BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027H07

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            146   2e-37   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       144   1e-36   Nicotiana tomentosiformis
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     137   3e-34   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    137   3e-34   Eucalyptus grandis [rose gum]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   1e-33   Solanum tuberosum [potatoes]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             133   1e-32   Populus trichocarpa [western balsam poplar]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  132   2e-32   Cucumis sativus [cucumbers]
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   3e-32   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   3e-32   Populus euphratica
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      130   9e-32   Gossypium arboreum [tree cotton]
gb|KJB65824.1|  hypothetical protein B456_010G114900                    130   1e-31   Gossypium raimondii
gb|KJB82811.1|  hypothetical protein B456_013G215000                    130   1e-31   Gossypium raimondii
emb|CBI21043.3|  unnamed protein product                                129   2e-31   Vitis vinifera
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   2e-31   Vitis vinifera
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    129   3e-31   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      128   5e-31   Gossypium arboreum [tree cotton]
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             128   5e-31   Phaseolus vulgaris [French bean]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   7e-31   Sesamum indicum [beniseed]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    127   1e-30   Glycine max [soybeans]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             127   2e-30   Citrus clementina [clementine]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            126   2e-30   Glycine soja [wild soybean]
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             126   2e-30   
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         125   4e-30   Jatropha curcas
gb|KJB65823.1|  hypothetical protein B456_010G114900                    125   5e-30   Gossypium raimondii
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       125   8e-30   
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   1e-29   Populus euphratica
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                124   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_002308665.2|  grr1 family protein                                124   2e-29   
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   2e-29   
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   3e-29   Citrus sinensis [apfelsine]
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   3e-29   Populus euphratica
gb|KJB55011.1|  hypothetical protein B456_009G058000                    123   5e-29   Gossypium raimondii
ref|XP_002524506.1|  grr1, plant, putative                              120   3e-28   Ricinus communis
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   5e-28   Fragaria vesca subsp. vesca
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            118   2e-27   Cucumis melo [Oriental melon]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   3e-27   Cucumis sativus [cucumbers]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   4e-27   
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            116   9e-27   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     117   9e-27   Vitis vinifera
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   1e-26   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   1e-26   Populus euphratica
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   2e-26   Cicer arietinum [garbanzo]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    115   2e-26   Glycine max [soybeans]
ref|XP_003588766.1|  Ein3-binding f-box protein                         115   3e-26   Medicago truncatula
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       114   5e-26   Vitis vinifera
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    114   6e-26   
ref|XP_002515516.1|  grr1, plant, putative                              114   8e-26   Ricinus communis
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   9e-26   Cucumis sativus [cucumbers]
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   2e-25   Cucumis melo [Oriental melon]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             113   2e-25   Prunus persica
emb|CBI28209.3|  unnamed protein product                                112   2e-25   Vitis vinifera
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   3e-25   
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             112   4e-25   
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            111   5e-25   Camelina sativa [gold-of-pleasure]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    111   5e-25   Gossypium raimondii
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_002880682.1|  ein3-binding F box protein 1                       111   7e-25   
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    110   1e-24   Prunus mume [ume]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             110   1e-24   Capsella rubella
ref|NP_565597.1|  EIN3-binding F-box protein 1                          110   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      109   2e-24   Gossypium arboreum [tree cotton]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         109   3e-24   Jatropha curcas
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   3e-24   
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       109   4e-24   
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            109   4e-24   Camelina sativa [gold-of-pleasure]
gb|KJB54023.1|  hypothetical protein B456_009G017100                    108   5e-24   Gossypium raimondii
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             108   7e-24   Phaseolus vulgaris [French bean]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       108   9e-24   
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             108   9e-24   Phaseolus vulgaris [French bean]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    107   1e-23   Arabis alpina [alpine rockcress]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   2e-23   
gb|KHN07078.1|  EIN3-binding F-box protein 1                            107   2e-23   Glycine soja [wild soybean]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            107   2e-23   Sesamum indicum [beniseed]
gb|AFT92041.1|  EIN3 binding F-box 1                                    107   3e-23   Malus domestica [apple tree]
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    106   3e-23   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    106   3e-23   
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       105   8e-23   
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             103   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   8e-22   Solanum tuberosum [potatoes]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   1e-21   Glycine max [soybeans]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          102   1e-21   Amborella trichopoda
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   1e-21   Glycine max [soybeans]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             100   4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   5e-21   Solanum lycopersicum
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   5e-21   Cicer arietinum [garbanzo]
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           99.8    7e-21   Phaseolus vulgaris [French bean]
ref|XP_010086585.1|  hypothetical protein L484_002248                 97.8    4e-20   Morus notabilis
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like     97.1    8e-20   Brassica rapa
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg           96.3    1e-19   Capsella rubella
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg              96.3    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.3    1e-19   Sesamum indicum [beniseed]
emb|CDY19807.1|  BnaA09g04600D                                        96.3    1e-19   Brassica napus [oilseed rape]
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    2e-19   Nicotiana tomentosiformis
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...  96.3    2e-19   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...  96.3    2e-19   
gb|EPS63879.1|  f-box family protein                                  95.9    2e-19   Genlisea aurea
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.1    4e-19   Nicotiana sylvestris
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like     94.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like     93.6    1e-18   Glycine max [soybeans]
emb|CDX76980.1|  BnaC04g37750D                                        93.2    2e-18   
ref|NP_001234858.1|  EIN3-binding F-box protein 1                     92.8    2e-18   Solanum lycopersicum
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          92.8    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     92.4    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.0    4e-18   Phoenix dactylifera
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.0    4e-18   Elaeis guineensis
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.0    4e-18   Solanum tuberosum [potatoes]
emb|CDY35358.1|  BnaA04g14890D                                        91.7    5e-18   Brassica napus [oilseed rape]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          91.7    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.7    5e-18   Elaeis guineensis
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          91.7    5e-18   Brassica rapa
emb|CDP10419.1|  unnamed protein product                              91.7    6e-18   Coffea canephora [robusta coffee]
emb|CDX87090.1|  BnaC09g04050D                                        91.3    7e-18   
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg           90.9    1e-17   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                   90.1    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.1    2e-17   Eucalyptus grandis [rose gum]
gb|AES73649.2|  EIN3-binding F-box-like protein                       89.4    3e-17   Medicago truncatula
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    89.4    3e-17   Gossypium arboreum [tree cotton]
ref|XP_003603398.1|  Ein3-binding f-box protein                       89.4    3e-17   
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     89.4    4e-17   Nicotiana tomentosiformis
emb|CAN83761.1|  hypothetical protein VITISV_043743                   88.6    6e-17   Vitis vinifera
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    8e-17   Cucumis sativus [cucumbers]
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    9e-17   Phoenix dactylifera
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874252.1|  ein3-binding F box protein 2                     87.4    1e-16   
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.4    2e-16   
gb|KJB07737.1|  hypothetical protein B456_001G042600                  87.0    2e-16   Gossypium raimondii
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     87.0    2e-16   Nicotiana sylvestris
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     86.7    3e-16   Cucumis melo [Oriental melon]
gb|ACB59221.1|  F-box protein                                         86.3    3e-16   Brassica oleracea
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     86.3    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     85.5    7e-16   Fragaria vesca subsp. vesca
emb|CDP13515.1|  unnamed protein product                              80.9    8e-16   Coffea canephora [robusta coffee]
gb|AFU61111.1|  F-box protein                                         85.1    1e-15   Capsicum annuum
gb|KEH32122.1|  EIN3-binding F-box-like protein                       85.1    1e-15   Medicago truncatula
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     84.7    1e-15   
emb|CDX88173.1|  BnaA06g27640D                                        84.0    2e-15   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          84.0    2e-15   Brassica rapa
ref|NP_197917.1|  EIN3-binding F-box protein 2                        83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.8    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 82.8    6e-15   Citrus sinensis [apfelsine]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           82.8    6e-15   
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.4    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     82.4    8e-15   
dbj|BAH20224.1|  AT2G25490                                            81.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KJB07621.1|  hypothetical protein B456_001G033400                  81.3    2e-14   Gossypium raimondii
gb|KEH32121.1|  EIN3-binding F-box-like protein                       81.3    2e-14   Medicago truncatula
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     80.9    2e-14   Camelina sativa [gold-of-pleasure]
emb|CDX80503.1|  BnaC07g29410D                                        80.9    3e-14   
ref|XP_003609344.1|  Ein3-binding f-box protein                       80.5    4e-14   
gb|AES91540.2|  EIN3-binding F-box-like protein                       79.3    8e-14   Medicago truncatula
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              78.2    2e-13   Erythranthe guttata [common monkey flower]
gb|ABK25485.1|  unknown                                               77.8    2e-13   Picea sitchensis
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     77.4    4e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003609343.1|  Ein3-binding f-box protein                       76.3    1e-12   
gb|AEK81539.1|  EIN3 binding F-box 1                                  74.7    3e-12   Dianthus caryophyllus [carnation]
gb|EPS63568.1|  ein3-binding f-box protein 3                          73.6    6e-12   Genlisea aurea
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     66.6    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237471.1|  grr1 protein                                     62.8    2e-08   
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.4    4e-08   Tarenaya hassleriana [spider flower]
dbj|BAD15849.1|  putative F-box protein                               60.5    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     58.9    4e-07   Brachypodium distachyon [annual false brome]
gb|EMT19526.1|  hypothetical protein F775_07091                       58.9    5e-07   
gb|EAY84905.1|  hypothetical protein OsI_06273                        58.2    7e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88579.1|  predicted protein                                    57.8    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     57.8    1e-06   Setaria italica
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          56.2    3e-06   Brachypodium distachyon [annual false brome]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  54.3    2e-05   
ref|NP_001147557.1|  LOC100281166                                     51.6    1e-04   Zea mays [maize]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     50.8    2e-04   Oryza brachyantha
gb|EAZ01599.1|  hypothetical protein OsI_23635                        50.4    2e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAD35544.1|  putative F-box protein Fbl2                          50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        49.7    5e-04   



