beniseed]
ref|NP_001274969.1|  pectin methyl esterase                           61.2    8e-08   Solanum tuberosum [potatoes]
gb|AAO85706.1|  pectin methyl-esterase                                60.8    9e-08   Nicotiana benthamiana
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                   60.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_003625921.1|  Pectinesterase/pectinesterase inhibitor          58.5    1e-07   Medicago truncatula
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                   59.3    1e-07   
emb|CDX87244.1|  BnaC09g05590D                                        58.5    1e-07   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320        60.5    1e-07   Amborella trichopoda
ref|XP_002322405.2|  ripening-related family protein                  58.5    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010420924.1|  PREDICTED: 21 kDa protein-like                   58.5    1e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...  60.5    1e-07   
emb|CDX86901.1|  BnaC03g51710D                                        58.5    1e-07   
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                   58.5    1e-07   Solanum tuberosum [potatoes]
gb|AFW03481.1|  pectin methylesterase 2                               60.5    1e-07   Gossypium hirsutum [American cotton]
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg           58.2    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                   60.5    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                 59.7    2e-07   
gb|KDP22409.1|  hypothetical protein JCGZ_26240                       58.2    2e-07   Jatropha curcas
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                  60.1    2e-07   Arabis alpina [alpine rockcress]
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                   57.8    2e-07   Cicer arietinum [garbanzo]
ref|XP_002304257.2|  pectinesterase family protein                    59.7    2e-07   Populus trichocarpa [western balsam poplar]
gb|ADE76337.1|  unknown                                               57.8    2e-07   Picea sitchensis
ref|NP_001265901.1|  pectinesterase 3-like                            59.7    3e-07   Cicer arietinum [garbanzo]
gb|AFI23411.1|  pectin methylesterase                                 59.3    3e-07   Coffea arabica [arabica coffee]
ref|XP_009335740.1|  PREDICTED: 21 kDa protein                        57.4    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009335681.1|  PREDICTED: 21 kDa protein-like                   57.4    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                   58.9    4e-07   Eucalyptus grandis [rose gum]
emb|CDY00279.1|  BnaA06g21800D                                        57.0    4e-07   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                        57.0    4e-07   Prunus mume [ume]
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                 58.9    5e-07   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                   58.5    5e-07   Cucumis melo [Oriental melon]
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                   58.5    5e-07   Prunus mume [ume]
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                 58.5    5e-07   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                   58.5    6e-07   Elaeis guineensis
gb|ACU13418.1|  unknown                                               56.6    6e-07   Glycine max [soybeans]
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative             58.5    7e-07   Ricinus communis
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                      58.5    7e-07   
ref|XP_002510935.1|  21 kDa protein precursor, putative               56.6    7e-07   Ricinus communis
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg           58.2    7e-07   Capsella rubella
ref|XP_008812393.1|  PREDICTED: pectinesterase-like                   58.2    7e-07   Phoenix dactylifera
gb|AFK47771.1|  unknown                                               56.2    8e-07   Lotus japonicus
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                   58.2    8e-07   Nicotiana tomentosiformis
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                   58.2    9e-07   
gb|AFK37116.1|  unknown                                               56.2    9e-07   Lotus japonicus
ref|XP_010273801.1|  PREDICTED: pectinesterase                        57.8    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                      57.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                   55.8    1e-06   Brassica rapa
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                   57.8    1e-06   
gb|KDP25618.1|  hypothetical protein JCGZ_20774                       55.8    1e-06   Jatropha curcas
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                 57.4    1e-06   
ref|XP_010932336.1|  PREDICTED: pectinesterase-like                   57.4    1e-06   Elaeis guineensis
ref|XP_006369078.1|  hypothetical protein POPTR_0001s162502g          57.0    1e-06   
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                        55.8    1e-06   Nicotiana sylvestris
ref|XP_010035021.1|  PREDICTED: 21 kDa protein-like                   55.5    2e-06   Eucalyptus grandis [rose gum]
ref|XP_003627459.1|  Pectinesterase                                   57.0    2e-06   
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2        55.1    2e-06   Populus euphratica
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                 57.0    2e-06   Setaria italica
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1        55.1    2e-06   Populus euphratica
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                   57.0    2e-06   Nicotiana sylvestris
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3            57.0    2e-06   Linum usitatissimum
gb|ABK22631.1|  unknown                                               55.1    2e-06   Picea sitchensis
ref|XP_003521571.1|  PREDICTED: 21 kDa protein-like                   55.1    2e-06   Glycine max [soybeans]
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg           56.6    2e-06   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                 56.6    2e-06   Cucumis sativus [cucumbers]
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                        55.1    3e-06   Vitis vinifera
gb|EYU25806.1|  hypothetical protein MIMGU_mgv1a003215mg              56.6    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_004240754.1|  PREDICTED: 21 kDa protein-like                   54.7    3e-06   Solanum lycopersicum
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...  56.6    3e-06   Malus domestica [apple tree]
ref|XP_010454384.1|  PREDICTED: 21 kDa protein-like                   54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                 56.2    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                   54.7    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                 56.2    3e-06   Camelina sativa [gold-of-pleasure]
gb|AJH66132.1|  pectin methylesterase                                 56.2    3e-06   Malus domestica [apple tree]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                   56.2    4e-06   
ref|XP_010493188.1|  PREDICTED: 21 kDa protein-like                   54.7    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                 55.8    4e-06   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...  55.8    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg           54.3    4e-06   Prunus persica
ref|XP_010096537.1|  Pectinesterase 3                                 55.5    4e-06   
ref|XP_008228105.1|  PREDICTED: pectinesterase                        55.8    5e-06   Prunus mume [ume]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg           55.8    5e-06   Prunus persica
gb|ACN40878.1|  unknown                                               55.8    5e-06   Picea sitchensis
gb|KJB70037.1|  hypothetical protein B456_011G055100                  55.5    6e-06   Gossypium raimondii
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                   55.5    6e-06   Populus euphratica
ref|XP_003627458.1|  Pectinesterase                                   55.5    7e-06   Medicago truncatula
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...  55.5    7e-06   Eucalyptus grandis [rose gum]
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                 55.1    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                   53.9    7e-06   Fragaria vesca subsp. vesca
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg           55.1    7e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009610995.1|  PREDICTED: 21 kDa protein                        53.9    8e-06   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g           55.1    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010091300.1|  21 kDa protein                                   53.5    8e-06   Morus notabilis
gb|ABK96280.1|  unknown                                               53.5    8e-06   Populus trichocarpa x Populus deltoides
ref|XP_010546336.1|  PREDICTED: 21 kDa protein-like                   53.9    8e-06   Tarenaya hassleriana [spider flower]
gb|ABK22757.1|  unknown                                               53.5    9e-06   Picea sitchensis
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...  55.1    9e-06   
gb|KGN44619.1|  hypothetical protein Csa_7G343850                     55.1    9e-06   Cucumis sativus [cucumbers]
gb|ACN40648.1|  unknown                                               53.5    9e-06   Picea sitchensis
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1        54.7    1e-05   Phoenix dactylifera
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                   54.7    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010259553.1|  PREDICTED: 21 kDa protein-like                   53.1    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008369014.1|  PREDICTED: 21 kDa protein                        53.1    1e-05   
ref|XP_004307823.1|  PREDICTED: 21 kDa protein-like                   53.1    1e-05   Fragaria vesca subsp. vesca
ref|XP_008355483.1|  PREDICTED: 21 kDa protein-like                   53.1    1e-05   
ref|XP_010550579.1|  PREDICTED: 21 kDa protein                        53.1    1e-05   Tarenaya hassleriana [spider flower]
gb|AFK35257.1|  unknown                                               53.1    1e-05   Medicago truncatula
ref|XP_010671450.1|  PREDICTED: probable pectinesterase/pectinest...  54.7    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010550514.1|  PREDICTED: probable pectinesterase/pectinest...  54.7    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...  54.3    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                   54.3    1e-05   Eucalyptus grandis [rose gum]
gb|AFK38286.1|  unknown                                               52.8    1e-05   Lotus japonicus
ref|XP_008235094.1|  PREDICTED: 21 kDa protein-like                   52.8    1e-05   Prunus mume [ume]
ref|XP_007131335.1|  hypothetical protein PHAVU_011G005200g           52.8    1e-05   Phaseolus vulgaris [French bean]
emb|CAC01624.1|  putative pectin methylesterase                       53.9    2e-05   Populus tremula x Populus tremuloides
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg              53.9    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                   52.4    2e-05   
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                   52.4    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg           52.4    3e-05   Prunus persica
ref|XP_009799203.1|  PREDICTED: pectinesterase 1-like                 53.5    3e-05   Nicotiana sylvestris
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...  53.5    3e-05   
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                53.5    3e-05   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                       53.5    3e-05   
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                   53.1    3e-05   
gb|AFQ23194.1|  pectin methylesterase                                 53.1    3e-05   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1        53.1    3e-05   
ref|XP_007210765.1|  hypothetical protein PRUPE_ppa020079mg           52.8    3e-05   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                53.1    3e-05   
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                   51.6    3e-05   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5       53.1    4e-05   
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg           53.1    4e-05   
ref|XP_011101127.1|  PREDICTED: 21 kDa protein-like                   52.0    4e-05   
gb|KEH29361.1|  plant invertase/pectin methylesterase inhibitor       51.6    4e-05   
ref|XP_008234384.1|  PREDICTED: 21 kDa protein                        52.0    4e-05   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...  53.1    4e-05   
ref|XP_002322406.1|  21K protein precursor                            51.6    4e-05   
ref|XP_002322403.1|  ripening-related family protein                  51.6    4e-05   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                   51.6    5e-05   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2        52.8    5e-05   
ref|XP_004298254.1|  PREDICTED: pectinesterase-like                   52.8    5e-05   
gb|EYU43527.1|  hypothetical protein MIMGU_mgv1a024700mg              51.2    5e-05   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                   52.4    5e-05   
ref|XP_011094019.1|  PREDICTED: pectinesterase-like                   52.4    6e-05   
gb|KJB25636.1|  hypothetical protein B456_004G201400                  51.2    6e-05   
ref|XP_002322404.2|  ripening-related family protein                  51.2    7e-05   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...  51.2    7e-05   
ref|XP_008387667.1|  PREDICTED: 21 kDa protein-like                   51.2    7e-05   
ref|XP_004495957.1|  PREDICTED: 21 kDa protein-like                   51.2    7e-05   
gb|AFK49039.1|  unknown                                               50.8    7e-05   
ref|XP_009796710.1|  PREDICTED: 21 kDa protein-like                   50.8    7e-05   
ref|NP_001236761.1|  uncharacterized protein LOC100305537 precursor   51.2    7e-05   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                   51.2    7e-05   
ref|XP_010100757.1|  putative pectinesterase/pectinesterase inhib...  52.0    8e-05   
ref|XP_006400644.1|  hypothetical protein EUTSA_v10014618mg           51.2    8e-05   
ref|XP_009603391.1|  PREDICTED: 21 kDa protein-like                   50.8    8e-05   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050        51.6    1e-04   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                   50.4    1e-04   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                   50.4    1e-04   
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...  51.6    1e-04   
ref|XP_004139621.1|  PREDICTED: pectinesterase/pectinesterase inh...  51.6    1e-04   
emb|CDX83075.1|  BnaA01g20750D                                        51.6    1e-04   
gb|KJB20850.1|  hypothetical protein B456_003G168700                  50.4    1e-04   
ref|XP_006444353.1|  hypothetical protein CICLE_v10022355mg           50.4    1e-04   
ref|XP_011010941.1|  PREDICTED: 21 kDa protein-like                   50.4    1e-04   
ref|XP_006421712.1|  hypothetical protein CICLE_v10007113mg           50.4    1e-04   
ref|XP_011076332.1|  PREDICTED: 21 kDa protein                        50.4    1e-04   
ref|XP_006490092.1|  PREDICTED: 21 kDa protein-like                   50.4    1e-04   
ref|XP_010519346.1|  PREDICTED: 21 kDa protein-like                   50.1    1e-04   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  51.6    1e-04   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                   50.1    1e-04   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...  51.2    1e-04   
gb|KDO65436.1|  hypothetical protein CISIN_1g028434mg                 50.4    1e-04   
gb|KDP33962.1|  hypothetical protein JCGZ_07533                       50.1    1e-04   
ref|XP_009594970.1|  PREDICTED: 21 kDa protein-like                   50.1    2e-04   
ref|XP_006421708.1|  hypothetical protein CICLE_v10007178mg           50.1    2e-04   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                   50.1    2e-04   
gb|KDP25617.1|  hypothetical protein JCGZ_20773                       50.1    2e-04   
ref|XP_002872846.1|  predicted protein                                50.8    2e-04   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...  50.8    2e-04   
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780        50.8    2e-04   
ref|XP_007038423.1|  Plant invertase/pectin methylesterase inhibi...  50.1    2e-04   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250        50.8    2e-04   
gb|EYU24974.1|  hypothetical protein MIMGU_mgv1a014119mg              49.7    2e-04   
ref|XP_009370482.1|  PREDICTED: 21 kDa protein-like                   49.7    2e-04   
ref|XP_007163112.1|  hypothetical protein PHAVU_001G207300g           49.7    2e-04   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg              50.8    2e-04   
ref|XP_009779202.1|  PREDICTED: 21 kDa protein-like                   49.7    3e-04   
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                   50.4    3e-04   
ref|XP_002263991.1|  PREDICTED: 21 kDa protein                        49.3    3e-04   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                   50.4    3e-04   
ref|XP_011076330.1|  PREDICTED: 21 kDa protein-like                   49.3    3e-04   
ref|XP_009401795.1|  PREDICTED: 21 kDa protein-like                   49.7    3e-04   
emb|CAN70288.1|  hypothetical protein VITISV_015784                   49.3    3e-04   
ref|XP_003635233.1|  PREDICTED: 21 kDa protein-like                   49.3    3e-04   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                   50.4    3e-04   
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g           50.4    3e-04   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...  50.1    3e-04   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...  50.1    4e-04   
emb|CDP05319.1|  unnamed protein product                              49.3    4e-04   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative             50.1    4e-04   
gb|ABK21023.1|  unknown                                               49.3    4e-04   
ref|XP_006288672.1|  hypothetical protein CARUB_v10001980mg           49.3    4e-04   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...  50.1    4e-04   
ref|XP_009618650.1|  PREDICTED: 21 kDa protein-like                   48.9    4e-04   
emb|CBI24572.3|  unnamed protein product                              48.9    4e-04   
ref|XP_006421709.1|  hypothetical protein CICLE_v10005888mg           48.9    4e-04   
ref|XP_007039937.1|  Plant invertase/pectin methylesterase inhibi...  48.9    4e-04   
ref|NP_197574.1|  plant invertase/pectin methylesterase inhibitor...  48.9    5e-04   
ref|XP_007039938.1|  Plant invertase/pectin methylesterase inhibi...  48.9    5e-04   
ref|XP_011033536.1|  PREDICTED: 21 kDa protein                        48.5    6e-04   
ref|XP_011029962.1|  PREDICTED: 21 kDa protein-like                   48.5    6e-04   
ref|XP_004170129.1|  PREDICTED: pectinesterase 3-like                 49.3    6e-04   
ref|XP_004139620.1|  PREDICTED: pectinesterase 3-like                 49.3    6e-04   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                   49.3    6e-04   
ref|XP_006490091.1|  PREDICTED: 21 kDa protein-like                   48.5    6e-04   
ref|XP_004148136.1|  PREDICTED: 21 kDa protein-like                   48.1    7e-04   
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg           49.3    7e-04   
emb|CDY69946.1|  BnaUnng03540D                                        48.9    7e-04   
gb|KFK34211.1|  hypothetical protein AALP_AA5G115200                  49.3    7e-04   
ref|XP_004243686.1|  PREDICTED: 21 kDa protein                        48.1    7e-04   
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...  49.3    7e-04   
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                   49.3    7e-04   
ref|XP_006826916.1|  hypothetical protein AMTR_s00010p00166600        48.1    7e-04   
gb|KJB19691.1|  hypothetical protein B456_003G114800                  48.1    8e-04   
emb|CDY11064.1|  BnaA03g47230D                                        48.5    8e-04   
emb|CBA10126.1|  PME inhibitor                                        48.1    8e-04   
ref|XP_002874013.1|  hypothetical protein ARALYDRAFT_488983           48.1    8e-04   
gb|KDP22406.1|  hypothetical protein JCGZ_26237                       48.1    0.001   
gb|KFK42156.1|  hypothetical protein AALP_AA2G218600                  48.1    0.001   
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                   48.9    0.001   
ref|XP_008439100.1|  PREDICTED: 21 kDa protein-like                   47.8    0.001   