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   146 bits (369),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG + F PGG +YPS K+S  FLSL   VD YFPPCKR+RV  P++  E  + 
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTE--KQ  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK P+I+VLPDECLFEV RRV DGKERSACAC S RWLMLLSS+
Sbjct  59   KKLPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSI  102



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   144 bits (362),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG   F PG  +YPS K+S  FLSL   VD YFPPCKR+R+  P++  E  + 
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTE--KQ  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK P+I+VLPDECLFEVFRRV DGKERSACAC S RWLMLLSS+
Sbjct  59   KKLPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSI  102



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   137 bits (345),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC S RWLMLLS++
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNI  105



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   137 bits (345),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC S RWLMLLS++
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNI  105



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   135 bits (341),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG + F+ GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTE--KK  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K  +I+VLPDECLFEV RR+ DGKERSA AC S RWLMLLSS+
Sbjct  59   QKLSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSI  102



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC S RWL+LLSS+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSI  105



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   132 bits (331),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K   +IE+LPDECLFE+FRR+ DGKERSACA  S RWLMLLS++
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNI  105



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   132 bits (331),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC S RWL+LLSS+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSI  105



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   132 bits (331),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC S RWL+LLSS+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSI  105



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   130 bits (327),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG ++F PGG +YP+ K+S  F   +P  D YFPPCKR RV +P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFF--YPNQDVYFPPCKRCRVSSPFVFAGGKFE  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP+IE+LPDECLFE+FRR+  G+ERS CAC S RWL L+S++
Sbjct  59   QKKPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNI  102



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   130 bits (327),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC S RWL L+S++
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNI  102



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   130 bits (326),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG + FFPGG +YP+ K+S  F SL   VD YFP  KR+R+  P+V       
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK P+IE+LPDECLFE+FRR+  G+ERS+CAC S RWL L+S++
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNI  104



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   129 bits (324),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC S RWLMLLSS+
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSI  105



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   129 bits (325),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC S RWLMLLSS+
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSI  105



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K   +IE+LPDECLFE+FRR+  GKERSACA  S RWLMLLS++
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNI  105



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   128 bits (322),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG ++F PGG MYP+ K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC S RWL ++S++
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNI  104



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   128 bits (322),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+  FSG ++F PGG +Y + K++  FL L P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K+K +IE LPDECLFE+FRR+  G++RSACAC S RWLMLLSS+
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSI  105



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   128 bits (322),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F+F G ++F PGG +Y + K++G FL L   VD YFPP KR+R+  P V   G+  
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVV-SGV-A  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K++P+IE+LPDECLFEVFRR+  G ERSACAC S RWLMLLSS+
Sbjct  59   KQQPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSI  102



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+  FSG ++F P G +Y + K++  FLSL P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K+K +IE LPDECLFE+FRR+  G++RSACAC S RWLMLLSS+
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSI  105



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   127 bits (318),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+FRR+  G+ERSACAC S RWL LLS++
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNI  104



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+  FSG ++F P G +Y + K++  FL L P+VD YFPP KR+RV TP V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K K ++E LPDECLFE+FRR+  G++RSACAC S RWLMLLSS+
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSI  105



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +E + GG +Y +S D G   S+  RVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+IEVLPDECLFE+FRRV +GKERS+CAC S +WLMLLSS+
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSI  105



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   125 bits (315),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            MSK+F F+G ++F PGGP+Y + K++   LSL   VD YFP  KR+R+  P V+  E  E
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC S RWL LLS++
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNM  105



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC S RWL L+S++
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNI  102



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   125 bits (314),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 74/104 (71%), Gaps = 6/104 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG +    GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDH----GGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSE--KK  54

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K  +I+VLPDECLFEV RR+ DGK+RSA AC S RWLMLLSS+
Sbjct  55   HKLSSIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSI  98



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +E + GG  Y +S D G   S+ PRVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
               +P+IEVLPDECLFE+FRRV +GKERS+CAC S +WLMLLSS+
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSI  105



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS++ +FSG N F P   +Y + K+S  FLSL   V+ YF P KR+R+  P +     EP
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSG--EP  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K+KP+IE+LPDECLFEVFRR+  G+ERSACA  S RWLMLLSS+
Sbjct  59   KQKPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSI  102



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IE LPDECLFE+FRR+  G ER ACAC S RWL LLS++
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNI  105



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  412
            MSK+  F+G  +F+ G  +Y S K++  FLSL   VD YFPP KR+R+  P V  E L E
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K++ TIEVLPDECLFE+FRR+  G+ERSACAC S RWL LLS++
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNI  105



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+FRR+  G+ERSACA  S RWL LLS++
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNI  104



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G ER ACAC S  WL LLS++
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNI  105



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   123 bits (308),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+F FSG ++F PGG +Y + K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC S RWL ++S++
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNI  104



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +EF+ GG +  +  D G + S+   VD Y PPCKRAR+ +P +      E
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I+VLPDECLFE+FRR+  GKERSACAC S RWL LLSS+
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSI  105



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   120 bits (300),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+F F+G ++F PGG +Y + K++G FLSL  RVD Y+PP KR+R   P V   E  E
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+ +I+VLP+ECLFE+F+R+  G+ERSACAC S +WL LLS++
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNI  105



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   118 bits (296),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  236  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  409
            M+KIF F+     +FFP  P+YP+ KD+  FLSL P VD Y+P  KR+RV  P V    +
Sbjct  1    MAKIFGFTLKESEDFFPA-PIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEI  59

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KK+ +IEVLPDECLFE+F+R+ D + RS CAC S RWLMLLSS+
Sbjct  60   LKKKEASIEVLPDECLFEIFKRLPDRETRSLCACVSKRWLMLLSSI  105



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +2

Query  236  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  409
            M+KIF F+     +FFPG P+YP+ KD+  FLSL  +VD Y+P  KR+RV  P V   G 
Sbjct  1    MAKIFGFTLTESEDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVP-SGE  59

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KK+ +IEVLPDECLFE+F+R+ + + RS CAC S RWLMLLSS+
Sbjct  60   ILKKEASIEVLPDECLFEIFKRLPERETRSLCACVSKRWLMLLSSI  105



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   117 bits (294),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +2

Query  269  EFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLEPKKKPTIEVLP  445
            +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E K   +IE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  446  DECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            DECLFE+FRR+ DGKERSACA  S RWLMLLS++
Sbjct  63   DECLFEIFRRLSDGKERSACATVSKRWLMLLSNI  96



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   116 bits (291),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 4/107 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLH--PRVDGYFPPCKRARVGTPVV-ACEG  406
            MS+IF+FSG+ EF+ GG +Y + K++GSFLSL     VD YFP  KRAR+  P+V   E 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  407  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LE KK+ +++VLPDECL+E+ RR+   +ERS+CA  S RWLMLLSS+
Sbjct  60   LEQKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSI  106



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   117 bits (292),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  260  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIE  436
            G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E K++ +I+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  437  VLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            VLPDECLFE+ RR+ +G+E+SACAC S RWLMLLSS+
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSI  205



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KKP+I+VLPDECLFE+FRR++ GKERS+CA  S +WLMLLSS+
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSV  105



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+ TP +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+IEVLPDECLFE+FRRV +GKERS+CA  S +WLMLLSS+
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSI  105



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MS++F FSG N F P G +Y + K++  F SL  +VD YFPP KR+RV  P V   E   
Sbjct  1    MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K+K +IE LPDECLFE+FRR+  G+ERS+CAC S RWLMLLS++
Sbjct  60   QKQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNI  104



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLE  412
            MSK+F F+G+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K K +IE LPDECLFE+ RR+  G++RS CA  S RWLMLLSS+
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MS++F FSG N  F  G +Y + K++  FLSL P+VD Y+PP KR+RV  P V   E  E
Sbjct  1    MSQVFGFSGDN--FCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFE  58

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K+K +IE LPDECLFE+FRR+  G+ERSA AC S RWLMLLS++
Sbjct  59   QKQKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNI  103



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   115 bits (287),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V  C+  E
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +K+ +IEVLPDECLFE+FRR+  G+ERSACA  S RWL+LLSS+
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSI  105



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   114 bits (286),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +2

Query  230  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  406
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  407  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  S RWLMLLSS+
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSI  107



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   114 bits (286),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 8/108 (7%)
 Frame = +2

Query  227  PIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACE  403
            P P+S         +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E
Sbjct  55   PFPVSS-------EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGE  107

Query  404  GLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +E K   +IE+LPDECLFE+FRR+  GKERSACA  S RWLMLLS++
Sbjct  108  EVESKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNI  155



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   114 bits (284),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            MSK+  F+G ++F PGG +Y + K+ G FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERSACA  S RWL LLS+L
Sbjct  61   KKKQASIEVLPDECLFEIFRRL-PGEERSACAGVSKRWLGLLSNL  104



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   114 bits (284),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G+PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +  P+IE LPDECLFE+FR +H  +ERS+CA  S RWLMLLS++
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTI  105



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V   +  E
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK+ +IEVLPDECLFE+FRR+  G+ERS CAC S RWL LLSS+
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSI  105



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   113 bits (282),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +  P+IE LPDECLFE+FR +H  +ERS+CA  S RWLMLLS++
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTI  105



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   113 bits (282),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            MSK+  F+G+++F PGG +Y + K+   FLS     D +F P KR+R+  P V + EG E
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC S RWL LLS++
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNI  105