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M+N++ K +L  TI   +A++LL F  + S       +  SSS+      +  +IH  K 
Sbjct  1    MYNIRHKPSLILTILASTALILLTFFVLLS-------NPKSSSSRAAEKTMTPHIHVHKN  53

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV + V EV+ASA NCS +R
Sbjct  54   IQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLR  111

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            R +P+L P+EKRAL DC+EL  ET  ELR  LSDL+   S+SKHY D+QT  SAAMT
Sbjct  112  RHVPKLEPIEKRALQDCVELLGETIAELRTALSDLSPKKSASKHYNDIQTLLSAAMT  168



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLPEFISATLNKTMDEVRASSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DLQT  S 
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSG  159

Query  559  AMT  567
            AMT
Sbjct  160  AMT  162



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            LQ+AH+ ACEGTLYPELCVSTL++  PD  +KTI ++I++TVN TV EV+ SA+NC+ IR
Sbjct  71   LQIAHS-ACEGTLYPELCVSTLSS-FPDLTSKTISQMISSTVNYTVKEVEISASNCTDIR  128

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            + L    PLE+RALDDCLELF ET  EL+  LSDL+  +S SKHY DLQT  SAAMT
Sbjct  129  KNLKAQDPLEQRALDDCLELFDETISELQTALSDLSPKSSPSKHYNDLQTLLSAAMT  185



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  + +QVA + AC+GTLYP+LCVST++  LP+ R KT+PEIIAAT+NVT+ EV+ +++
Sbjct  34   IHAYEHVQVAES-ACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASS  92

Query  379  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  555
            NCS +RRKL  +L PLE RAL+DCLELFS T  +L K+ SDL  +++  K+Y DL+T  S
Sbjct  93   NCSSLRRKLNKKLEPLELRALEDCLELFSYTASDLSKIFSDLKASSAQEKYYDDLRTLLS  152

Query  556  AAMT  567
            AAMT
Sbjct  153  AAMT  156



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H  K +Q+AH+ AC+GTLYPELCVSTL + L D  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LSDLASKSLPEFISATLNKTMDEVRASSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DLQT  S 
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSG  159

Query  559  AMT  567
            AMT
Sbjct  160  AMT  162



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  + +Q+A +  CEGTLYP+LCVST+A A P+ R KT+PEII+ T+NVT+ EV+ASA+
Sbjct  41   IHVYRHVQIAKS-TCEGTLYPDLCVSTVA-AFPELRRKTLPEIISGTINVTMKEVRASAS  98

Query  379  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  555
            NCS +RRKL  +L PL+ +ALDDCLELFS+T  EL+++L++L+   S  K+Y DLQT  S
Sbjct  99   NCSSLRRKLMKKLAPLDLQALDDCLELFSDTVGELKRILAELSAGNSPEKYYDDLQTLLS  158

Query  556  AAMT  567
             AMT
Sbjct  159  GAMT  162



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H  K LQ+AH+ ACEGTLYPELCVST+++  PD  +KTIP+II+ATV  TV+EV+ SA+
Sbjct  44   LHLHKHLQIAHS-ACEGTLYPELCVSTVSS-FPDLASKTIPDIISATVQHTVNEVRTSAS  101

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+G R K   L PL++ ALDDCLEL  ET  EL+  LSDL+   S S+HY DL T  SA
Sbjct  102  NCTGJRMKRRTLDPLQQMALDDCLELLDETVAELKSALSDLSPKNSPSRHYNDLGTLLSA  161

Query  559  AMT  567
            AMT
Sbjct  162  AMT  164



>gb|EYU46746.1| hypothetical protein MIMGU_mgv1a0044632mg, partial [Erythranthe 
guttata]
Length=201

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H  K  QV     C+GTLYP LCVST+A A P+ R KT+PEIIA T+NVT+ EV+ SA 
Sbjct  42   LHVYKHAQVIAESTCDGTLYPGLCVSTVA-AFPELRQKTLPEIIAGTINVTMKEVRDSAT  100

Query  379  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  555
            NCSG+RRKL  +L P +  ALDDCLELF++T  EL+K LSDL++ +   K+Y DLQT  S
Sbjct  101  NCSGLRRKLLKKLDPRDLIALDDCLELFADTVAELKKTLSDLSSGSPPEKYYDDLQTLLS  160

Query  556  AAMT  567
             AMT
Sbjct  161  GAMT  164



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 106/159 (67%), Gaps = 3/159 (2%)
 Frame = +1

Query  91   AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  270
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  8    AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  65

Query  271  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  450
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  66   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  124

Query  451  ELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            EL   T  +L+  +SDL+   S +KHY DLQT  S ++T
Sbjct  125  ELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSIT  163



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 106/159 (67%), Gaps = 3/159 (2%)
 Frame = +1

Query  91   AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  270
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  18   AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  75

Query  271  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  450
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  76   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  134

Query  451  ELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            EL   T  +L+  +SDL+   S +KHY DLQT  S ++T
Sbjct  135  ELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSIT  173



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  61   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  118

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DLQT FSA
Sbjct  119  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTFAQLKAAISDLSSNKSALQHYMDLQTLFSA  178

Query  559  AMT  567
            AMT
Sbjct  179  AMT  181



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  69   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  126

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DLQT FSA
Sbjct  127  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTVAQLKAAISDLSSNKSALQHYMDLQTLFSA  186

Query  559  AMT  567
            AMT
Sbjct  187  AMT  189



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 107/161 (66%), Gaps = 12/161 (7%)
 Frame = +1

Query  88   SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  264
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  265  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  444
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  445  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            CLELF +T  EL+  L+DL+   S SKHY DLQT FS AMT
Sbjct  131  CLELFHDTIVELKSALNDLSPKKSPSKHYHDLQTLFSGAMT  171



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  K +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV V V EV+ SA 
Sbjct  47   IHVHKNIQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKVAVGEVRDSAH  104

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NCS +RR +P+L P+EKRAL DC+EL  ET  ELR  L+DL+   S+SKHY D+QT  SA
Sbjct  105  NCSDLRRNVPKLEPIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHYNDIQTLLSA  164

Query  559  AMT  567
            AMT
Sbjct  165  AMT  167



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++ E I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLQEFISATLNKTMDEVRASSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            +C+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +S+LA    +SKHY DLQT  S 
Sbjct  101  DCNAIRNKM-KLGPLEKVALKDCIELFDDTIAELKSAISNLALRKPTSKHYHDLQTLLSG  159

Query  559  AMT  567
            AMT
Sbjct  160  AMT  162



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = +1

Query  88   SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  264
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  1    SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  50

Query  265  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  444
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  51   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  109

Query  445  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            CLELF +T  EL+  L+DL+     SKHY DLQT FS AMT
Sbjct  110  CLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMT  150



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = +1

Query  88   SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  264
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  265  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  444
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  445  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            CLELF +T  EL+  L+DL+     SKHY DLQT FS AMT
Sbjct  131  CLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMT  171



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 111/181 (61%), Gaps = 32/181 (18%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M+N ++K +L  T+S   AI+LL F S                       L +++  Q +
Sbjct  1    MYNQRRKPSLLLTLS---AIILLIFFS-----------------------LPISLQTQNI  34

Query  217  -LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  393
             L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN TVDEVKAS  NC+ I
Sbjct  35   QLEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNTTVDEVKASTENCTNI  92

Query  394  RRKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDLQTFFSAAM  564
              K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DLQT  SAAM
Sbjct  93   LHKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAM  152

Query  565  T  567
            T
Sbjct  153  T  153



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 100/156 (64%), Gaps = 8/156 (5%)
 Frame = +1

Query  100  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  279
            LL FL  T F    T   I+ +  P    L+   H QK +QV     C+GTLYP+LCVST
Sbjct  16   LLLFLGTTHF----TNTPITITRAPDQKHLH---HFQKHIQVVAKSTCQGTLYPDLCVST  68

Query  280  LATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELF  459
            LAT  PD   K++P++I++ VN T+ EV++S+ NCSG+++ L  L PL++RALDDCL+LF
Sbjct  69   LAT-FPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLF  127

Query  460  SETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
             +T  EL+  + DL+ +   SK + DLQT  S AMT
Sbjct  128  EDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMT  163



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +1

Query  196  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  375
            ++H QK  Q+AH+ ACEGTLYPELCVSTL++ LPD   +++ ++I++T++ T+ EV+ S 
Sbjct  39   HLHIQKHNQIAHS-ACEGTLYPELCVSTLSS-LPDLTYRSLQQLISSTISRTMYEVRVSY  96

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  555
            +NCSGI+ KL +L  +E+ AL+DCLELF+ET DEL   +SDL +  S S+H+ DLQT  S
Sbjct  97   SNCSGIKNKLRKLNKIERVALNDCLELFTETMDELNVAISDLTSRKSVSQHHHDLQTLLS  156

Query  556  AAMT  567
             AMT
Sbjct  157  GAMT  160



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 11/177 (6%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M+NL++K +L  T+   SAIV L F         FT      S+  T L    +IH  K 
Sbjct  1    MYNLRRKTSLLLTLFALSAIVSLTF---------FTLSNNPKSSSKTVLTTTPHIHVHKN  51

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +Q+AH+  C+ T YP+LCVSTL+  +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  52   IQIAHSH-CQDTRYPKLCVSTLSL-IPDLAQKSISQIISSTINVTVAEVKASARNCTDIR  109

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
              LP+L P EKRAL+DC++L   T  ELR  LSDL      S++Y DLQT  SAAMT
Sbjct  110  EDLPQLEPYEKRALEDCVQLLDNTIIELRTTLSDLNPKKPPSQNYNDLQTLLSAAMT  166



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 99/160 (62%), Gaps = 15/160 (9%)
 Frame = +1

Query  88   SAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPEL  267
            SA+ +L   SVT F+      G + S    HL             VA++  CEGTLYP+L
Sbjct  60   SAVHVLLLFSVTQFS---ITAGATRSLQQNHLHF----------HVANS-TCEGTLYPDL  105

Query  268  CVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDC  447
            CVSTL T+ PD  +KT+PE+I + VN T+ EV  S++NCS +R+KLP L  LEKRALDDC
Sbjct  106  CVSTL-TSFPDLTSKTVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLEKRALDDC  164

Query  448  LELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            L LF ET +EL+  + DL+ +   SK Y D QTF S AMT
Sbjct  165  LNLFDETVEELKTTVKDLSQSTIGSKRYHDSQTFLSGAMT  204



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 93/127 (73%), Gaps = 6/127 (5%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            IH  K +Q+A++  C+ TLYP+LC+STL+  +P+   K+IPEII++ VNVT++EVK+SA 
Sbjct  37   IHVHKNIQIANSH-CQDTLYPKLCISTLSL-IPNLHKKSIPEIISSNVNVTMNEVKSSAE  94

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS---KHYVDLQT  546
            NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L+DL+T  SS+   KHY DLQT
Sbjct  95   NCSNILHHMSKLDPIEKRALDDCIELLGDTTIDELQTTLNDLSTKNSSNSPLKHYNDLQT  154

Query  547  FFSAAMT  567
              S AMT
Sbjct  155  LLSGAMT  161



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +1

Query  196  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  375
            ++H  K +QVA +  C+GTLYP+LCVSTLAT  PD  +K++P++I++ VN T+ EVK+S 
Sbjct  34   HLHFHKHMQVAQS-TCQGTLYPDLCVSTLAT-FPDLTSKSVPQVISSVVNHTMYEVKSSF  91

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  555
             NCS +++K+  L PL++RALDDCL+LF +T  EL+  + DL+ ++  SK + DLQT  S
Sbjct  92   YNCSSLKKKIRNLNPLDQRALDDCLKLFQDTNLELKTTIDDLSKSSIGSKRHHDLQTLLS  151

Query  556  AAMT  567
             AMT
Sbjct  152  GAMT  155



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 12/177 (7%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M+NL++K  L  T+   SAIV + F  +++     +K   +  T P       +IH  K 
Sbjct  1    MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSK---TVQTTP-------HIHVHKN  50

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +Q+AH+  C+ T YP+LCVSTL+  +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  51   IQIAHSH-CQDTRYPKLCVSTLSL-IPDLAQKSISQIISSTINVTVAEVKASAKNCTEIR  108

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
              LPRL P EKRAL+DC++L   T  EL+  LSDL    S S++Y DLQT  SAAMT
Sbjct  109  EDLPRLEPYEKRALEDCVQLLDNTIIELKTTLSDLHPKKSPSQNYNDLQTLLSAAMT  165



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H    LQ+AH+ ACEGTLYP+LCVST+ + LPD  +KT+PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEGTLYPDLCVSTI-SVLPDLASKTLPELIQATLNQTMYEVRLSSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDLQTFFS  555
            NC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DLQTF S
Sbjct  101  NCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLS  160

Query  556  AAMT  567
            AAMT
Sbjct  161  AAMT  164



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN T+DEVK S  NC+ I 
Sbjct  36   LEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNATIDEVKGSTENCTKIL  93

Query  397  RKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMT  567
             K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DLQT  SAAMT
Sbjct  94   HKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMT  153



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 16/180 (9%)
 Frame = +1

Query  31   TRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQ  210
            T M+NL+++  L  ++   SA++L+   S T   +       S+S  P         H  
Sbjct  11   TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRN-------SNSITP-------KTHVH  56

Query  211  KLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  390
              +Q+A   AC+ TLY +LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+G
Sbjct  57   NRIQLAAHSACQDTLYKDLCVSTLST-FPDLSTKSVPQIISYTVSHTVSEVQASSSNCTG  115

Query  391  I-RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            I +++  +L  L++ ALDDCLELF +T  EL+ V+SDL+    SS  Y DL+T  S AMT
Sbjct  116  IIKKQFKKLDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAMT  175