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +2

Query  230  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  406
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  407  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  S RWLMLLSS+
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSI  107



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K P+I VLPDECLFE+FRR+  GKERS+CA  S +WLML+SS+
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSI  105



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P       E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFE-  59

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK  + +VLPDECLFE+FRR+   +ERSACA  S  WL L+SS+
Sbjct  60   KKPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSI  103



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+  P +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
               +P+IEVLPDECLFE+FRRV +GKERS+CA  S +WLMLLSS+
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSI  105



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   111 bits (278),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K+ +I+VLPDECLFE+FRR+   +ERSACA  S  WL L+SS+
Sbjct  60   -KQVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSI  102



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   111 bits (278),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  412
            M  +  + G ++F+ GG  Y +S D G   S+  +VD Y+PP KRAR+  P V  E L E
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+ +I+VLPDECLFE+F+R+  G+ERS+CAC S  WLMLL S+
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISI  105



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   111 bits (278),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE  59

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  60   KKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  103



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   111 bits (278),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            M  +   SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K P+I VLPDECLFE+FRR+  GKERS+CA  S +WLMLLSS+
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSI  105



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G N+F+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V   G E 
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVF-SGFE-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK  +I+VLPDECLFE+FRR+   +ERSACA  S  WL L+SS+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSI  102



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC-EGLE  412
            M  +  + G ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KKP+I+ LPDECLFE+FRR++ GKERS+CA  S +WLMLLSS+
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSI  105



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV-GTPVVACEGLE  412
            MSK+    G+++F PGG +Y + K+   FLSL    D +F P KR+R+ GT V + EG E
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC S  WL LLS++
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNI  105



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V       
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  416  KKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +KKP +I+VLPDECLFE+FRR+   +ERSACA  S  WL L+SS+
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSI  102



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+IF F+G N+F+  G +YP+ KD+   LSL    D YFPP KR+RV  P +     E 
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK  +I+VLPDECLFE+FRR+   +ERSACA  S +WL L+SS+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSI  102



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I+VLPDECL E+F+R+  GKERS+CAC S  WLMLL+S+
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSI  105



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   109 bits (273),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 5/105 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  412
            M  +  +SG +EF+ GG +  +S       S+   VD Y PPCKRAR  +P +      E
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFE  56

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I+VLPDECLFE+FRR+  GKERS+CAC S RWL+LLSS+
Sbjct  57   QNKQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSI  101



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   109 bits (273),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNI  102



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   109 bits (273),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNI  102



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  263  HNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEV  439
            +++F PGGP+Y + KDS  FLSL   VD YFP  KR+R+  P V + E L+ KKK +I+V
Sbjct  59   NDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDV  118

Query  440  LPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LPDECLFE+FRR+   +ERSA AC S RWLMLLS++
Sbjct  119  LPDECLFEIFRRL-PAEERSASACVSKRWLMLLSNI  153



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   109 bits (272),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K  +I+VLPDECLFE+FRR+   +ERS+CA  S  WL L+SS+
Sbjct  60   -KPVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSI  102



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   108 bits (271),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  412
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I+VLPDECL E+F+R+  GKERS+CAC S  WLMLL+S+
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSI  105



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   108 bits (270),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  409
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YFP  KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            EPK+K +IE LPDECLFE+ RR+  G++RS CA  S RWLMLLSS+
Sbjct  60   EPKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  260  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  439
            G ++F PGG +YP+ K+S  FLSL   VD YFP  K++R+  P V       +KKP+I+V
Sbjct  56   GSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDV  115

Query  440  LPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LPDECLFE+FRR+  G+ERSACAC S RWL L+S++
Sbjct  116  LPDECLFEIFRRLPGGQERSACACVSKRWLTLVSNI  151



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   108 bits (269),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLS-LHPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +E +PGG   PS  + G   S +   +D Y+PP KR+R  + + A EG +
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR--SILEAIEGEQ  58

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              ++P IEVLPDECLFE+FRR+  GKERS CAC S RWLML+SS+
Sbjct  59   HYQEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSI  103



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+IF FSG N+F+  G  YP+ KD    LSL   VD YFPPCKR+RV  P       E 
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEE-  59

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K  +I+VLP+ECLFE+FRR+   +ER+ACA  S  WL L++S+
Sbjct  60   -KPVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSI  102



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGY-F  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  102



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  254  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLEPKKKP-  427
            FSG+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E K+KP 
Sbjct  4    FSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQKPK  63

Query  428  -TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +IE LPDECLFE+ RR+  G++RS CA  S RWLMLLSS+
Sbjct  64   TSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  104



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS++F+F    +F PGG    + K S  FL L   VD YF P KR+R+  P V     EP
Sbjct  1    MSEVFDFKAVGKFCPGG-FLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSG--EP  57

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +++P+I+VLPDECLFEVFRR+  G+ERSACAC S RWLML+SS+
Sbjct  58   EQQPSIDVLPDECLFEVFRRLPGGQERSACACVSKRWLMLMSSI  101



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   107 bits (266),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  102



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  102



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  102



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  CSFNFCSLWRVF*AHNFRI*PAPDLPPIPMSKIF-EFSGHNEFFPGGPMYPSSKDSGSFL  325
            C+  FC L       +F     P L  +    +F   SG ++F+ GG  Y +S D G   
Sbjct  18   CAVGFCVLGLEASQKSFFFEIQPCLLLLITVILFIGISGDDDFYSGGSFYTNSTDLGRLC  77

Query  326  SLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKERSA  502
            S+  +VD Y PP KRAR+  P +  E   E  K+P+I+VLP+ECLFE+F+R+  G+ERS+
Sbjct  78   SISSQVDVYCPPRKRARICAPFLFGETEFEQNKQPSIDVLPEECLFEIFKRLPGGRERSS  137

Query  503  CACTSXRWLMLLSSL  547
            CAC S  WLMLL+S+
Sbjct  138  CACVSKHWLMLLTSI  152



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   103 bits (257),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+IF F+G ++F P G +YP+ K++   LSL   VD YFPP K++RV  P+VA    E 
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLVA-RAFE-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            ++  +I+VLPDECLFE+FRR+   +ER ACA  S RWL LLSS+
Sbjct  59   QEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWLNLLSSI  102



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   103 bits (256),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDG-YFPPCKRARVGTPVVACEGLE  412
            MS+IF F+G N+F+  G +YP+ K++   LSL   VD  Y+PPCKR+RV     +     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K  +I+VLPDECLFE+FRR+   +ERSACA  S  WL L++S+
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSI  105



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   102 bits (255),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 6/104 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P V     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLMLALG-HADIYCPVSKRARISGPFVV---EER  54

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P+IEVLP+ECLFE+FRR+  G+ERSA AC S RWLMLLS++
Sbjct  55   TKNPSIEVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNM  98



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPR--SIFEAIEREQ  58

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              + P IEVLPDECLFE+FRR+  GKERS+CAC S RWLML+S++
Sbjct  59   YYQDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI  103



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSS-KDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-L  409
            MS + ++SG +    GGP+Y S   DS  FLSL P +D Y PP KR+RV  P V  E   
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              ++KP+++ LPDECLFE+ RRV+  ++RSACAC S  WLML S++
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTI  104



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+IF  +G N F P G +YP+ K++   LSL   VD YFPPCKR RV  P      +  
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAF--SVFE  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +   +I+VLPDECLFEVFRR+   +ERS CA  S RWL LLS +
Sbjct  59   QDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWLNLLSGI  102



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPR--SIFEAIEREQ  58

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              ++P IEVLPDECLFE+FRR+  GKERS+CAC S RWLML+S++
Sbjct  59   YYQEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI  103



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  248  FEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKP  427
            +  +G ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   KK+ 
Sbjct  9    YWLAGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEV  67

Query  428  TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  68   SINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  107



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTP-VVACEGL  409
            M  +  +SG +E +PG     +  D G   +L   V+GY+  P KRAR+  P +     L
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
               +KP IEVLP+ECLFE+FRR+  GKERS+C+C S RWLML+S +
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRI  106



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +FFPGG M+ S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFRFSGDEDFFPGGSMHLSPGSC-------PGV--YFPARKRLRIAAPSVQI-GFE-  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+ RR+  G+ERSACAC S  WL LLSS+
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSI  93



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 6/104 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P +     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLILALG-HADIYCPVSKRARISGPFIV---EER  54

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P+IE+LP+ECLFE+FRR+  G+ERSA AC S RWLMLLS++
Sbjct  55   TKNPSIELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNM  98



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS +F FSG  +FFPGG +Y         LS   ++D Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEDFFPGGSLY---------LSPGSQIDVYYPAHKRSRIAAPAIF-SGFE-  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + + +I+VLPDECLFE+FR +  G+ERSACAC S RWL LLS++
Sbjct  50   QNQVSIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNI  93



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +   SG +E +PGG M       G   ++   VD Y  P KRAR+  P      +E 
Sbjct  1    MPALVNSSGDDEMYPGGSM----DLGGCLYTISSNVDVYCSPTKRARISAPFTF-GAVEH  55

Query  416  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K+  KP++E+LPDECLFE+FRR+  GKERS+CAC S RWLML+S++
Sbjct  56   KQDHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI  101



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 3/106 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  409
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YF   KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            E K++ +IE LPDECLFE+ RR+  G++RS CA  S RWLMLLSS+
Sbjct  60   EQKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--L  409
            M  +  +SG +EF+ GG   P         S+   VD Y PP KRAR+  P  A EG   
Sbjct  1    MPTLVNYSGDDEFYSGGSCSP--------YSIASHVDLYCPPSKRARISAPF-ALEGSFF  51

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            E  +KP+I+VLPDECLFE+ R V  GKER + AC S RWLML+SS+
Sbjct  52   EQAEKPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSI  97



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 60/104 (58%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  EFF GG MY S+               Y PP KR RV  P +       
Sbjct  1    MSGIFSFSGDEEFFNGGSMYLSTGSCSGV---------YLPPRKRLRVAAPSLYSSF--N  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC S  WL  L+S+
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSI  93



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +FF GG MY S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMYLSPGSC-------PGV--YFPAHKRLRIAAPSVF-SGFE-  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLPDECLFE+ RR+  G+ERSACAC S  WL LLSS+
Sbjct  50   QKQTSIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSI  93



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 8/104 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS++F+FS  + F       P+SKDS    +L  RVD YF   KR+R+  P +A  G + 
Sbjct  1    MSEVFDFSDVHTF------CPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIA--GKKS  52

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K + +IE LPDECLFE+ RR+  G+E +ACAC S RWLMLLSS+
Sbjct  53   KMQSSIEALPDECLFEILRRLPRGRETNACACVSKRWLMLLSSM  96



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFP-GGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +    G ++F+  GG +   S DSG   S+   V+ Y PP KR+R+  P +    L 
Sbjct  1    MPALVNIRGDDDFYSEGGSL--CSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLF  58

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I+VLPDECLFE+FRR+  G+ERSA AC S RWL +LSS+
Sbjct  59   EDKRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSV  103



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 60/104 (58%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF F+G  EFF GG MY S                Y PP KR RV TP +       
Sbjct  1    MSGIFSFNGDEEFFNGGSMYLSPGSCSGV---------YLPPRKRLRVSTPSLYSSF--N  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC S  WL  L+S+
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSI  93



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 8/105 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  K+AR+  P V     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKKARISGPFVV---EE  53

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K P+IE+LPDECLFE+FRR+  G+ERSA AC S RWLML S++
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNV  98



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/117 (44%), Positives = 72/117 (62%), Gaps = 9/117 (8%)
 Frame = +2

Query  197  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  376
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  377  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  150



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/117 (44%), Positives = 72/117 (62%), Gaps = 9/117 (8%)
 Frame = +2

Query  197  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  376
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  377  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC S RWL +LS++
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNI  150



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MSK+  + G  E    G ++P S  S +F       + Y    KR R+  P VA  G E 
Sbjct  14   MSKVLGYGGVCEH-QAGMLFPRSDYSDTFFPFGNHFESYSLQRKRCRISAPFVA--GREV  70

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K  P+IE+LPDECLFE+FRR+H  KE+S CAC S RWLMLLSS+
Sbjct  71   KLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKRWLMLLSSI  114



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 8/105 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  KRAR+  P +     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKRARISGPFII---EE  53

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K P+IE+LPDECLFE+FRR+  G++RSA AC S RWLML S++
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNV  98



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             ++  +I  LPDECLFE+FRR+  G+ERSACAC S  WL LLSS+
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSM  105



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTPVVACE--G  406
            M  +  +SG +E + GG    +  D G   +    VD Y+  P KRAR+   + A E  G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINA-LDAFEFLG  59

Query  407  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             E  +KPTI+VLPDECLFEVFR +  GKERS+CA  S RWLML+SS+
Sbjct  60   REQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSI  106



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV          E 
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEE  57