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 113/179 (63%), Gaps = 18/179 (10%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSF-NSLFTKDGISSSTGPTHLDLNLNIHRQK  213
            M+NL+++  L  ++   SA++L+   S T F NS       +S+T  TH      +H + 
Sbjct  1    MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRNS-------NSNTPKTH------VHNR-  46

Query  214  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  393
             +Q+A   AC+ TLY  LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+GI
Sbjct  47   -IQLAAHSACQDTLYKLLCVSTLST-FPDLTTKSVPQIISYTVSHTVSEVQASSSNCTGI  104

Query  394  -RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
             +++  +L  L++ ALDDCLELF +T  EL  V+SDL+    SS  Y DL+T  S AMT
Sbjct  105  IKKQFKKLDALQQIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMT  163



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 7/136 (5%)
 Frame = +1

Query  175  THLDLNLNIHRQKL-----LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  339
            TH  +  N  R         QVA++  CEGTLY +LCVSTLA+  PD  +KT+P++I + 
Sbjct  83   THFSITANATRTPQENSLHFQVANS-TCEGTLYSDLCVSTLAS-FPDLTSKTLPQMIRSV  140

Query  340  VNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS  519
            VN T+ EV  SA+NCSG+RR LP+L  LE+RALDDCL LF +T  EL   ++DL+ +   
Sbjct  141  VNHTIYEVTLSASNCSGLRRNLPKLDKLEQRALDDCLNLFDDTVSELETTIADLSQSTIG  200

Query  520  SKHYVDLQTFFSAAMT  567
             K Y D QT  S AMT
Sbjct  201  PKRYHDAQTLLSGAMT  216



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H    LQ+AH+ ACE TLYP+LCVST+ + LPD  +K++PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEATLYPDLCVSTI-SVLPDLASKSLPELIQATLNQTMYEVRLSSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDLQTFFS  555
            NC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DLQTF S
Sbjct  101  NCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLS  160

Query  556  AAMT  567
            AAMT
Sbjct  161  AAMT  164



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 118/180 (66%), Gaps = 15/180 (8%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPT-HLDLNLNIHRQK  213
            M++L+++  L  ++   SA +L+ F S+  F         ++S  PT    +++  H Q 
Sbjct  1    MYSLRRRTKLLLSLLPTSAFILIIFFSLNHF---------TNSPKPTKEFTIHVEKHNQ-  50

Query  214  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  393
            L QVAH+  C+ TLY +LCVSTL T+ P+  +KT+P+II++TVN T+ EV AS +NC+GI
Sbjct  51   LNQVAHS-TCQNTLYKDLCVSTL-TSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGI  108

Query  394  RR-KLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDLQTFFSAAMT  567
            ++    +L  ++++ALDDCLELF +T  +L+  +S+L++  S ++KHY  L+T  SAAMT
Sbjct  109  KKHNKNKLAAVQQQALDDCLELFDDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMT  168



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            LQVAH+  C+GTLYP LCVSTL+T   D  +K++P+II +T+N T++EVK+S+ NC+ ++
Sbjct  38   LQVAHS-TCQGTLYPNLCVSTLST-FQDLASKSVPQIICSTLNSTINEVKSSSFNCTRLK  95

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            ++ P L P ++RALDDCL LF  T +EL+  ++DL+ T  +SK Y + QT  S AMT
Sbjct  96   KR-PSLHPYDQRALDDCLNLFDNTIEELKSTINDLSQTKITSKPYHNCQTLLSGAMT  151



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
             H ++ LQVAH+  C+GTLYP+LCVSTLA+  PD  +K++PEII++TVN+T  + +++++
Sbjct  34   FHTRRHLQVAHS-TCQGTLYPDLCVSTLAS-FPDLASKSVPEIISSTVNLTSAQARSASS  91

Query  379  NCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATT---ASSSKHYVDLQT  546
            +CS + R+L  +LGPLE+RALDDCLEL + T DE  K +SDL++     + + H+ DLQT
Sbjct  92   SCSALERRLAAKLGPLERRALDDCLELLARTVDEFGKAISDLSSANGPTAPAAHFHDLQT  151

Query  547  FFSAAMT  567
              S AMT
Sbjct  152  LLSGAMT  158



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
             H    LQ A + AC+GTLYPELCVST+ + LPD  +K++PE+I+AT+N T+ EV+ S+A
Sbjct  43   FHVHNHLQRA-SSACDGTLYPELCVSTI-SVLPDLASKSLPELISATLNQTMHEVRLSSA  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS-SKHYVDLQTFFS  555
            N + I +KL     LE+ A++DCLELF  T  EL+ V S L    SS S++Y DLQTF S
Sbjct  101  NITNIEKKLKSYNTLEEAAINDCLELFDNTMAELKVVRSGLGPKGSSVSENYHDLQTFLS  160

Query  556  AAMT  567
            AAMT
Sbjct  161  AAMT  164



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 106/177 (60%), Gaps = 18/177 (10%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M++L+ K  L  ++     IV L F +  S NS                   ++IH  K 
Sbjct  1    MYSLQWKTPLLLSLLAIFIIVSLTFFTSLSKNS----------------SEIVHIHVHKN  44

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +Q+AH+  CE  LY +LCVSTLA+ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLAS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
              LP+L P EKRAL+DC++L  +T  EL+  L  L    S S++Y DLQT  SAAMT
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDDTIIELKSSLVALHPNRSLSQNYNDLQTLLSAAMT  159



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   114 bits (285),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 74/180 (41%), Positives = 109/180 (61%), Gaps = 15/180 (8%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK-  213
            M+NL++   L  T+   S + L    S   F +       S+S  P    ++   H QK 
Sbjct  1    MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKN-------SNSKSPK---IHFQNHIQKQ  50

Query  214  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  393
            +L+ AH  AC+ TLY  LC+STLAT  P+  +KT+P+II++TV+ TV EVKAS++NC+ I
Sbjct  51   VLETAHW-ACQDTLYKSLCLSTLAT-FPNLASKTLPQIISSTVSHTVLEVKASSSNCTSI  108

Query  394  RRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDLQTFFSAAMT  567
            +++   +L  L++ ALDDCLEL   T DEL+  +SDL+   + +S  Y DL+   SAAMT
Sbjct  109  KKQFSKKLSSLQQWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMT  168



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = +1

Query  37   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  216
            M+NLK K  L  ++   SAIV L F +  S NS  T                ++IH  K 
Sbjct  1    MYNLKWKTPLLLSLLAISAIVCLTFFTSLSKNSSET----------------VHIHVHKN  44

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +Q+AH+  CE  LY +LCVSTL++ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLSS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  397  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
              LP+L P EKRAL+DC++L   T  +L+  L  L+   S S++Y DLQT  SAAMT
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDNTIIDLKSSLLALSPNRSLSQNYNDLQTLLSAAMT  159



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 9/122 (7%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            +QVA + ACEGTLY +LCVSTL+T LPD  +KT+P+II + +N T+ EVK S++NC+G+R
Sbjct  42   IQVAQS-ACEGTLYQDLCVSTLST-LPDLTSKTVPQIICSVLNNTIKEVKQSSSNCTGLR  99

Query  397  -RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA----TTASSSKHYVDLQTFFSAA  561
             R       L++RAL+DC+ LF  T DEL+  +SDL+    T ASSSK   D QT  S A
Sbjct  100  IRGRSAQSILDQRALEDCVNLFDTTIDELKTTISDLSQTQTTVASSSKR--DCQTLLSGA  157

Query  562  MT  567
            MT
Sbjct  158  MT  159



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC+G LY +LCVST+ T L  RR  T+PE+IAATV+V + EV ++++N   +RRKL +  
Sbjct  451  ACDGALYDDLCVSTVVTKL--RRNTTLPEMIAATVDVAMAEVMSASSNFRNLRRKLKKAE  508

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
             L+ RALDDCLEL S T +EL +VL      AS  KHY DL+T  S +MT
Sbjct  509  LLDVRALDDCLELLSSTAEELSEVLEMTTAPASPVKHYDDLKTLLSGSMT  558



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 3/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H    LQ A    C+GTLYP+LCVSTLA  +P+  +K++P++IAA VN T ++V+ SA+
Sbjct  41   LHVHSHLQAA-ARHCDGTLYPDLCVSTLAD-IPNLTSKSLPDVIAAVVNRTANDVRFSAS  98

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NCS   R+   +   ++ AL+DCLEL  +T D+LR   +DL T  ++S H  D+QT  SA
Sbjct  99   NCSSYLRRRGYMDSRQRLALNDCLELLDQTLDDLRTAAADL-TCGNASVHVSDIQTVLSA  157

Query  559  AMT  567
            AMT
Sbjct  158  AMT  160



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRL  414
            ACE T + +LC S L++ LP   + ++PE+IAATVN T+ EV  S++NCSG++R+L P L
Sbjct  50   ACERTRFKDLCFSPLSS-LPPGNSSSVPELIAATVNETISEVMISSSNCSGLQRRLGPDL  108

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
             P + RAL+DCLEL  +T  +L   L+DL  + S+++ + DLQT  SAAMT
Sbjct  109  SPRDSRALEDCLELLGDTAGDLDDALADLH-SPSAAREFYDLQTLLSAAMT  158



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 3/123 (2%)
 Frame = +1

Query  199  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
            +H +  LQVA +  C+GTLYP+LCVSTLA  +P+  +K +P++IAA VN T   V++SA+
Sbjct  43   LHIRSDLQVA-SRHCDGTLYPDLCVSTLAD-IPNLSSKPLPDVIAAVVNRTAAAVRSSAS  100

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  558
            NC+    +   +   ++ AL+DCLEL  +T D+LR  ++DLA   +SS H  DLQT  SA
Sbjct  101  NCTSYLHRRGHMDFRQRLALNDCLELLDQTLDDLRTAIADLA-GCNSSAHVSDLQTVLSA  159

Query  559  AMT  567
            A+T
Sbjct  160  AIT  162



>ref|XP_009401623.1| PREDICTED: pectinesterase 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  160  SSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  339
            S+  P      L +H       A  + C+GT+YPELCVSTL +  PD  +K++P +I AT
Sbjct  31   SAPKPVAYHHKLRVHSHLHAAAAAVDHCDGTIYPELCVSTL-SVFPDLHSKSLPAVICAT  89

Query  340  VNVTVDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS  516
            +N T   V+ SA NC+  + R+   L   ++ A+ DCL+LFS+T DELR   + L  T+ 
Sbjct  90   INATEAAVRGSAKNCTDYLNRRGYNLDGRQRLAIGDCLDLFSQTLDELRAASAGL--TSG  147

Query  517  SSKHYVDLQTFFSAAMT  567
            +S H  D+QT  SAA+T
Sbjct  148  ASAHVDDVQTVLSAAIT  164



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAA  336
            S  T  TH     + H    LQ+A+T ACEGTLYP+LCV+T++  L +  ++++P++I+A
Sbjct  31   SPETSETH-----HFHVNNNLQIAYT-ACEGTLYPDLCVATVSI-LQNLASRSLPDLISA  83

Query  337  TVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT-A  513
             +  T+DEV+ S ANC+ I + L     LE  A++DC+ELF+ T  ELR  L++L     
Sbjct  84   ILIQTMDEVRLSCANCTEIEKGLKSNTTLEWAAINDCIELFNHTLAELRVALAELKPKRV  143

Query  514  SSSKHYVDLQTFFSAAMT  567
              S++Y  ++TF SAAMT
Sbjct  144  RLSRNYHKIKTFLSAAMT  161



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  193  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  372
            L++H  +L   A  + C+GTLYP+LCVSTL+T +PD  AK++PE+I A+VN T   V+ +
Sbjct  47   LHVH-SRLQATAAADHCDGTLYPDLCVSTLST-IPDLHAKSLPEVICASVNTTAAAVRNA  104

Query  373  AANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFF  552
            A NC+    +   L P ++ A+ DCL+LFS+T DEL    +  A  A  + H  D+QT  
Sbjct  105  AKNCTNFLHRRGYLDPRQRLAVTDCLDLFSQTLDELGAASA--ALAADPAAHVDDVQTVL  162

Query  553  SAAMT  567
            SAA+T
Sbjct  163  SAAIT  167



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +1

Query  172  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  351
            P H  L+++ H Q       T+ C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TDHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  352  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  528
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EAAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153

Query  529  YVDLQTFFSAAMT  567
               +QT  SAA+T
Sbjct  154  VDHVQTLLSAAIT  166



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 9/133 (7%)
 Frame = +1

Query  172  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  351
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  41   PYHHRLHVHSHLQDA-----TGHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  94

Query  352  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  528
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  95   EGAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  152

Query  529  YVDLQTFFSAAMT  567
               +QT  SAA+T
Sbjct  153  VDHVQTLLSAAIT  165



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 9/133 (7%)
 Frame = +1

Query  172  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  351
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TXHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  352  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  528
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EXAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153

Query  529  YVDLQTFFSAAMT  567
               +QT  SAA+T
Sbjct  154  VDHVQTLLSAAIT  166



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 1/109 (1%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            CEGTLYPELC+STLAT +PD   K +P++I ATVN T  EV   A+NCS   ++   L P
Sbjct  43   CEGTLYPELCLSTLAT-VPDLHKKPLPDVICATVNRTEVEVADMASNCSSFLQQGKSLPP  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
             ++ A+ DC+EL   T DEL+   SDL   ++ +     + T  S A+T
Sbjct  102  RDRVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAIT  150



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +1

Query  193  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  372
            +++H Q  LQ+A +  C+GTLY +LC+STL+  +P    K++ EI+   ++VT  EV+AS
Sbjct  38   IHLHVQNHLQLAQSH-CDGTLYTDLCISTLSN-IPHLHKKSLTEILRYVISVTEAEVRAS  95

Query  373  AANCSGI----RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  540
            A N SG+    R  L RL   +  A+ DCLEL ++T DEL  VL ++      S +  ++
Sbjct  96   ATNISGLESVNRHTLSRL---QHFAVRDCLELLADTTDELDTVLDEMTGQCGPSNNVSNI  152

Query  541  QTFFSAAMT  567
            +T+ SAAMT
Sbjct  153  RTYLSAAMT  161



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLPRLG  417
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTA  513
            P ++ A+ DC+EL   T DEL+   SDL + A
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPA  137



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +1

Query  325  IIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA  504
            +I + VN T+ EV  SA+NCSG+RR LP L  LE+RALDDCL LF +T  EL   ++DL+
Sbjct  1    MIRSVVNHTIYEVTLSASNCSGLRRNLPELDKLEQRALDDCLNLFDDTVSELETTIADLS  60

Query  505  TTASSSKHYVDLQTFFSAAMT  567
             +    K Y D QT  S AMT
Sbjct  61   QSTIGPKRYHDAQTLLSGAMT  81



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = +1

Query  196   NIHRQKLLQVAHTEAC-----EGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDE  360
             N H+ +     HT+ C      GT Y +LCVSTLA+        + PEII+A ++ +  E
Sbjct  1169  NYHKDQYSHTRHTQPCPLPRCRGTPYSDLCVSTLAS-FTGLATMSFPEIISAMLHQSASE  1227

Query  361   VKASAANCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  537
             V+A++ +C+ ++   P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY D
Sbjct  1228  VRAASTHCTVMKNHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYD  1287

Query  538   LQTFFSAAMT  567
             LQ+  S  MT
Sbjct  1288  LQSLLSGVMT  1297



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 74/118 (63%), Gaps = 3/118 (3%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            LQV H+  C GT Y +LCVSTLA+      + + PEII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLAS-FTGLASMSFPEIISAMLHQSASEVRAASTHCTVMK  88

Query  397  RK-LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
               L +L  LE++ALD CLELF +  D+    +S L ++  + +HY DLQ+  S  MT
Sbjct  89   NHFLGKLSMLERQALDICLELFRDIFDDFDNAVSYLESSKVTVRHYYDLQSLLSGMMT  146



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A++ NCS   +    L  
Sbjct  49   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNHTEDVVTATSTNCSYYLQD-RSLSA  106

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTASSS  522
             ++ A++DCLEL S T DELR   +DL+T++  +
Sbjct  107  RDRLAINDCLELLSTTMDELRATTADLSTSSGGN  140



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLPRLG  417
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTA  513
            P ++ A+ DC+EL   T DEL+   SDL + A
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPA  137



>tpg|DAA54386.1| TPA: hypothetical protein ZEAMMB73_825660 [Zea mays]
Length=347

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTAS  516
             ++ A++DCLEL S T DELR   +DLA+ A 
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAG  133



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTAS  516
             ++ A++DCLEL S T DELR   +DLA+ A 
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAG  133



>ref|XP_006355852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=264

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  352  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS--  522
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T   S+  
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNISNSP  60

Query  523  -KHYVDLQTFFSAAMT  567
             KHY DLQT  S AMT
Sbjct  61   LKHYYDLQTLLSGAMT  76



>ref|XP_010042403.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40, 
partial [Eucalyptus grandis]
Length=253

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = +1

Query  217  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  396
            LQV H+  C GT Y +LCVSTLA +       +  EII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLA-SFTGLATMSFLEIISAMLHQSASEVRAASTHCTVMK  88

Query  397  RKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
               P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY DLQ+  S  MT
Sbjct  89   NHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYDLQSLLSGLMT  146



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = +1

Query  121  TSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLL--------QVAHTEAC-----EGTLYP  261
            +SF+  F  +       P H+    N+  +K             HT+ C      GT Y 
Sbjct  46   SSFSVEFNAESFLLGIKPNHVYFMDNVDEKKKSYSMDNGESHTQHTQPCPLPRCRGTPYS  105

Query  262  ELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRK-LPRLGPLEKRAL  438
             LCVSTLA+      + + PEII+  ++ +  EV+A++ +C+ ++   L +L  LE++AL
Sbjct  106  GLCVSTLAS-FTGLASMSFPEIISGMLHQSASEVRAASTHCTVMKNHFLEKLSMLERQAL  164

Query  439  DDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            D CLELF +  D+    +S L +   + +HY DLQ+  S  MT
Sbjct  165  DICLELFRDILDDFDNTVSYLDSLKVTIRHYYDLQSLLSGMMT  207



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = +1

Query  352  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS--  522
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T  SS+  
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSP  60

Query  523  -KHYVDLQTFFSAAMT  567
             KHY DLQT  S AMT
Sbjct  61   LKHYNDLQTLLSGAMT  76



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  358  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  537
            EV++S+ NCSG+++ L  L PL++RALDDCL+LF +T  EL+  + DL+ +   SK + D
Sbjct  3    EVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHD  62

Query  538  LQTFFSAAMT  567
            LQT  S AMT
Sbjct  63   LQTMLSGAMT  72



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCSG  R+   L  
Sbjct  55   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSGYLRER-SLSG  112

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD-LQTFFSAAMT  567
             +  A+ DC+EL   T +EL    +DL + +++ +  +D   T  SAA+T
Sbjct  113  RDHLAVTDCMELLETTMEELVATTADLESPSAARRPTMDHAMTVLSAAIT  162



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 6/127 (5%)
 Frame = +1

Query  196  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  375
            ++ R K    A   AC  TLY ELCVS++++           EI+ A VNV ++ VK   
Sbjct  63   HVRRWKSTSNAVKNACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQ  122

Query  376  ANCSGIRRKLPR-LGPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQT  546
            A+    R    R L   ++ AL+DC+E++ +T DEL   LSDL  AT  S  KH  DL+T
Sbjct  123  AHT---RSLFSRDLDSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLET  179

Query  547  FFSAAMT  567
              SAA+T
Sbjct  180  LLSAAIT  186



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = +1

Query  214  LLQVAHTEA---CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  384
            L Q  H  A   C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC
Sbjct  93   LFQTFHQTARSLCNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNC  151

Query  385  SGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAA  561
            + ++  L   L P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAA
Sbjct  152  TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  211

Query  562  MT  567
            MT
Sbjct  212  MT  213



>gb|EMS68834.1| Pectinesterase 1 [Triticum urartu]
Length=449

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            CEGTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCS        L  
Sbjct  54   CEGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSAYLHGR-SLTS  111

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQ-TFFSAAMT  567
             +  A+ DC+EL   T DEL    +DL + +++ +  ++   T  SAA+T
Sbjct  112  RDHLAVMDCMELLDTTMDELVATTADLQSPSAARRPTMEHAVTVLSAAIT  161



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  417
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  52   CNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  110

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAAMT
Sbjct  111  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMT  160



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAIT  175



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 4/115 (3%)
 Frame = +1

Query  232  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            T AC  T YPELC+STLAT+    +  +  ++I A++N+T   V+ +      + +K   
Sbjct  51   TSACSSTRYPELCISTLATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKG  109

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+T
Sbjct  110  LTPREKTALHDCLETIDETLDELHEAVEDLQLYPNKKSLREHAGDLKTLISSAIT  164



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAIT  175



>ref|XP_010489830.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=213

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+T
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHAGDLKTLISSAIT  173



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  408
            +AC  TLYPELCVS++++   L DR      EI+   ++V++  V+ + A  + I    P
Sbjct  83   DACSSTLYPELCVSSVSSFPGLSDRAGPI--EIVHVVLSVSIAAVEKANA-LARIMWTRP  139

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQTFFSAAMT  567
             L   ++ AL DCLELF ET DEL + +S+L   +  S+ +   DL+T  SAA+T
Sbjct  140  GLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAIT  194



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  TLYPELC+ST++ A PD   + K+  ++I  ++N+T+  V+++  +   +      
Sbjct  61   SCSSTLYPELCLSTISAA-PDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLISTNKN  119

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
            L   EK AL+DCLEL  ET DEL K   DL+       S S+H  +L+T  SAAMT
Sbjct  120  LPKREKTALNDCLELEDETLDELYKAEQDLSDYPTFNKSISQHADELKTLLSAAMT  175



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  417
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  82   CNGTLFPDLCFSKLSS-FPLLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  140

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAAMT
Sbjct  141  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMT  190



>gb|KHN03710.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=415

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = +1

Query  358  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHY  531
            E+++++ NCSG+++ L  L PL++RALD CL+LF +T  EL+  + DL+  +T  S +H+
Sbjct  3    EIRSTSYNCSGLKKMLKNLNPLDQRALDYCLKLFEDTSVELKATIDDLSIKSTIGSKRHH  62

Query  532  VDLQTFFSAAMT  567
             DLQT  S AMT
Sbjct  63   -DLQTLLSGAMT  73



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = +1

Query  205  RQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAAN  381
            R K    A   AC  TLYPE CVS++++  P    +  P EI+   V +++  V+   AN
Sbjct  26   RWKSTSKAVHHACSSTLYPEFCVSSVSS-FPGLSKRPGPMEILKVVVKLSIAAVEK--AN  82

Query  382  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQTFFS  555
                R   P L   ++ AL DC ELF ET DEL   LSDL   T  S  +   DL+T  S
Sbjct  83   ARARRLSRPGLDQRQRGALQDCFELFDETLDELYSTLSDLKNKTFISIPQSASDLETLLS  142

Query  556  AAMT  567
            AA+T
Sbjct  143  AAIT  146



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 64/113 (57%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+T
Sbjct  121  PREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADLKTLISSAIT  173



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCS        L  
Sbjct  52   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSAYLHGR-SLTS  109

Query  421  LEKRALDDCLELFSETRDELRKVLSDLATTASSSK  525
             +  A+ DC+EL   T DEL    +DL + +++ +
Sbjct  110  RDHLAVMDCMELLDTTMDELVATTADLQSPSAARR  144



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLMSQKDVIEASLNLTTTAVEHNYFGVKKLIKNTKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAIT  175



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>gb|KDO53765.1| hypothetical protein CISIN_1g018173mg [Citrus sinensis]
Length=360

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMT
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMT  184



>ref|XP_010273995.1| PREDICTED: pectinesterase 1-like [Nelumbo nucifera]
Length=226

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 66/117 (56%), Gaps = 10/117 (9%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            C  TLYP LC STL +++P  +  T P  I+   +N+T + V  S  +  G+  +   L 
Sbjct  72   CAKTLYPSLCFSTL-SSIPSSKNATHPRHILVIAINLTFNSVNISQTHIMGLLTR-QDLN  129

Query  418  PLEKRALDDCLELFSETRDELR--KVLSDLATTASSS-----KHYVDLQTFFSAAMT  567
            P E+ AL DCLE+  +T+ EL+  + L DL   +S+S     + Y +L+T  SAAMT
Sbjct  130  PQERNALQDCLEMLDQTQYELQQAQALQDLRYFSSASVGFHGRLYSNLKTLLSAAMT  186



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S LAT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSPTLYPELCISALATS-GDVKLTSQKDVIEASLNLTTTVVEHNYFTVKKLIKNRKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + + DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDLHVYPNKKTLREHAGDLKTLISSAIT  175



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 64/113 (57%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYPELCVS +AT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   SCSSTLYPELCVSAVATS-GDVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAGDLKTLISSAIT  175



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+T
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHASDLKTLISSAIT  173



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 69/119 (58%), Gaps = 12/119 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGI---RRK  402
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +   +   RRK
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTRRK  110

Query  403  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
               L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  --SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMT  167



>gb|KJB54564.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=412

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 68/118 (58%), Gaps = 10/118 (8%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  405
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDLKSLLSAAMT  167



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E  ++T DELRK + ++   +SS+   +  D+QT+ SAA+T
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALT  147



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C GTL+ ++CVSTLAT +P+   K + ++I+  V      V+AS+ANCS   ++  +L  
Sbjct  63   CAGTLHRDVCVSTLAT-IPNLAQKPLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRV  121

Query  421  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMT  567
             ++ AL DCLELF  T D+L    ++L A   S+ +    +QT  SAAMT
Sbjct  122  RDRLALSDCLELFGHTLDQLGTAAAELSAGNRSAEESIAGVQTVLSAAMT  171



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMT
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMT  184



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMT
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMT  184



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMT
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMT  184



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 10/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC GT YP+LC S +AT  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVATVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMT
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181



>ref|XP_004298672.1| PREDICTED: 21 kDa protein [Fragaria vesca subsp. vesca]
Length=197

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 70/118 (59%), Gaps = 14/118 (12%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAA---NCSGIRRKL  405
            +C  TLYP+LC ++L+  +   + KT P+++A T +NVT+   KA++A    CS    K+
Sbjct  40   SCSVTLYPKLCYTSLS--IYAGKIKTSPKVLAHTALNVTLRATKATSAVINRCS----KV  93

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV----DLQTFFSAAMT  567
              L P+E  A  DC+E  S+  DELRK + +L      S+ ++    D+QT+ SAA+T
Sbjct  94   HGLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFLFQISDIQTWVSAALT  151



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 68/118 (58%), Gaps = 10/118 (8%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATAL-PDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  405
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDLKSLLSAAMT  167



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E  ++T DELRK + ++   +SS+   +  D+QT+ SAA+T
Sbjct  95   KPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALT  147



>emb|CDY67447.1| BnaA03g57460D [Brassica napus]
Length=220

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (54%), Gaps = 4/115 (3%)
 Frame = +1

Query  232  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+T
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDLHLYPNKKSLREHAGDLKTLISSAIT  175



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYPELC+S +ATA       +  ++I A++N+T   V+ +      + +K   L 
Sbjct  93   SCSSTLYPELCISAVATA-GGVELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKKRKGLT  151

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+T
Sbjct  152  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDLKTLISSAIT  204



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 68/113 (60%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHYVDLQTFFSAAMT  567
             P E  A+ DC+E  ++T DELRK + ++   +T++   +  D+QT+ SAA+T
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSTSNYEVYMSDMQTWVSAALT  147



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            +AC  TL+PELCVS++A+           EI+ + V V +  V+ + A+   + R  P L
Sbjct  65   DACSSTLHPELCVSSIASYGGLSSKADHMEIVESAVRVGIGAVEKAKAHVRRLSR--PGL  122

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQTFFSAAMT  567
               ++ AL DC+E+F +T +EL+  L+DL  AT  S  K+  DL+T  S A+T
Sbjct  123  DFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAIT  175



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  408
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMT  167



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 67/117 (57%), Gaps = 7/117 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  TLYP+LC+S L ++  L     KT  ++IA ++N+T+  V+ +  +   +    P 
Sbjct  63   SCSSTLYPDLCLSQLTSSPSLASNAVKTPKDVIALSLNLTIAYVQHNYFSIKKVAAVRPG  122

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL-----ATTASSSKHYVDLQTFFSAAMT  567
            L   E+ AL DCLE+  ET DE+R+ L++L         S+S+   D++T  SAAMT
Sbjct  123  LTARERTALHDCLEMVDETLDEVRETLAELLAYPNGGNKSASELAEDMKTLLSAAMT  179



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  408
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMT  167



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  T YPELC+S + TA       +  ++I A+VN+T+  V+ +      + +K   L 
Sbjct  62   SCSSTRYPELCISAVVTA-GGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLT  120

Query  418  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+T
Sbjct  121  PREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAIT  173



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 86/186 (46%), Gaps = 24/186 (13%)
 Frame = +1

Query  28   VTRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHR  207
            +++  + K    L  +    +AI LL F +V          GI+++T     + N N   
Sbjct  8    ISKFSDFKNNKKLILS---SAAIALLLFATVV---------GIAATT-----NQNKNKKI  50

Query  208  QKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  378
              L   +H      C  TLYPELC ST+A A   ++  +  E+I A++N+T   VK +  
Sbjct  51   TTLSSTSHAVLKSVCSSTLYPELCFSTVA-ATGGKQLTSQKEVIEASLNLTTKAVKHNYF  109

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTF  549
                +  K   L P E  AL DCLE   ET DEL   + D+       S  KH  DL+T 
Sbjct  110  AVKKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDIHQYPKQKSLRKHADDLKTL  169

Query  550  FSAAMT  567
             S+A+T
Sbjct  170  ISSAIT  175



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  408
            AC GT YP+LC S + TA+P   AK +    ++I  ++N T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAV-TAVPAGTAKKVRSQKDVIELSLNTTTTAVEH---NYFKIKKLLA  123

Query  409  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMT
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  408
            +C  TLYPELC ST+++A PD   + K    +I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKGVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMT
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMT  167



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 64/117 (55%), Gaps = 12/117 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATA----LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YPELC+S + TA    L  ++     ++I A+VN+T+  V+ +      + +K 
Sbjct  62   SCSSTRYPELCISAVVTAGACELTSQK-----DVIEASVNLTITAVEHNYFTVKKLIKKR  116