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K  +I+VLPDECLFE+FRR+   +ER+ACA  S  WL L++S+
Sbjct  58   EKPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSI  101



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P++EVLPDECLFE+ RR+  G+ER A AC S RWL +LSS+
Sbjct  55   SKDPSLEVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSV  98



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS +F FSG   +FPGG M          LS    +  Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEGYFPGGSM---------CLSPGSNIGVYYPARKRSRISAPSLF-SGFE-  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + + +IEVLPDECLFE+FRR+  G+ERS CAC S +WL LLS++
Sbjct  50   RNQASIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNI  93



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC S  WL LL+S+
Sbjct  51   QKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSI  94



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P V   G + 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  416  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +KP     +I+VLPDECLFE+ RR+   +ERS  AC S RWLMLLSS+
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSI  109



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  403
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  404  GLEPKKKP--TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            G E +K+   +I+VLPDECLFE+ RR+   KERS  AC S RWLMLLSS+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSI  110



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P++E+LPDECLFE+ RR+  G+ER A AC S RWL +LSS+
Sbjct  55   SKDPSLEILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSV  98



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 8/106 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  409
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  S  WL L++S+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSI  100



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC S  WL LL+S+
Sbjct  51   EKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSI  94



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  403
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  404  GLEPKKKPT--IEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            G E +K+ +  I+VLPDECLFE+ RR+   KERS  AC S RWLMLLS++
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTI  110



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 8/106 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  409
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  S  WL L++S+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSI  100



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            M  +  + G ++F+ G  +   S DSG  LS+    D Y PP KR+RV  P  V      
Sbjct  1    MPALVNYGGDDDFYTGRSI--CSADSGLVLSI---ADVYCPPRKRSRVSAPYAVDSRLFN  55

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             ++ P+IE LPDECLFE+FRR+   +ERSA AC S RWLMLLSS+
Sbjct  56   KERNPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSV  100



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 61/104 (59%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +FF GG M+ S           P V  Y PP KR RV  P  +      
Sbjct  1    MSGIFSFSGDEDFFNGGTMHLSPGSC-------PGV--YLPPRKRLRVAAP--SPYSAFN  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC S  WL  L+S+
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSI  93



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 3/68 (4%)
 Frame = +2

Query  350  YFPPCKRARVGTPVVACEG--LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXR  523
            Y+PP KRAR  +   A EG   E  +KP+IEVLPDECLFE+FRR+  GKERS+CAC S +
Sbjct  13   YYPPSKRARKDSQF-AFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGGKERSSCACVSKK  71

Query  524  WLMLLSSL  547
            WLMLLSS+
Sbjct  72   WLMLLSSI  79



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +   +I  LPDECLFE+FRR+  G+ERSACAC S  WL LLSS+
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSM  102



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  412
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +   +I  LPDECLFE+FRR+  G+ERSACAC S  WL LLSS+
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSM  102



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  409
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + K + +IE LPDECLFE+ RR+ +G++RS CA  S RWL LLSS+
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSI  106



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  412
            M  +  +SG ++FF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDDFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I  LP EC+FE+F+R+  G+ERS CAC S RWL LLSS+
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSI  101



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  409
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + K + +IE LPDECLFE+ RR+ +G++RS CA  S RWL LLSS+
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSI  106



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 17/104 (16%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  +SG +EF+ GGP          F S     + Y PP KR R+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISGPFVV---EDR  43

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P++E+LPDECLFE+ RR+  G+ERSA AC S RWLMLLSS+
Sbjct  44   SKDPSLEILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSV  87



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  308  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHD  484
            DSG  +S+   +D Y PP KR+R+  P +  E  LE +K+P+I+VLPDECLFE+ RR+  
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  485  GKERSACACTSXRWLMLLSSL  547
            G+ERS+CA  S RWLMLLSS+
Sbjct  62   GQERSSCARVSKRWLMLLSSI  82



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +     L  
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPISSRINVCFQPNKRFRTNLKI---PFLGD  52

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KP+I+ LPDECLFE+F+R+ +GK +S+CAC S RWLMLLSS+
Sbjct  53   DTKPSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSI  96



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 5/109 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P +   G   
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  416  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +KP     +I+VLPDECLFE+ R +   +ERS  AC S RWLMLLSS+
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSI  109



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 5/108 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  406
            M+ + ++ G+++  PG P Y +  DS   LSL  + D Y PPCKR RV  P++   G   
Sbjct  1    MAALVKYGGNDDICPG-PFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKV  59

Query  407  LEPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            ++ +K+P +I+ LPDECLFE+ RR+   KERS  AC S  WLML+SS+
Sbjct  60   IDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSI  107



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGP-MYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  412
            MS IF FSG  +FF GG  MY S           P V  YFP  KR R+  P V   G E
Sbjct  1    MSGIFRFSGDEDFFLGGSSMYLSPGSC-------PGV--YFPARKRLRIAAPSVF-SGFE  50

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +K+ +I+VLPDECLFE+ RR+  G+ERSACAC S  WL LLSS+
Sbjct  51   -EKQTSIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSI  94



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 5/101 (5%)
 Frame = +2

Query  260  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV---ACEGLEPKKKP-  427
            G ++    GP+  +  DS   LS+   VD +FPP KR+R+  P +     +G E +K+  
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  428  -TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             +I+VLPDECLFE+ RR+   KERS  AC S RWLMLLSS+
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSI  121



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  412
            M  +  +SG +EFF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDEFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K+P+I  LP EC+FE+F+R+  G+ERS CAC S RWL LLSS+
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSI  101



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 60/104 (58%), Gaps = 17/104 (16%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +   SG +EF+ GGP          F S     + Y PP KR R+ +P V     + 
Sbjct  1    MPTLVNHSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISSPFVV---EDR  43

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             K P++E+LPDECLFE+ RR+  G+ERSA AC S  WLMLLSS+
Sbjct  44   SKDPSLEILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSV  87



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 16/108 (15%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +       P
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPVSSRINVCFQPNKRVRANLKI-------P  48

Query  416  KKK----PTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             ++    P+I+ LPDECLFE+F+R+++GK +S+CAC S RWLMLLSS+
Sbjct  49   FRRDDTNPSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSI  96



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS+IF F+    F  G     + KD+   LSL    D YFPP KR RV  P +     E 
Sbjct  1    MSQIFSFAVKTIFTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLF-SAFE-  58

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KK  +I+VLPDECLFE+FRR+   +ERSACA  S +WL  +SS+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTTVSSI  102