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+T
Sbjct  117  KGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAIT  173



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 67/113 (59%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC ++LAT       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  72   SCTFTTYPRLCFTSLATQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSNTRL  127

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E   +T DELRK + ++   ++S+   +  D+QT+ SAA+T
Sbjct  128  KPREVAAMRDCVEELGDTLDELRKSIGEMCRLSNSNYEVYMSDIQTWVSAALT  180



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (55%), Gaps = 10/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMT
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (55%), Gaps = 10/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMT
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (55%), Gaps = 10/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMT
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLYPELCVS +A +    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCVSAVAIS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNKKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  TLYPELC S +++   +    T P ++I A +N T+  V+ +      I +    L
Sbjct  61   SCSATLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHIIKTRLGL  120

Query  415  GPLEKRALDDCLELFSETRDELRKV---LSDLATTASSSKHYVDLQTFFSAAMT  567
             P EK AL DCLE+  +T DEL K    L D +   S S+   DL T  SAAMT
Sbjct  121  SPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMT  174



>ref|XP_002864788.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41047.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=196

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC S+L+T       +T P+I+A A +N+T+   KA++A    +R    RL
Sbjct  40   SCTFTTYPRLCFSSLSTHAS--LIQTSPKIMAHAALNITLASAKATSAMM--VRLSNSRL  95

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T
Sbjct  96   KPREISAMRDCVEELGDTLEELRKSIGEMCRLSGSNYEVYMSDIQTWVSAALT  148



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 68/116 (59%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+ + K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSKS-  95

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALT  151



>gb|AAC05147.1| 21 kD protein precursor [Pinus radiata]
Length=211

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ + YP+LCVS+L+      +  T+ +++ A +NV++   +  +   +G++ +   + 
Sbjct  41   SCQVSRYPQLCVSSLSPYAGSLK-PTLCDLVKAAMNVSLVNARTVSVWAAGLKGRSAEMS  99

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMT  567
              E+ AL+DC++ F +T DE++K L +L     S  +    D+QTF SAA+T
Sbjct  100  ERERAALNDCIQNFDDTVDEIQKSLKELEQLQRSNFNPQMNDMQTFMSAALT  151



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 10/125 (8%)
 Frame = +1

Query  220  QVAHT---EACEGTLYPELCVSTLATALPDR---RAKTIPEIIAATVNVTVDEVKASAAN  381
            Q AH     +C  TLYPELC ST++T LPD    + K+  ++I  ++NVT D VK + + 
Sbjct  58   QAAHVVLKSSCSTTLYPELCFSTIST-LPDDAVTKIKSTRDVIDLSLNVTKDSVKQTYSK  116

Query  382  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS---SKHYVDLQTFF  552
               +          E+ A  DCL + +ET DE+ KV  +L   +S    S+H   L+   
Sbjct  117  IEKLAYSGTNYTQRERIAFHDCLLVLNETLDEINKVEDELKEYSSKETISQHADVLKILL  176

Query  553  SAAMT  567
            SAAMT
Sbjct  177  SAAMT  181



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 82/161 (51%), Gaps = 13/161 (8%)
 Frame = +1

Query  100  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  279
            LL  L+ T F +L    G+SS     H   + + H   +++     AC  TLYPELC+S+
Sbjct  25   LLFALAATLFIALAVVAGVSSRKNSAHNASSTSSH--AIIK----SACSSTLYPELCLSS  78

Query  280  LATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLE  453
            +A+  P +  +  T   +I  ++N+TV  V+ +      + RK   L   +K AL DCLE
Sbjct  79   IASE-PGKADKVSTHKNVIEQSLNITVGIVERNYFTVEKLLRK-KGLTKRQKTALHDCLE  136

Query  454  LFSETRDELRKVLSDLATTASS---SKHYVDLQTFFSAAMT  567
               ET DEL K + +L    S    S H  DL+T  S+A+T
Sbjct  137  TIDETLDELHKAIDELKEYPSKKSLSHHAEDLKTLMSSAIT  177



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 9/135 (7%)
 Frame = +1

Query  190  NLNIHR--QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVT  351
            N N H   Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T
Sbjct  54   NSNDHADIQAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNIT  113

Query  352  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSS  522
               V+ +      + +    L P EK AL DCLE   ET DEL   + DL       S  
Sbjct  114  CKAVQHNFFTVEKLIKTRKGLTPREKVALHDCLETIDETLDELHTAIDDLELYPNKKSLK  173

Query  523  KHYVDLQTFFSAAMT  567
             H  DL+T  S+A+T
Sbjct  174  DHADDLKTLISSAIT  188



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 7/127 (6%)
 Frame = +1

Query  208  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  375
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQT  546
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H  DL+T
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKT  171

Query  547  FFSAAMT  567
              S+A+T
Sbjct  172  LISSAIT  178



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 7/127 (6%)
 Frame = +1

Query  208  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  375
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  62   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  121

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQT  546
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H  DL+T
Sbjct  122  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKT  181

Query  547  FFSAAMT  567
              S+A+T
Sbjct  182  LISSAIT  188



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    I + L
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISKSL  96

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T
Sbjct  97   G-MKPREAEAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALT  151



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  TLY ELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYTELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMKGLT  122

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+T
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAIT  175



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 57/112 (51%), Gaps = 4/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S +A A   +   +  E+I A++N+T   VK +      +  K   L P
Sbjct  61   CSSTLYPELCFSAVA-ATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTP  119

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+T
Sbjct  120  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAIT  171



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKS-  95

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALT  151



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 57/112 (51%), Gaps = 4/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S +A A   +   +  E+I A++N+T   VK +      +  K   L P
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTP  124

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+T
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAIT  176



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (54%), Gaps = 4/115 (3%)
 Frame = +1

Query  232  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+T
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDLHLYPNKKSLREHAGDLKTLISSAIT  175



>gb|KJB19687.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
 gb|KJB19688.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
Length=201

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR-  411
            +C  T YP+LC  +L T       +T P++IA A +NVT+   K+++A    +  KL + 
Sbjct  44   SCSSTTYPKLCYESLLT--QASMIQTSPQLIAHAALNVTLSTAKSTSA----LMVKLAKS  97

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              L P E  A+ DC+E   +T DELRK +S++     S+   +  D+QT+ SAA+T
Sbjct  98   QGLKPTEVGAMQDCVEELEDTIDELRKSISEMGQLKGSNFGLMINDIQTWVSAALT  153



>ref|XP_002324773.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
 gb|EEF03338.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
Length=359

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 90/187 (48%), Gaps = 30/187 (16%)
 Frame = +1

Query  40   HN-LKQKATLFFTISGCSAIVLL-AFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  213
            HN LK K  LF ++   S+I+L+ A +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRLFLSL--FSSILLVTAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  214  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  378
              QVAHT    +C  TLYP LC S L+ A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAHTILKSSCSSTLYPHLCFSALS-AVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQT  546
                +          E  AL DCL + +ET D+L K   +L    S  K    H  DL+ 
Sbjct  108  KIQKLTSTRRSFTERENTALHDCLVMLNETLDQLSKAYQELQDYPSLKKSLSVHADDLKI  167

Query  547  FFSAAMT  567
              SAAMT
Sbjct  168  LLSAAMT  174



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  T YPELC+S +A         +  ++I A++N+T+  V+ +  N   + +K   L 
Sbjct  61   SCSSTRYPELCISAVANT-GGVEITSQKDVIEASLNLTIIAVEHNYFNVKKLIKKRKGLT  119

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            P EK AL DCLE   ET DEL + + DL    +     +H  DL+T  S+A+T
Sbjct  120  PREKTALHDCLETIDETLDELHETVEDLHLYPARKTLREHAGDLKTLISSAIT  172



>gb|ABK24883.1| unknown [Picea sitchensis]
Length=571

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 4/135 (3%)
 Frame = +1

Query  175  THLDLN---LNIHRQKLLQVAHTEA-CEGTLYPELCVSTLATALPDRRAKTIPEIIAATV  342
            TH ++N   + ++R++L   A  E+ C  TLYP++CVS+L      R+A +  E+    V
Sbjct  43   THSNVNEHGVVMNRRELEGTAVFESVCSVTLYPDVCVSSLLAHPESRKAASSKELATIVV  102

Query  343  NVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  522
             VT+ E+K  +A+      +        + A+DDCLELF  +  +L   L  L ++    
Sbjct  103  KVTLYELKNLSASLGSEMSRQRITDQRSQSAVDDCLELFGYSLRQLNDSLGSLQSSEWRR  162

Query  523  KHYVDLQTFFSAAMT  567
            +   D+QT+ SA++T
Sbjct  163  QEADDVQTWLSASLT  177



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (53%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP---EIIAATVNVTVDEVKASAANCSGIRRKLP  408
            +C  TLYP+LC ST+ +ALP     TI    ++I  ++NVT   V  +     G+     
Sbjct  71   SCSSTLYPDLCFSTI-SALPADATSTIKTTKDVIILSLNVTESSVYQTYLKIQGLTLARR  129

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMT  567
               P E  AL DCL+  SET DE+RKV+  L    +   S S+H  +L+   SAAMT
Sbjct  130  SYTPREVTALKDCLQTLSETVDEIRKVVQLLKEYPSLKNSISEHADELKILISAAMT  186



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +1

Query  181  LDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTV  354
            L ++ N HR+    +    +C  TLYP+LC+S L ++  L     KT  +++A  +N+T+
Sbjct  27   LAIDDNRHREARSLI--KSSCSSTLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTI  84

Query  355  DEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL-----ATTASS  519
              V+ +      +      L   E+ AL DCLE+  ET DE+R+ L+DL       + S 
Sbjct  85   TSVQHNYFTIKKVAATRSGLTVRERTALHDCLEMVDETLDEVRETLADLLAYPNGGSKSV  144

Query  520  SKHYVDLQTFFSAAMT  567
            S+   D++T  SAAMT
Sbjct  145  SELAEDMKTLLSAAMT  160



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP+LC  TL+T       +T P+++A A +NVT+   ++++A    + +    L
Sbjct  44   SCSSTTYPKLCFETLST--HASLIQTSPQLLAHAALNVTLSTTESTSAMMVTLSKS-HGL  100

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P E  A+ DC+E  S++ DELRK +S++     S+   +  D+QT+ SAA+T
Sbjct  101  KPREAEAMQDCVEELSDSIDELRKSISEMGQVKGSNFGLMINDVQTWVSAALT  153



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  421  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMT  567
             ++ AL DCLELF  T D L    ++L A  +++ +    +QT  SAAMT
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMT  180



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  421  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMT  567
             ++ AL DCLELF  T D L    ++L A  +++ +    +QT  SAAMT
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMT  180



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            AC  T YP LC+++L+T       +T P+++A A +N+T+   KA++A    +   + +L
Sbjct  42   ACTYTTYPRLCIASLST--HATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV-QL  98

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH-YV-DLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++    SS+   Y+ D+QT+ SAA+T
Sbjct  99   KPREVSAMRDCVEELGDTVEELRKSIGEMGQLNSSNYEVYISDIQTWVSAALT  151



>emb|CBI27756.3| unnamed protein product [Vitis vinifera]
Length=537

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 81/170 (48%), Gaps = 25/170 (15%)
 Frame = +1

Query  94   IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  252
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  22   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  69

Query  253  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  429
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  70   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKAL-FTYQDLNSQEK  128

Query  430  RALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMT  567
             AL+DC+E+  +T  EL + + DL     +     + Y +L+T  SAAMT
Sbjct  129  NALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMT  178



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +1

Query  205  RQKLLQVAHT---EACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVK  366
            + +  Q AH     +C  TLYP+LC ST++T LP+    + +   ++I  ++NVT + V 
Sbjct  51   KNEYHQAAHAIIKSSCSATLYPDLCFSTIST-LPNAAISKVRNTRDVIGLSLNVTKESVT  109

Query  367  ASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYV  534
             +    + I   L +L P EK A  DC EL ++T  ++ KV   L +  S  K    H  
Sbjct  110  KAYLKINRISSGLKKLTPREKIAFGDCFELLNQTIVQINKVARKLHSYPSLKKSIAEHAE  169

Query  535  DLQTFFSAAMT  567
            + +   SAA+T
Sbjct  170  EFKILLSAALT  180



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    +  K 
Sbjct  74   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMS-KS  127

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T
Sbjct  128  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALT  183



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    +  K 
Sbjct  46   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMS-KS  99

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T
Sbjct  100  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALT  155



>ref|XP_002277473.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=582

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 81/170 (48%), Gaps = 25/170 (15%)
 Frame = +1

Query  94   IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  252
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  25   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  72

Query  253  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  429
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  73   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKAL-FTYQDLNSQEK  131

Query  430  RALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMT  567
             AL+DC+E+  +T  EL + + DL     +     + Y +L+T  SAAMT
Sbjct  132  NALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMT  181



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 69/135 (51%), Gaps = 14/135 (10%)
 Frame = +1

Query  193  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  357
            +N HR    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T  
Sbjct  48   VNSHRNSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT-  105

Query  358  EVKASAANCSGIRRKL--PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSS  522
              KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S  
Sbjct  106  --KAVQHNFFTVEKLIATKKLSKREKTALHDCLEIIDETLDELHEALVDLNEYPNNKSLK  163

Query  523  KHYVDLQTFFSAAMT  567
            KH  DL+T  S+A+T
Sbjct  164  KHADDLKTLLSSAIT  178



>ref|NP_201042.2| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAA97200.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAO41999.1| putative DC1.2 homolog [Arabidopsis thaliana]
 gb|AED97600.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=203

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 67/113 (59%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  47   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  102

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLAT-TASSSKHYV-DLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++   + S+ + Y+ D+QT+ SAA+T
Sbjct  103  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALT  155



>gb|AAN60276.1| unknown [Arabidopsis thaliana]
Length=204

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 67/113 (59%), Gaps = 7/113 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  48   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  103

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLAT-TASSSKHYV-DLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++   + S+ + Y+ D+QT+ SAA+T
Sbjct  104  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALT  156



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  417
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    + R   RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRS-SRLK  98

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
            P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALT  150



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 5/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE+  ET DEL   L DL       S  KH  DL+T  S+A+T
Sbjct  124  REVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTLISSAIT  175



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 5/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE+  ET DEL   L DL       S  KH  DL+T  S+A+T
Sbjct  124  RELTALHDCLEIIDETLDELHVALEDLHQYPKGKSLRKHADDLKTLISSAIT  175



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC S+L      + A  I      +  A +NVT+  VK+++A  S + +K 
Sbjct  47   SCSSTTYPRLCYSSLV-----KHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKK-  100

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              L P E  A+ DC+E  S+T DELR+ +++++   +S+   +  D+QT+ SAA+T
Sbjct  101  QGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  156



>ref|XP_004245727.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=206

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEKQLAHAALSVSLSKAKSTIIFVSKLNR-MRGLK  99

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK------HYVDLQTFFSAAMT  567
            P+EK+A+ DC++  S++ D++ K + +L  T   S       H  ++QT+ SAA+T
Sbjct  100  PIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFSSGQDFMWHVSNVQTWVSAALT  155



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 67/145 (46%), Gaps = 21/145 (14%)
 Frame = +1

Query  196  NIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDE  360
            N H  KL    HT    +C  T YP+LC S +A+A      K  T  ++IAA++N+T   
Sbjct  41   NNHNPKLSHETHTILKASCSNTKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLA  100

Query  361  VKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT----------  510
            V+ +      +      L   E+ AL DCLE   ET DELR+ L DL +           
Sbjct  101  VEHNFFTVEKLIETRKNLTVRERNALHDCLESIDETLDELRRTLQDLLSYTHTNNNNNNN  160

Query  511  -----ASSSKHYV-DLQTFFSAAMT  567
                   S K Y  D++T  SAAMT
Sbjct  161  NNNKRGKSLKDYADDMKTLVSAAMT  185



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL--  405
            AC  T YP+LC S +AT +P   ++  +  ++IA ++N+TV  V+    N   I + L  
Sbjct  100  ACSSTRYPDLCYSAIAT-VPGASKKVTSQKDVIAVSLNITVTAVEH---NYFTIEKLLDF  155

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL   + DL       S ++H  DL+T  SAAMT
Sbjct  156  KNLTKREKAALHDCLETIDETLDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMT  212



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP+LC S +A      +  + P ++I A++N+T+  ++ S  +   +    P L
Sbjct  65   SCRSTRYPDLCYSAVAATPALIQTISKPKDVIHASINLTITAIQRSFRHVERLSASYPNL  124

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
               E+ AL DCLE+F E+ DEL    +DL    +     +H +DL+   SAAMT
Sbjct  125  TTRERTALHDCLEMFDESLDELNLTDADLRAYPAGKPLRRHALDLEILVSAAMT  178



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +1

Query  304  RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELR  483
            R  T+P   A  ++ T+ EVKAS+ NC+ I R L    P++KRALDDCLEL  +T  EL 
Sbjct  2    RRNTLP---ATLLSHTLKEVKASSTNCTNIERNLRSSDPVQKRALDDCLELLDDTIAELN  58

Query  484  KVLSDLATTASSSKHYVDLQTFFSAAMT  567
             V+ DL++  S+SKH+ DLQT  S AMT
Sbjct  59   DVVFDLSSRKSASKHFHDLQTLLSGAMT  86



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 62/118 (53%), Gaps = 11/118 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD-RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL---  405
            +C  TLYPELC S +A +L D ++  +  ++I  ++NVT+  V+    N   I + L   
Sbjct  49   SCSSTLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQ---RNYFAIEKLLYAG  105

Query  406  -PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT---TASSSKHYVDLQTFFSAAMT  567
               L   EK AL DCLE   ET DEL   + DL       S  +H  DL+T  S+A+T
Sbjct  106  KSNLTEREKTALHDCLETIDETLDELHTAVKDLKEYPLKKSIREHADDLKTLLSSAIT  163



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 59/114 (52%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  65   ACSNTLHPELCYSAIVNVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  124

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
             P EK AL DCLE   ET DEL   ++DL       S  +H  DL+T  S+A+T
Sbjct  125  TPREKVALHDCLETMDETLDELHTAVADLELYPNKKSLKEHAEDLKTLISSAIT  178



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 63/127 (50%), Gaps = 7/127 (6%)
 Frame = +1

Query  208  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  375
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQT  546
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H   L+T
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADGLKT  171

Query  547  FFSAAMT  567
              S+A+T
Sbjct  172  LISSAIT  178



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 85/182 (47%), Gaps = 24/182 (13%)
 Frame = +1

Query  49   KQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVA  228
            K+   L  +ISGC    LL   +V          GI +     H D NL++    L    
Sbjct  16   KRNRKLLLSISGC----LLLVAAVI---------GIVAGVHSGHHDRNLDV--STLTPPT  60

Query  229  HT---EACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGIR  396
            H     +C  T YP+LC S +A          T  ++I A++N+T   V+ +      + 
Sbjct  61   HAILKSSCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLL  120

Query  397  RKLPR-LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAA  561
             K  + L   EKRAL DCLE   ET DELR+   DL++  S++K    H  DL+T  S+A
Sbjct  121  SKRSKSLTKREKRALHDCLETIDETLDELREAERDLSSYPSAAKSLKQHADDLKTLMSSA  180

Query  562  MT  567
            +T
Sbjct  181  IT  182



>ref|XP_003625921.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 ref|XP_003628462.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES82139.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 10/116 (9%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            EAC  T Y  LC+ TLA    +   +T  +   A V+VT+ EVK    N      KL + 
Sbjct  36   EACSVTRYQNLCIHTLA-QFSNTAGRTPSKWARAGVSVTISEVK----NVQAYLTKLKKN  90

Query  415  GPLEKR---ALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMT  567
            G ++ R   AL DC+E F    DEL K L  L   + +  S    DL T+ SAA+T
Sbjct  91   GKMKGRNRVALSDCIETFGYAVDELHKSLGVLRKLSKNTFSTQMGDLNTWISAALT  146



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 66/115 (57%), Gaps = 10/115 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTL---ATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  408
            +C  T YP LC S+L   A  +   R      +  A +NVT+  VK+++A  S + +K  
Sbjct  96   SCSSTTYPRLCYSSLVKHADLIQTNRVV----LTGAALNVTLASVKSTSAMMSTLAKK-Q  150

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             L P E  A+ DC+E  S+T DELR+ +++++   +S+   +  D+QT+ SAA+T
Sbjct  151  GLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  205



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LCV++L+T       +T P+++A A +N+T+   KA++     +     +L
Sbjct  42   SCTVTTYPRLCVASLST--HASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSS-SQL  98

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E   +T DELRK + ++     SS   +  D+QT+ SAA+T
Sbjct  99   KPREVSAMRDCVEELGDTLDELRKSIGEMGQLIGSSYEVYMSDIQTWVSAALT  151



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC  TLYPELC S+L +A P    +A +  ++I A +N+++    A       +++   R
Sbjct  48   ACSSTLYPELCFSSL-SAFPAAAEKASSQKDVIEAALNLSI---TAGEHAYFKLKKLYGR  103

Query  412  LGPLEKR--ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
               LE    AL DCLEL  ET DELRK   +L    +  S S H  DL+T  S AMT
Sbjct  104  KDVLEAEHTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSGAMT  160



>ref|XP_002322405.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06532.2| ripening-related family protein [Populus trichocarpa]
Length=197

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T+YP+LC S+L  ++     +T PE++A A +NVT+   K+++A  S + +    L
Sbjct  40   SCSTTIYPKLCYSSL--SIHSSTIQTSPELLANAALNVTLSSAKSTSAKMSTLSQS-HGL  96

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P E  A++DC+E  ++   EL+K + +++    S+   +  D+QT+ SAA+T
Sbjct  97   KPREVSAMEDCVEELTDAVYELKKSIDEMSHAKKSNFRMMISDVQTWVSAALT  149



>ref|XP_010420924.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +CE   YP LCV TL++  P        ++  A V +++   +++A   + +R  + +  
Sbjct  38   SCEHASYPSLCVRTLSS-YPGPTITNSRDLAQAAVKISLSHAQSAAKKLAAVRDSVGKKK  96

Query  418  PLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY----VDLQTFFSAAMT  567
             LEK AL DC+E+  ++ DEL +   VL  L  T  S+K +     + QT+ SAA+T
Sbjct  97   KLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVTGGSAKEFRWQMSNAQTWASAALT  153



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  69   ACSNTLHPELCYSAIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  128

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             P EK AL DCLE   ET DEL   + DL       S  +H  DL+T  S+A+T
Sbjct  129  TPREKVALHDCLETMDETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAIT  182



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 65/113 (58%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LCV++L+T       +T  ++IA A +N+T+   KA++A    +     RL
Sbjct  43   SCTFTTYPRLCVTSLST--QSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSS-SRL  99

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T
Sbjct  100  KPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMSDIQTWVSAALT  152



>ref|XP_006355502.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=206

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEQQLAHAALSVSLSKAKSTMIFVSKLNR-MRGLK  99

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS------KHYVDLQTFFSAAMT  567
            P EK+A+ DCL+  S++ D++ K + +L  T   S       H  ++QT+ SAA+T
Sbjct  100  PREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFSTGQDFMWHVSNVQTWVSAALT  155



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  408
            +C  TLYPELC ST+++A PD   + K   ++   ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVTELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMT  567
             L   EK AL+DCLEL  ET DEL     DL+       S S+H   L++  SAAMT
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADVLKSLLSAAMT  167



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 65/113 (58%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T Y  LCV++L+T       +T P+++A A +N+T+   KA++     + R  P L
Sbjct  41   SCNFTQYQRLCVASLSTQAS--LIQTSPKLMAHAALNITLASAKATSVMMVRLSRTSP-L  97

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T
Sbjct  98   KPREASAMRDCVEELGDTLEELRKSIGEMGQLSGSNYELYMSDVQTWVSAALT  150



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  TLYP+LC S +AT +P       T  +II  ++N+T   V+ +      I      
Sbjct  66   SCRSTLYPDLCYSAIAT-VPGAMDNLSTQKDIIEMSLNITTTAVEHNYFTIEKIIGS-KN  123

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMT  567
            L   EK AL DCLE+  ET DEL K   DL    SS K    H  DL+   SAAMT
Sbjct  124  LTKREKTALHDCLEMVDETLDELHKTADDLKDYPSSKKSIFQHADDLKILVSAAMT  179



>ref|XP_008368265.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=375

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  408
            +C  TLYPELC STLA   P+  ++  +  ++I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDVIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS---SKHYVDLQTFFSAAMT  567
            +L   EK AL DCLE   ET DEL   + DL    +    ++H  DL+T  S+A+T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAIT  184



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP+LC ++L+  +     +T P+++A A +NVT+   K+++A  S + +    +
Sbjct  46   SCSTTTYPKLCYTSLS--VHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLSQS-HGM  102

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P+E  A+ DC+E  S+T + LRK + ++ T   S    +  D+QT+ SAA+T
Sbjct  103  KPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKESDFKLMINDVQTWVSAALT  155



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 11/115 (10%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S ++T    ++  +  ++I A++N+T + V     N   ++++L +   
Sbjct  66   CSSTLYPELCFSAVSTT--GKKLTSQKDVIEASLNLTRNAV---TNNYLDVKKQLAKRKG  120

Query  421  LEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            L  R   AL DCLE   ET DEL K + DL       S  KH  DL+T  S+A+T
Sbjct  121  LTVREVTALHDCLETMDETLDELYKAVKDLHIYPNGKSLRKHSDDLKTLISSAIT  175



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 64/116 (55%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC ++L      + A +I      +    +NVT+  VK++ A  S +  K 
Sbjct  41   SCSSTTYPRLCYASLV-----KHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLA-KT  94

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              L P E  A+ DC+EL S++ DELRK +++++   +S+      D+QT+ SAA+T
Sbjct  95   RELKPRETAAMKDCIELLSDSIDELRKSINEMSRLRTSNFELTMSDIQTWVSAALT  150



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 69/135 (51%), Gaps = 14/135 (10%)
 Frame = +1

Query  193  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  357
            +N H+    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T  
Sbjct  53   VNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT-  110

Query  358  EVKASAANCSGIRRKL--PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSS  522
              KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S  
Sbjct  111  --KAVQHNFFTVEKLIATKKLTKREKTALHDCLEIIDETLDELHEALVDLNDYPNNKSLK  168

Query  523  KHYVDLQTFFSAAMT  567
            KH  DL+T  S+A+T
Sbjct  169  KHADDLKTLLSSAIT  183



>gb|ADE76337.1| unknown [Picea sitchensis]
Length=204

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ TLYP++CVS+L +     +A T  +I+ A V  ++   +  +   +G++ +   + 
Sbjct  42   SCKVTLYPQVCVSSLFSYAGSLKA-TQSDIVKAAVQASLVNARNISVWATGMKTRGATMS  100

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMT  567
              EK AL DC+E F  T D++R+ LS+L     ++  +   +++T+ SAA+T
Sbjct  101  KREKAALVDCIENFGVTTDQIRESLSELKKLQRNTFKFQMSNVKTWMSAALT  152



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 56/187 (30%), Positives = 88/187 (47%), Gaps = 19/187 (10%)
 Frame = +1

Query  28   VTRMHNLKQKATLF--FTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNI  201
            +TR+ N  +K   F  FT    +A ++    SVTS     TK+ I SS+       +  I
Sbjct  8    LTRISNSNKKKLFFSLFTALLITASIIAISASVTSSQKTKTKNNIVSSSLSLSHHSHTII  67

Query  202  HRQKLLQVAHTEACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASA  375
                        AC  TLYP+LC S +++  P+   +     ++I+ ++N+T   V+ + 
Sbjct  68   ----------KTACTTTLYPDLCFSAISSE-PNITHKINNHKDVISLSLNITTRAVEHNF  116

Query  376  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQT  546
                 + R+   L   EK AL DCLE   +T DEL++   DL    +     +H  DL+T
Sbjct  117  FTVENLLRR-KNLSEREKIALHDCLETIDDTLDELKEAQRDLVLYPNKKTLYQHADDLKT  175

Query  547  FFSAAMT  567
              SAA+T
Sbjct  176  LISAAIT  182



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 68/136 (50%), Gaps = 13/136 (10%)
 Frame = +1

Query  196  NIHRQKLLQV---AHT---EACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNV  348
            N  +Q+ L+V   AH     +C  TLYP+LC STLA  LP   ++ I    ++I   +N 
Sbjct  55   NNSKQESLRVSSAAHAIVKSSCSNTLYPDLCFSTLAN-LPQAVSQKITSQKDVIELVLNH  113

Query  349  TVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASS  519
            T   V+ +      +      L   EK AL DCLE   ET DEL + + DL    +  S 
Sbjct  114  TTTTVEHNYFAVEHLIATHHNLTEREKTALHDCLETIDETLDELHQTVKDLELYPSKKSL  173

Query  520  SKHYVDLQTFFSAAMT  567
             +H  DL+T  SAAMT
Sbjct  174  KQHADDLKTLMSAAMT  189



>ref|XP_009335740.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=202

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 5/114 (4%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  411
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMT  567
            +    K AL DC+E F    DEL K L  L T   ++      DL+T+ SAA+T
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALT  150



>ref|XP_009335681.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 5/114 (4%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  411
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMT  567
            +    K AL DC+E F    DEL K L  L T   ++      DL+T+ SAA+T
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALT  150



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGI-RRKLPR  411
            +C  T YP+LC S +A          T  ++I A++N+T   V+ +      +  ++  R
Sbjct  58   SCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEQNFFTVEKLLSKRSKR  117

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMT  567
            L   EKRAL DCLE   ET DEL++   DL +  S++K    H  DL+T  SAA+T
Sbjct  118  LTKREKRALHDCLETIDETLDELQQAARDLNSYPSAAKSLKQHADDLKTLMSAAIT  173



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 64/112 (57%), Gaps = 6/112 (5%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  417
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    +     RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSS-SRLK  98

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
            P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALT  150



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (55%), Gaps = 13/117 (11%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPR-  411
            +C  T+YP LC  +L+  +   + KT P+++A T +NVT+    A+    S I R+L   
Sbjct  39   SCSVTIYPRLCYHSLS--IYAGKIKTDPKVLAHTALNVTL----AATQESSVIMRRLSEI  92