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 3/107 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  406
            M+ +    G+++  PGGP++ +  DS   LSL   VD Y PP KR RV  P++   G   
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  407  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
             + K + +I+ LP+ECLFE+ RR+   KERS  AC S RWLMLLSS+
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSI  107



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 15/111 (14%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGG------PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-V  394
            M  +  +SG +EF+ GG      PM     D G  LS+       +PP KRAR+ +   +
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPM-----DLGCLLSVGSNA---YPPSKRARISSQFDI  52

Query  395  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
                 E +KK +IEVLP+ECLFE+FRR+H GKER  CA  S +WLMLLSS+
Sbjct  53   RGSSFEQEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSI  103



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CLKSLNSVVTMSFSQGGLCTPVPRTRVPFCPFILVWMGIFLLARGLESVPLLLHVKDLSR  416
            CLK L SVVT +FS GG  T +PR+++ F P  L+WM  F LARGL S+P +  V+    
Sbjct  44   CLKCLISVVTRTFSLGGRYTQIPRSQICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLS  103

Query  417  RRSLQLKSFQMNASLRYSDVFMMAKKEVPVLVRPSVG  527
              S  LK FQMNASLR S V M  +++VPVLV  + G
Sbjct  104  GSSPPLKFFQMNASLRSSGVCMGVQRKVPVLVYLNAG  140



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 8/105 (8%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  412
            M  +  +SG +E + GG     S D G  LSL H  V  Y PP KR+R+  P V     +
Sbjct  1    MPALVNYSGDDELYSGGSF--CSADLGLMLSLGHAEV--YCPPRKRSRISGPFVV---ED  53

Query  413  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              K P+++ LPDECLFE+ RR+  G+ER A +C S RWLMLLSS+
Sbjct  54   RSKGPSLDDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSV  98



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +2

Query  251  EFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--K  424
            +F G  E +PGG M     D+G    ++   D +  P KR R+  P  +   LE ++  K
Sbjct  2    DFPGDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEHEQDLK  53

Query  425  PTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            PTIEVL DECLFE+FRR+  GKERS+ AC S RWLML+SS+
Sbjct  54   PTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  94



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +2

Query  293  YPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFR  472
            YP+S+ S  FLS     +  FPP KR  V T   A +  E +  P+IE+L DECLF+VF+
Sbjct  6    YPTSRQSSLFLSRGQNRNVNFPPRKRICVTT---ASKNFEQRNHPSIEILLDECLFKVFK  62

Query  473  RVHDGKERSACACTSXRWLMLLSSL  547
             +  GKERS CAC S RWL LLSS+
Sbjct  63   HLPSGKERSVCACVSKRWLTLLSSI  87



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  409
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  410  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSXRWLMLLSSL  547
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC S  WL +LSS+
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  409
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  410  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSXRWLMLLSSL  547
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC S  WL +LSS+
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 60/104 (58%), Gaps = 11/104 (11%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS IF FSG  +   GG MY S           P V  Y+P  KR RV        G E 
Sbjct  1    MSGIFRFSGDEDCLLGGSMYLSPGSC-------PGV--YYPARKRLRVAATSFY-SGFE-  49

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +K+ +I+VLP+ECLFE+ RR+  G+ERSACAC S  WL LLSS+
Sbjct  50   EKQTSIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSI  93



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 15/96 (16%)
 Frame = +2

Query  287  PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV---------VACEGLEPKKKPTIEV  439
            P++P S     FLS    VD Y PP KRARV  P+         VA E  +P+   +I+ 
Sbjct  15   PLFPGSS---RFLSPGRNVDVYCPPRKRARVIAPLGFSFRGREEVAAEKQQPR---SIDT  68

Query  440  LPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LPDECLFE+ RR+   KERS+CAC S RWLMLL S+
Sbjct  69   LPDECLFEILRRLPGEKERSSCACVSKRWLMLLISI  104



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  496
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  70

Query  497  SACACTSXRWLMLLSSL  547
            S  AC S +WLM+L+S+
Sbjct  71   SFAACVSKKWLMMLTSI  87



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  496
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  12   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  71

Query  497  SACACTSXRWLMLLSSL  547
            S  AC S +WLM+L+S+
Sbjct  72   SFAACVSKKWLMMLTSI  88



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 3/107 (3%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC--EGL  409
            M+ +   +G+++  PGGP++ +  DS   LSL    D Y PP KR R+ + +     +  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  410  EPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + K++P +I+ LPDECLFE+ RR+   KERS  AC S RWLMLL S+
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSI  107



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  496
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  109  LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  168

Query  497  SACACTSXRWLMLLSSL  547
            S  AC S +WLM+L+S+
Sbjct  169  SFAACVSKKWLMMLTSI  185



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +2

Query  308  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDG  487
            D+   LSL    D YFPP KR+RV  P +     E KK  +I+VLPDECLFE+FRR+   
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-KKPVSIDVLPDECLFEIFRRLSGP  58

Query  488  KERSACACTSXRWLMLLSSL  547
            +ERSACA  S +WL L+SS+
Sbjct  59   QERSACAFVSKQWLTLVSSI  78



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +2

Query  341  VDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSX  520
            +D YFP  KR+R      + E  E +KKP+IEVLPDECLFE+FR +  G+ERS+CAC S 
Sbjct  1    MDVYFPLSKRSRTSA---SGEKFE-QKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSK  56

Query  521  RWLMLLSSL  547
            RWL+L+S++
Sbjct  57   RWLILVSNI  65



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  1    MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  52

Query  416  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC S RWLML+SS+
Sbjct  53   EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  98



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +2

Query  260  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  439
            G  +FF GG M+  S  S       P V  YFP  KR R+    V   G E +K+ +I+V
Sbjct  5    GDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-QKQTSIDV  54

Query  440  LPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            LPDECLFE+ RR+  GKERSACAC S  WL LL+S+
Sbjct  55   LPDECLFEILRRLPSGKERSACACVSKHWLNLLTSI  90



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 62/109 (57%), Gaps = 15/109 (14%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVAC--E  403
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV +        
Sbjct  1    MSGIFRISGDDEFFTGG---------GSSMHLSPGSCPGVYLPARKRLRVASAAATSFYS  51

Query  404  GLEPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSXRWLMLLSSL  547
              E +K+ +I+VLPDECLFE+ RR+   G+ERSACAC S  WL +LSS+
Sbjct  52   SFE-EKQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  52   MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  103

Query  416  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC S RWLML+SS+
Sbjct  104  EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  149



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 58/104 (56%), Gaps = 19/104 (18%)
 Frame = +2