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV---DLQTFFSAAMT  567
              L P+E  A+ DC+E   +  DEL++ L +L      S  +    D+QT+ SAA+T
Sbjct  93   HGLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQMSDIQTWVSAALT  149



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             +K A  DCLE   ET  EL +V+ D+       S S++  DL+T  S+ +T
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTIT  153



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC +T++TA+      +  E I A+VN+T+  V  +      + +    L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITIGAVGDNYRRVKKLLKTENSLTK  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             EK AL DCLE   ET  EL +V+ D+       S S++  DL+T  S+A+T
Sbjct  102  REKIALHDCLETGEETLRELYEVVEDVNEYPNKKSLSRYADDLKTLLSSAIT  153



>ref|XP_008242331.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=554

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = +1

Query  220  QVAH---TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  390
            Q+ H     AC   L+P LC + LA+A       T   ++ A +N TV  V+++  +  G
Sbjct  40   QIPHPTIKNACTTLLHPSLCFTALASAKTHDHFTTFHHLLEANINQTVASVESTRQSIKG  99

Query  391  IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            +  KL  L   E+ AL DCLE+  +T  EL + + DL     S   Y +L+T  SAAMT
Sbjct  100  L-LKLQDLYLQERNALKDCLEMLDQTLYELGQAVDDLHGFRVS---YGNLKTLLSAAMT  154



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             +K A  DCLE   ET  EL +V+ D+       S S++  DL+T  S+ +T
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTIT  153



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C    +P+LC S +A   P     + P ++I A++N+T+  ++ S  +   +      L
Sbjct  58   SCRSARFPDLCYSAIAATPPLVHTISKPKDVIHASLNLTITAIERSFRHVERLSAAAANL  117

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
               E+ AL DCLE+F E+ DELR   +DL    +     +H +DL+   SAAMT
Sbjct  118  TARERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSAAMT  171



>gb|ACU13418.1| unknown [Glycine max]
Length=202

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC S+L      R A  I      +  A +NVT+  VK+++A  S + +K 
Sbjct  47   SCSSTTYPRLCYSSLV-----RHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKK-  100

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              L   E  A+ DC+E  S+T DELR+ +++++   +S+   +  D+QT+ SAA+T
Sbjct  101  QGLKLREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  156



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  T YP+LC S +A+A P   +K  ++ ++I  ++N+T   V+ +      + ++   
Sbjct  67   SCSTTRYPDLCFSAVASA-PGATSKLVSLKDVIEVSLNLTTTAVEHNFFTVEKLAKR-KG  124

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
            L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  S+A+T
Sbjct  125  LTKREKTALHDCLETIDETLDELHKAMDDLKEYPNKKSLSQHADDLKTLLSSAIT  179



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 59/129 (46%), Gaps = 20/129 (16%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATA----LPDRRAKTIP-------------EIIAATVNVTVDEVKA  369
            C  TLYPELC S +A       PD+     P             ++I A++N+T + VK 
Sbjct  66   CSSTLYPELCFSAVAATGKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKH  125

Query  370  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  540
            +      +  K   L   E  AL DCLE+  ET DEL   L DL       S  KH  DL
Sbjct  126  NYFAVKKLITKRKGLTAREVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDL  185

Query  541  QTFFSAAMT  567
            +T  S+A+T
Sbjct  186  KTLISSAIT  194



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 18/131 (14%)
 Frame = +1

Query  208  QKLLQVAHTE----ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKAS  372
            + L Q   TE    +C  T YP LC S+L   +   + +T P ++A A +NVT+    AS
Sbjct  30   RNLAQTTSTEFIRTSCSTTTYPRLCYSSLK--IHASKIQTSPMLLANAALNVTL----AS  83

Query  373  AANCSGIRRKLPR---LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV---  534
              + S + +KL +   + P E  A+ DC++  +++ DELRK + +L   A  SK  +   
Sbjct  84   TRSTSTMMQKLSKSHGMKPREVSAMQDCMDELTDSVDELRKSIDELG-KAQGSKFGLMMN  142

Query  535  DLQTFFSAAMT  567
            D+QT+ SAA+T
Sbjct  143  DVQTWVSAALT  153



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 10/115 (9%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S +A A   +   +  ++I A++N+T    KA   N   +++ + +   
Sbjct  66   CSSTLYPELCYSAVA-ASGGKELTSHKDVIEASLNLTT---KAVTHNYFAVKKLITKRKG  121

Query  421  LEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            L  R   AL DCLE   ET DEL +   DL    T  S  KH  DL+T  S+A+T
Sbjct  122  LTAREVTALHDCLETIDETLDELHEAKEDLHMYPTQKSLRKHADDLKTLISSAIT  176



>ref|XP_008812393.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=586

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 10/116 (9%)
 Frame = +1

Query  226  AHTEACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRR  399
            A T ACE T YP  C S LA+    P + AK + ++           V+A A N +   +
Sbjct  89   AITSACEATHYPNACQSALASLAGAPTKSAKEVFDVSVQFAMGRAHSVRAMAYNLTLNHQ  148

Query  400  KLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            KL   G      +DDCLEL   T D+L  VL       SSS H  D++T+ SAA+T
Sbjct  149  KL---GSGRPTGMDDCLELLDITLDQLNDVLD---AKKSSSPH--DIKTWLSAALT  196



>gb|AFK47771.1| unknown [Lotus japonicus]
Length=205

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP----EIIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC ++L      + A++I     ++    +NVT+   K+++A  S + +K 
Sbjct  45   SCSSTTYPRLCFASLV-----KHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKK-  98

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              + P E  A+ DC+E+ S++ DELR+ +++L    +S+      D+QT+ SAA+T
Sbjct  99   QGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALT  154



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 5/115 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  TL+ ELC ST+A  +P+  ++     ++I  ++N+T   V+ +      + +    
Sbjct  75   SCSITLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLVKTRKG  134

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
            L   EK AL DCLE   ET DEL   + DL       S  +H  DL+T  SAA+T
Sbjct  135  LTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHADDLKTLISAAIT  189



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  417
            C GTL+P LC S L++  P   + +  ++  + +N T  EV  + ANC+ ++  L   L 
Sbjct  87   CNGTLFPNLCFSKLSS-FPQLASLSPEKLAGSALNFTTREVLLAYANCTNLKTHLYCGLN  145

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            P ++ ALDDCLEL  ++  EL+  + DL  + S+++H  DL T  SAAMT
Sbjct  146  PTDRHALDDCLELLDDSIAELKASILDLGPSQSAARHSHDLLTLVSAAMT  195



>gb|AFK37116.1| unknown [Lotus japonicus]
Length=206

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP----EIIAATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP LC ++L      + A++I     ++    +NVT+   K+++A  S + +K 
Sbjct  45   SCSSTTYPRLCFASLV-----KHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKK-  98

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              + P E  A+ DC+E+ S++ DELR+ +++L    +S+      D+QT+ SAA+T
Sbjct  99   QGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALT  154



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP-  408
            +C  TLYP+LC S +AT +P       T  ++I  ++N+T   V+    N   I++ L  
Sbjct  68   SCSSTLYPDLCYSAIAT-VPGAADNLSTQKDVIEISLNITTTAVEH---NYFTIKKLLAH  123

Query  409  -RLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
             +L   EK AL DCLE+  ET DEL +   DL       S  +H  DL+   SAAMT
Sbjct  124  EKLTEREKTALHDCLEMVDETLDELHETAEDLKQYPNKKSLDEHAEDLKILLSAAMT  180



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYPELC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  124

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+T
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAIT  176



>ref|XP_009112019.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY16779.1| BnaA09g06030D [Brassica napus]
Length=199

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T YP LCV++L+T       +T P+++A A +N+T+   KA++     +     +L
Sbjct  42   SCTVTTYPRLCVASLST--HASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSS-SQL  98

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMT  567
             P E  A+  C+E   +T DELRK + ++   + SS   +  D+QT+ SAA+T
Sbjct  99   KPREVSAMRVCVEELGDTLDELRKSIGEMGQLSGSSYEVYMSDIQTWVSAALT  151



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  411
            C  TLYP++C S ++ +     + K+  ++I  ++N+TV   KA   N   +++   L  
Sbjct  78   CSSTLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITV---KAVEENYFRVKKLCGLKN  134

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            +   EK AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+T
Sbjct  135  ISHREKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAIT  189



>gb|KDP25618.1| hypothetical protein JCGZ_20774 [Jatropha curcas]
Length=205

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 6/114 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGI-RRKLPR  411
            +C  T YPELC S+L+     R+ +  P+ +A   +NVT+   K+++     +   KL  
Sbjct  40   SCSNTTYPELCYSSLSCYA--RKIQRNPKTLAYVALNVTLTATKSASEFIKTLYNNKLHG  97

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
            L P E  A+ DC+EL  E  DEL + +  +     S+   V  D+QT+ SAA+T
Sbjct  98   LKPKEAAAMADCVELADEAVDELERSIGKMGRARGSNSDPVINDIQTWVSAALT  151



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  408
            +C  TLYPELC STLA   P+  ++  +  + I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDXIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS---SKHYVDLQTFFSAAMT  567
            +L   EK AL DCLE   ET DEL   + DL    +    ++H  DL+T  S+A+T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAIT  184



>ref|XP_010932336.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=577

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 58/116 (50%), Gaps = 10/116 (9%)
 Frame = +1

Query  226  AHTEACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRR  399
            A   ACE TLYP  C S LA+    P + AK + ++        V  V++ A N +   R
Sbjct  82   AIASACEATLYPNACESALASIAGAPTKSAKDLFDVSVQFAMGRVHSVRSMAYNLTLKHR  141

Query  400  KLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            +L   G      +DDCLEL   T D+L  V +      SSS H  D++T+ SAA+T
Sbjct  142  QL---GSGRPSGMDDCLELLDITLDQLNDVAN---PKKSSSPH--DIKTWLSAALT  189



>ref|XP_006369078.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
 gb|ERP65647.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
Length=349

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = +1

Query  193  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  357
            +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T  
Sbjct  48   VNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLKDVIELSINLTTK  106

Query  358  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLAT--TASSSKHY  531
             V+ +      +  K  +L   EK AL DCLE   ET DEL + L D+       S K  
Sbjct  107  TVQQNYFTVEKLIAK-TKLTKREKTALHDCLETIDETLDELHEALVDINGYPDKKSLKEQ  165

Query  532  VD-LQTFFSAAMT  567
             D L+T  S+A+T
Sbjct  166  ADNLKTLLSSAIT  178



>ref|XP_009767669.1| PREDICTED: 21 kDa protein [Nicotiana sylvestris]
Length=210

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 65/116 (56%), Gaps = 8/116 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S +  K+  L 
Sbjct  41   SCKATLYPVLCVQCL-SAYANTVKQSEQQLARAALSVSLSKAKSTTIFVSKL-TKIRGLK  98

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK------HYVDLQTFFSAAMT  567
            P EK+A+ DC +  S++ D++ K + +L  T   +       H  ++QT+ SAAMT
Sbjct  99   PREKQAVKDCFDTMSDSVDQINKSIPELGQTGHFAAGQDFMWHVSNVQTWVSAAMT  154



>ref|XP_010035021.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46288.1| hypothetical protein EUGRSUZ_K00155 [Eucalyptus grandis]
Length=200

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 68/117 (58%), Gaps = 13/117 (11%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPR-  411
            +C  T YP LC ++L++       +T P+++ +T +NVT+++ ++++A    +  +L R 
Sbjct  42   SCSKTTYPRLCYTSLSS--HANLIQTSPKLLTSTALNVTLNKARSTSA----MMVRLSRA  95

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV---DLQTFFSAAMT  567
              + P E  A+ DC+E  S T DELR+ + ++     SS   +   D+QT+ SAA+T
Sbjct  96   HGMKPREVGAMQDCVEELSSTVDELRRSIHEMGQIKRSSNFGLIMNDVQTWVSAALT  152



>ref|XP_003627459.1| Pectinesterase [Medicago truncatula]
Length=391

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC  TLYPELC S +++  P+   K     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL++  +DL    S     +H  DL+T  S+A+T
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAIT  183



>ref|XP_011010937.1| PREDICTED: 21 kDa protein-like isoform X2 [Populus euphratica]
Length=190

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T+YP+LC ++L  ++     +T P+++A A +NVT+   K+++A  S + ++   L
Sbjct  25   SCSTTIYPKLCYASL--SIHSSTIQTSPKLLANAALNVTLSSAKSTSAKMSTLSQR-HGL  81

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P E  A++DC+E  S+   EL+  + +++    S+   +  D+QT+ SAA+T
Sbjct  82   KPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQTWVSAALT  134



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C GTL+ E+C STLA+ +P+   K + ++I+  V      V+AS++NCS   R+   L  
Sbjct  90   CAGTLHREVCASTLAS-IPNLARKPLRDVISDVVARAAAAVRASSSNCSSYLRRPRGLRV  148

Query  421  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMT  567
             ++ AL DCLELF  T  +L     +L A   ++ +    +QT  SAA+T
Sbjct  149  RDRLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAGVQTVLSAALT  198



>ref|XP_011010936.1| PREDICTED: 21 kDa protein-like isoform X1 [Populus euphratica]
Length=197

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  414
            +C  T+YP+LC ++L  ++     +T P+++A A +NVT+   K+++A  S + ++   L
Sbjct  40   SCSTTIYPKLCYASL--SIHSSTIQTSPKLLANAALNVTLSSAKSTSAKMSTLSQR-HGL  96

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P E  A++DC+E  S+   EL+  + +++    S+   +  D+QT+ SAA+T
Sbjct  97   KPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQTWVSAALT  149



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            +C  TL+ +LC ST+A  +P+  ++     ++I  ++N+T   V+ +      + +    
Sbjct  76   SCSITLHQQLCYSTIANNIPNFSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLIKTRKG  135

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            L   EK AL DCLE   ET DEL   + DL    ++    +H  DL+T  SAA+T
Sbjct  136  LTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKALRQHADDLKTLISAAIT  190



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = +1

Query  232  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            T +C  T +P+LC S+LA+A       T  ++I A++NVT   V  + A  +        
Sbjct  44   TSSCSNTRHPDLCFSSLASAPVHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTD  103

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            L P  + AL DC+E  S + DEL   L++L       S ++H  DL+T  SAA T
Sbjct  104  LTPRSRSALKDCVETMSTSLDELHVALAELDEYPNKKSITRHADDLKTLLSAATT  158



>gb|ABK22631.1| unknown [Picea sitchensis]
 gb|ACN40721.1| unknown [Picea sitchensis]
Length=204

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYP+LCVS+L++     +A T   ++   + V++   +  +   +G++ +   + 
Sbjct  42   SCNVTLYPQLCVSSLSSYAGSLKA-TQSNLVNVALQVSLVTARNVSVWAAGMKSRRALMS  100

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMT  567
              E+ AL DC+E F +T D++R+ L++L     ++  +   +++T+ SAA+T
Sbjct  101  RRERAALGDCIEDFGDTADQIRQSLAELKKLRRNTFKFQMSNVETWMSAALT  152



>ref|XP_003521571.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=197

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +1

Query  235  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  411
            +AC  T +  LCV TL      R A T P   A A V+V++ EVK   A  + ++R+   
Sbjct  35   DACSVTRFQSLCVQTLGHF--SRTAGTSPSKWARAGVSVSIGEVKNVEAYLAQVKRQ---  89

Query  412  LGPLEKR---ALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMT  567
             G L+ R   AL DC+E F    DEL K L  L + + S  S    DL T+ SAA+T
Sbjct  90   -GQLKGRNSVALSDCVETFGYAIDELHKSLGVLRSLSKSKFSTQMGDLNTWISAALT  145



>ref|XP_007204488.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
 gb|EMJ05687.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
Length=530

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 7/119 (6%)
 Frame = +1

Query  220  QVAH---TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  390
            Q+ H     AC   L+P LC + LA+A           ++ A +N TV  V+++  +  G
Sbjct  16   QIPHPTIKNACTTLLHPSLCFTALASAKTHDHFTAFHHLLEANINQTVASVESTRQSIKG  75

Query  391  IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            +  KL  L   E+ AL DCLE+  +T  EL + + DL     S   Y +L+T  SAAMT
Sbjct  76   L-LKLQDLYLQERNALKDCLEMLDQTLYELGQAVDDLHGFRVS---YGNLKTLLSAAMT  130



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 61/115 (53%), Gaps = 9/115 (8%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  411
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  75   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  131

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+T
Sbjct  132  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAIT  186



>ref|XP_002264167.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRL  414
            AC  T YP+LC ++LA        +T P+++A+T ++VT+   ++++++ S + ++   L
Sbjct  43   ACGTTTYPQLCFTSLAAHAS--VIQTNPKLLASTALSVTLATARSTSSDMSTLLKR-HGL  99

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             P E  A+ DC+E  S++ D+L+K + +++   SS+   +  D+QT+ SAA+T
Sbjct  100  TPREVSAMRDCVEELSDSVDQLKKSMGEMSQIKSSNFGLMINDIQTWVSAALT  152



>gb|EYU25806.1| hypothetical protein MIMGU_mgv1a003215mg [Erythranthe guttata]
Length=599

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 82/180 (46%), Gaps = 36/180 (20%)
 Frame = +1

Query  94   IVLLAFLSVTS-FNSLFTKDGISSSTGPTHLDLNLNIHRQK---------LLQVAHTEAC  243
            I L+AFL+V + F SLF    I+SS          N HR++          LQ    ++C
Sbjct  18   IKLVAFLAVAAVFISLFL---INSS----------NHHRRRRPLPTTPPSPLQSFIKKSC  64

Query  244  EGTLYPELCVSTLATALP----DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
              TLYP LC +TL+  +P    +  + T   I+   +N T   VK +    S    K   
Sbjct  65   SETLYPSLCHTTLSPLIPTSMNNNNSTTFQNILQFAINRTAGHVKNTQTRISA-NFKTQD  123

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASS--------SKHYVDLQTFFSAAMT  567
            L   EK AL DC+E+  +T  EL + L  L   +S          + Y +++T  SAAMT
Sbjct  124  LTSPEKNALKDCMEMLDQTLYELEQALIQLGGGSSPPPTTGYNLRRSYGNIKTLLSAAMT  183



>ref|XP_004240754.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=192

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRL  414
            +C+ T YP++CV++L+   P    K  P+ +A T ++V++D  +++    + +  K   L
Sbjct  33   SCKITTYPQVCVTSLSVYAPT--IKRSPQQLAQTALSVSLDRAQSAHTFITKLN-KFKGL  89

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASS-----SKHYVDLQTFFSAAMT  567
               E  AL DCLE  SET D + K + +L    SS       H  ++QT+ SAA+T
Sbjct  90   KSREYAALKDCLEEMSETVDRINKSVKELTRMGSSRGKDVQWHMSNIQTWMSAAIT  145



>ref|XP_008380988.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Malus domestica]
Length=613

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 83/173 (48%), Gaps = 16/173 (9%)
 Frame = +1

Query  49   KQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVA  228
            K K  L F +    A+ L+   +V++   +  K   S+    + L       R+K  Q A
Sbjct  41   KNKLILMFLL----AVALILASAVSAVVLIVGKSKASNPAASSAL-------RRKPTQ-A  88

Query  229  HTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  408
             + AC  T +P LCV +L    P   A +  +++  + N+T+  +  +    S +  +  
Sbjct  89   ISNACAKTRFPSLCVDSLLD-FPGSNAASEQDLVHISFNMTLQRLSKALYLSSSLSYR--  145

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  567
            ++ P  + A DDCLEL  ++ D L + L+ +A    SS    D++T+ SAA+T
Sbjct  146  QMDPHSRSAYDDCLELLDDSVDALSRALTSVAPGVESSSTQ-DVRTWLSAALT  197



>ref|XP_010454384.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 14/120 (12%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIP---EIIAATVNVTVDEVKASAANCSGIRRKLP  408
            +CE   YP LCV TL++        TI    ++  A V +++   +++A   + +R  + 
Sbjct  38   SCEHASYPSLCVRTLSS----YSGPTITNSRDLAQAAVKISLSHAQSAAKKLAAVRDSVG  93

Query  409  RLGPLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY----VDLQTFFSAAMT  567
            +   LEK AL DC+E+  ++ DEL +   VL  L  +  S+K +     + QT+ SAA+T
Sbjct  94   KKKKLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEFRWQMSNAQTWASAALT  153



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 61/116 (53%), Gaps = 6/116 (5%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC  T+Y +LCVS ++TA  +  +   +  ++I A++N+T   V+ +      + +    
Sbjct  69   ACSSTIYRDLCVSAVSTAAAVTGQELTSQRDVIEASLNITKIAVEHNYFTVKKLLKNRKG  128

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMT  567
            L   EK AL DCLE   ET DE+ + + DL    +  K    H  DL+T  S+A+T
Sbjct  129  LTEREKTALHDCLETIDETLDEIHEAVEDLNGYPNEKKSLRQHADDLKTLISSAIT  184



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 72/117 (62%), Gaps = 12/117 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTL---ATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRR-K  402
            +C  T+YP+LC STL   A+A+     +T P+++A T ++V++   ++S+A  S + + +
Sbjct  51   SCGTTMYPKLCFSTLSGYASAI-----QTDPKLLADTALSVSLTNARSSSAMISELSKSQ  105

Query  403  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMT  567
            L  + P E  A+ DC+E+  ++ DEL+K +++++        +   ++QT+ SAA+T
Sbjct  106  LATMKPREAAAMRDCVEMVGDSVDELQKSMAEMSHLGGPDLGFQISNIQTWVSAALT  162



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYP+LC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  76   CSSTLYPDLCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  134

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+T
Sbjct  135  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAIT  186



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  408
            +C  TLYP+LC STLA   P+  ++  +  ++I  ++N+T   V+        + + +  
Sbjct  70   SCSSTLYPDLCFSTLALH-PEASKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKN  128

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            +L   EK AL DCLE   ET DEL + + DL    ++    +H  DL+T  S+A+T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHEAVEDLHEYPNNKTLVQHADDLKTLLSSAIT  184



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  408
            +C  TLYP+LC STLA   P+  ++  +  ++I  ++N+T   V+        + + +  
Sbjct  70   SCSSTLYPDLCFSTLALH-PEASKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKN  128

Query  409  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
            +L   EK AL DCLE   ET DEL + + DL    ++    +H  DL+T  S+A+T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHEAVEDLHEYPNNKTLVQHADDLKTLJSSAIT  184



>ref|XP_010493188.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 61/117 (52%), Gaps = 8/117 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +CE   YP LCV TL++           ++  A V +++   +++A   + +R  + +  
Sbjct  38   SCEHASYPSLCVRTLSS-YSGPTINNSRDLAQAAVRISLSHAQSAAKKLAAVRDSVGKKK  96

Query  418  PLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY----VDLQTFFSAAMT  567
             LEK AL DC+E+  ++ DEL +   VL  L  +  S+K +     + QT+ SAA+T
Sbjct  97   KLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEFRWQMSNAQTWASAALT  153



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 61/115 (53%), Gaps = 9/115 (8%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  411
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  72   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  128

Query  412  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+T
Sbjct  129  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAIT  183



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLAT-ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  414
            AC    Y +LCVS ++T AL      +  ++I A++N+T   V+ +      +  K   L
Sbjct  63   ACSSARYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLLEKRKGL  122

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
               EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+T
Sbjct  123  TKREKTALHDCLETIDETLDELHEAMDDLNEYPDKKSLRQHADDLKTLISSAIT  176



>ref|XP_007218426.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
 gb|EMJ19625.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
Length=203

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 69/119 (58%), Gaps = 18/119 (15%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP+LC+++L++      A TI   P+++A A +NVT+   K+++A    +  KL
Sbjct  46   SCSATTYPKLCLTSLSS-----HASTIQTSPKLMAGAALNVTLSSAKSTSA----VMLKL  96

Query  406  PR---LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             +   L P E  A+ DCLE  S++ DEL+  ++++    S     +  D+QT+ SAA+T
Sbjct  97   SQSHGLKPKEVGAMRDCLEELSDSVDELQSSIAEMGNFKSYDFQLMISDVQTWVSAALT  155



>ref|XP_010096537.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB64657.1| Pectinesterase 3 [Morus notabilis]
Length=362

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 60/118 (51%), Gaps = 11/118 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  408
            AC  T YP+LC S +A +      ++   + ++I  +VN+T+  V+    N   I++   
Sbjct  68   ACSSTRYPDLCYSAVAASASSGGSKKVSNLKDVIGLSVNITITAVQE---NYFSIKKLTK  124

Query  409  RLG--PLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMT  567
            R G    EK AL DCLE   ET DEL +V  DL     T S  +H  D  T  S+A+T
Sbjct  125  RKGLTKREKTALHDCLETIDETLDELHEVQDDLEQYPNTKSLKQHADDFLTLLSSAIT  182



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V+ +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLT  132

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK---HYV-DLQTFFSAAMT  567
              EK AL DCLE   ET DEL   ++DL    +  K    Y  DL+T  S+A+T
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAIT  186



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V  +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLT  132

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK---HYV-DLQTFFSAAMT  567
              EK AL DCLE   ET DEL   ++DL    + +K    Y  DL+T  S+A+T
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAIT  186



>gb|ACN40878.1| unknown [Picea sitchensis]
Length=655

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCS-GIRRKLPRL  414
            AC  TLYP+LC+STL T     + +   ++   T+NVT+D V+ +    S  I     ++
Sbjct  89   ACRKTLYPQLCMSTLVTYQGGAQLREPKDLAHITLNVTMDRVQQAYQVISVNISAHDGKM  148

Query  415  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMT  567
            G  E  A +DC+EL  +T   L      +   + + K    H  D+ T+ SAA+T
Sbjct  149  GHRELVAYEDCVELLQDTIYHLSASSVKMQAMSKNPKSIKAHIADVNTWLSAALT  203



>gb|KJB70037.1| hypothetical protein B456_011G055100 [Gossypium raimondii]
Length=579

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 61/115 (53%), Gaps = 9/115 (8%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            AC  T YP+LC S +A A   +  +   ++I  ++N+T   V+    N   I++ L R G
Sbjct  68   ACSSTFYPDLCFSAVAAAAAKKVTRK-KDVIRLSLNITASAVEH---NFYKIKKLLARKG  123

Query  418  PLEKR--ALDDCLELFSETRDELRKVLSDLATTASS---SKHYVDLQTFFSAAMT  567
              E+   AL DCLE  +ET DEL + + DL         ++H  DL+T  SAAMT
Sbjct  124  LTERGVTALHDCLETINETLDELHQAVEDLHGYPYKKPLTQHADDLKTLISAAMT  178



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 90/187 (48%), Gaps = 30/187 (16%)
 Frame = +1

Query  40   HN-LKQKATLFFTISGCSAIVLLA-FLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  213
            HN LK K  +F ++   S+I+L+A  +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRVFLSL--FSSILLVAAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  214  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  378
              QVA+T    +C  TLYP LC S++ +A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAYTILKSSCSSTLYPHLCFSSI-SAVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  379  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQT  546
                +          E  AL DCL + +ET D+L K   +L    S  K    H  DL+ 
Sbjct  108  KIQKLTFTRRSFTERENTALHDCLVMLNETLDQLSKAYQELQDYPSLKKSLSVHADDLKI  167

Query  547  FFSAAMT  567
              SA MT
Sbjct  168  LLSATMT  174



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  411
            AC  TLYPELC S +++  P+   K     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  412  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMT  567
              L   EK AL DCLE   ET DEL++  +DL    S     +H  DL+T  S+A+T
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAIT  183



>ref|XP_010049073.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Eucalyptus grandis]
Length=589

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 5/116 (4%)
 Frame = +1

Query  226  AHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  405
            A +  C  T YP LC+  LA A PD    +  +++  + NVT+     +    S I    
Sbjct  73   AISRTCGLTRYPALCLDALA-AFPDAEGASQQDLVHISFNVTLQRFSKALYVSSTIGHL-  130

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
             ++ P  + A DDCLEL  +  D LR+ L+ +    + S  +   D+ T+ SAAMT
Sbjct  131  -QMEPRVRSAFDDCLELLDDAVDALRRSLNYVTPGGAKSASWSAQDVVTWLSAAMT  185



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  420
            C  TLYP+LC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  76   CSSTLYPDLCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  134

Query  421  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             E  AL DCLE+  ET D L   + DL       S  KH  DL+T  S+A+T
Sbjct  135  REVTALHDCLEMIDETLDGLHVAVEDLHQYPKQKSLRKHADDLKTLISSAIT  186



>ref|XP_004307822.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=203

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 69/116 (59%), Gaps = 12/116 (10%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIA-ATVNVTVDEVKASAANCSGIRRKL  405
            +C  T YP+LC+++L++     +A  I   P++IA A +NVT+   K+++A    +    
Sbjct  46   SCGATTYPKLCLASLSS-----QASVIQRSPKLIACAALNVTLSSAKSTSAMMLRLSHGY  100

Query  406  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMT  567
              + P E  A+ DC+E+ S++ DE+++ +S++    S+    +  D+QT+ SAA+T
Sbjct  101  G-MKPREAAAMRDCVEMVSDSVDEIQRSISEMVNFRSAGFEMMISDVQTWVSAALT  155



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 12/116 (10%)
 Frame = +1

Query  241  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  417
            C  T YPELC S +A+    ++  +  ++I A++N+T + VK    N   +++ +  R G
Sbjct  66   CTSTRYPELCFSAVAST--GKKLTSHKDVIEASLNLTTNVVKH---NYFAVKKLITKRKG  120

Query  418  PLEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMT  567
             L  R   AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+T
Sbjct  121  GLRAREATALHDCLETIDETLDELHVAVEDLHQYPKGKSLRKHADDLKTLISSAIT  176



>ref|XP_009610995.1| PREDICTED: 21 kDa protein [Nicotiana tomentosiformis]
Length=211

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +1

Query  238  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  417
            +C+ TLYP LCV  L +A  +   ++  ++    ++V++   K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAYANTVKQSEQQLARVALSVSLSRAKSTTIFVSKLTR-VRGLK  99

Query  418  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK------HYVDLQTFFSAAMT  567
            P EK+A+ DC +  S++ D++ K + +L  T   +       H  ++QT+ SAAMT
Sbjct  100  PREKQAVKDCFDTMSDSVDQINKSIPELGQTGHFAAGQDFMWHVSNVQTWVSAAMT  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960