Query  257  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK-----  421
            SG++E  PG   Y  S +          VD +  P KR R+  P     G  P+      
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTF--GPLPRALEHGQ  55

Query  422  --KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
              KP+IE LPDECLFE+FRR+  GKERS+ AC S RWLML+SS+
Sbjct  56   DLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  99



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +2

Query  302  SKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRV  478
            S DSG   S+    + Y PP KR+R+  P  +    L   K P+I+ LPDECLFE+F  +
Sbjct  21   SGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADDKTPSIDTLPDECLFEIFTHL  80

Query  479  HDGKERSACACTSXRWLMLLSSL  547
             +G+ERS  AC S RWL +LSS+
Sbjct  81   SNGRERSTSACVSKRWLSVLSSV  103



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (58%), Gaps = 5/106 (5%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  415
            M  +  F G  +F  GGP +    D+  FLSL PR++   PP KR R G   +     +P
Sbjct  1    MPTLVSFRGDEDF--GGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLR-GNVTIPFRETKP  57

Query  416  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            K+  K  I +LPDECLFE+FR +   ++RS  AC S RWLML SS+
Sbjct  58   KQEQKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSM  103



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +2

Query  350  YFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRW  526
            ++P CKRAR+  P V+  +  E +K+ +I VLPDECLFE+FR +  G+ERS CAC S  W
Sbjct  19   FYPSCKRARINAPFVLWGQESEQEKRSSINVLPDECLFEIFRHL-PGQERSNCACVSKHW  77

Query  527  LMLLSSL  547
            L LLSS+
Sbjct  78   LTLLSSI  84



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 58/102 (57%), Gaps = 15/102 (15%)
 Frame = +2

Query  257  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC---EGLEPKK--  421
            SG++E  PG   Y  S +          VD +  P KR R+  P         LE  +  
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTFGPLPRALEHGQDL  57

Query  422  KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            KP+IE LPDECLFE+FRR+  GKERS+ AC S RWLML+SS+
Sbjct  58   KPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  99



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +2

Query  254  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KP  427
            FSG +E + G    PS+            VD Y PP KR RV  P V   G  P++  + 
Sbjct  8    FSGEDELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLW-GSNPEQNTRS  57

Query  428  TIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +I VLPDEC+FEVFRR+   +ERS CAC S +WL +L+ +
Sbjct  58   SINVLPDECMFEVFRRL-PPQERSNCACVSKQWLTILTGI  96



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +2

Query  365  KRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSS  544
            KR RV  P VA    E K  P+I+ LPDECLFE+ RR+    E+SACAC S RWLMLLSS
Sbjct  7    KRCRVNAPFVASR--EFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLMLLSS  64

Query  545  L  547
            +
Sbjct  65   I  65



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = +2

Query  236  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-------V  394
            M+ +    G ++   GG ++ +  DS   LSL   VD Y    KR RV  P+       V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  395  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            A +  +P+   +I+ LPDECLFE+ RR+   KERS  A  S RWLMLLSS+
Sbjct  61   AYKKQQPR---SIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSI  108



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query  281  GGPMYPSSKDSGSFLSLHPRVDGYFPPCK-RARVGTPVVACEGLEPKK--KPTIEVLPDE  451
            G P+YP+ K+  S   L  ++   F   +  A V   + A  GL   +  + +IE LPDE
Sbjct  57   GAPIYPNPKEHVSSCLLAVKLMFTFLFRRGLASVFHLISAENGLSRSRSQRTSIESLPDE  116

Query  452  CLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            CLFE+ RR+  G++RS CA  S RWLMLLSS+
Sbjct  117  CLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  148



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +2

Query  350  YFPPCKRARVGTPVVACEGL-EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRW  526
            Y+PP KRAR+ + V++ E   E  ++ +IE+LPDECLFE+ RR+   KER    C S RW
Sbjct  41   YYPPNKRARISSSVLSVESETEVSEQQSIEILPDECLFEILRRLPRVKERCLSLCVSKRW  100

Query  527  LMLLSSL  547
            L +L+S+
Sbjct  101  LNVLTSM  107



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 10/97 (10%)
 Frame = +2

Query  260  GHNEFFPG-GPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPK--KKPT  430
            G  EF    G +  +  + G    +   VD Y+PP KRAR+          EP+   + +
Sbjct  9    GAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLSES-------EPEATDRSS  61

Query  431  IEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLS  541
            IE+LPDECLFE+ RR+   KER   +C S RWL +L+
Sbjct  62   IEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLT  98



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S RWL LL S+
Sbjct  61   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSI  106



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  422  KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +P+++ LPDECLFEV RR+  G+ER+  AC S RWL LL+S+
Sbjct  69   QPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASI  110



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  422  KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +P+++VLPDECLFEV RR+  G+ER+  AC S RWL LL+S+
Sbjct  354  QPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASI  395



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S RWL LL S+
Sbjct  53   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSI  98



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  422  KPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +P+++ LPDECLFEV RR+  G+ER+  AC S RWL LL+S+
Sbjct  64   QPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASI  105



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            +++P+++ LPDECLFEV RRV   + R A AC S RWL LL+ +
Sbjct  42   REEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGI  85



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  FPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLM  532
             PPC  A V     A +  + ++ P+++ LPDECLFE+ RRV   + R A AC S RWL 
Sbjct  37   VPPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASACVSRRWLA  96

Query  533  LLSSL  547
            LL  +
Sbjct  97   LLGGI  101



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + +P+++ +PDECLFEV RRV   + R A AC S RWL LL+ +
Sbjct  41   RDEPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGI  84



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  431  IEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            ++ LPDECLFEV RRV   + R A AC S RWL LL+ +
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGI  84



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = +2

Query  353  FPPCKRARVGTPVVACEGLEPKKK--PTIEVLPDECLFEVFRRVHDGKERSACACTSXRW  526
             PPC  A      V       K++  P+++ LPDECLFE+ RRV   + R A    S RW
Sbjct  36   VPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARCASGAVSRRW  95

Query  527  LMLLSS  544
            L LL +
Sbjct  96   LALLGA  101



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  419  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + P+++ LPDECLFE+ RRV   + R A A  S RWL LL  +
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGI  115



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  419  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + P+++ LPDECLFE+ RRV   + R A A  S RWL LL  +
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGI  115



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 2/46 (4%)
 Frame = +2

Query  410  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSXRWLMLLSSL  547
            + ++ P+++ LPDECLFE+ RRV     R A AC S RWL LL S+
Sbjct  55   KQRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSI  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335