BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027G07

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03239.1|  unnamed protein product                                156   1e-41   Coffea canephora [robusta coffee]
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    155   4e-41   Solanum tuberosum [potatoes]
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   4e-41   Sesamum indicum [beniseed]
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     154   1e-40   Solanum lycopersicum
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     152   4e-40   Fragaria vesca subsp. vesca
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     152   5e-40   Nicotiana tomentosiformis
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     152   7e-40   Nicotiana sylvestris
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   150   8e-40   Citrus sinensis [apfelsine]
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     151   8e-40   Pyrus x bretschneideri [bai li]
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             151   1e-39   Citrus clementina [clementine]
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   2e-39   Vitis vinifera
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   2e-39   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            149   4e-39   Prunus persica
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   4e-39   Eucalyptus grandis [rose gum]
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   5e-39   Prunus mume [ume]
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    146   4e-38   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    146   5e-38   
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    146   6e-38   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         146   7e-38   Jatropha curcas
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    146   9e-38   Ricinus communis
gb|KJB65051.1|  hypothetical protein B456_010G078300                    145   1e-37   Gossypium raimondii
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                144   3e-37   Erythranthe guttata [common monkey flower]
gb|KJB27173.1|  hypothetical protein B456_004G282300                    144   3e-37   Gossypium raimondii
gb|KJB27172.1|  hypothetical protein B456_004G282300                    144   3e-37   Gossypium raimondii
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   4e-37   Nelumbo nucifera [Indian lotus]
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     142   2e-36   Glycine soja [wild soybean]
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-36   Glycine max [soybeans]
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        141   4e-36   Phaseolus vulgaris [French bean]
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             141   4e-36   Phaseolus vulgaris [French bean]
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   7e-36   Cucumis sativus [cucumbers]
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        140   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   8e-36   Populus euphratica
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-35   
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             139   2e-35   Eutrema salsugineum [saltwater cress]
gb|KHG04832.1|  hypothetical protein F383_29565                         139   2e-35   Gossypium arboreum [tree cotton]
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-35   
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   3e-35   Cucumis melo [Oriental melon]
gb|EPS73640.1|  hypothetical protein M569_01113                         139   3e-35   Genlisea aurea
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-35   Phoenix dactylifera
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     138   5e-35   Phoenix dactylifera
gb|KHG26459.1|  hypothetical protein F383_04538                         138   5e-35   Gossypium arboreum [tree cotton]
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     138   6e-35   Brassica rapa
ref|XP_010545323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   2e-34   Cicer arietinum [garbanzo]
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     136   2e-34   Glycine soja [wild soybean]
emb|CDY32869.1|  BnaC09g33160D                                          136   3e-34   Brassica napus [oilseed rape]
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     136   3e-34   Glycine max [soybeans]
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                139   4e-34   
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     135   4e-34   Elaeis guineensis
emb|CDY64970.1|  BnaAnng19910D                                          134   1e-33   Brassica napus [oilseed rape]
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   1e-33   Elaeis guineensis
gb|AIR93910.1|  glucanase                                               133   3e-33   Cicer arietinum [garbanzo]
gb|ABD91577.1|  beta-1,3-glucanase                                      133   3e-33   Medicago sativa [alfalfa]
gb|ABD91576.1|  beta-1,3-glucanase                                      133   4e-33   Medicago sativa [alfalfa]
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-33   Oryza brachyantha
ref|NP_001044198.1|  Os01g0739700                                       132   5e-33   
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          132   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               132   8e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   8e-33   Setaria italica
gb|AGA95870.1|  beta-1,3-glucanase                                      130   9e-33   Arachis hypogaea [goober]
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           131   1e-32   Medicago truncatula
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          131   1e-32   
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          131   2e-32   Sorghum bicolor [broomcorn]
gb|EEC71452.1|  hypothetical protein OsI_03677                          131   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    131   2e-32   
gb|AAC04713.1|  beta-1,3-glucanase 7                                    127   2e-32   Glycine max [soybeans]
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     130   3e-32   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    130   1e-31   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   2e-30   
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   2e-30   
dbj|BAJ85556.1|  predicted protein                                      125   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     125   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               125   3e-30   
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     124   5e-30   
emb|CDM84006.1|  unnamed protein product                                124   5e-30   Triticum aestivum [Canadian hard winter wheat]
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     124   6e-30   Triticum urartu
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     124   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             123   1e-29   Eutrema salsugineum [saltwater cress]
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    123   1e-29   Arabis alpina [alpine rockcress]
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             121   6e-29   Capsella rubella
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             121   6e-29   Capsella rubella
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     121   6e-29   Brassica rapa
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   119   3e-28   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       119   3e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06818.1|  BnaC01g09170D                                          119   4e-28   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   119   5e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14214.1|  BnaA08g13450D                                          118   9e-28   Brassica napus [oilseed rape]
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   3e-27   Brassica rapa
emb|CDY62033.1|  BnaC03g77660D                                          113   6e-26   Brassica napus [oilseed rape]
gb|EAY85760.1|  hypothetical protein OsI_07118                          106   2e-23   Oryza sativa Indica Group [Indian rice]
gb|EEE56938.1|  hypothetical protein OsJ_06635                          106   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KJB54308.1|  hypothetical protein B456_009G028300                    100   1e-21   Gossypium raimondii
gb|KJB54309.1|  hypothetical protein B456_009G028300                    100   2e-21   Gossypium raimondii
gb|KHG29271.1|  hypothetical protein F383_14120                       84.3    1e-15   Gossypium arboreum [tree cotton]
gb|KJB54307.1|  hypothetical protein B456_009G028200                  79.7    5e-14   Gossypium raimondii
ref|XP_002994218.1|  hypothetical protein SELMODRAFT_163389           77.8    6e-14   
ref|XP_002974888.1|  hypothetical protein SELMODRAFT_102117           78.6    1e-13   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256            77.8    1e-13   
ref|XP_002963799.1|  hypothetical protein SELMODRAFT_79527            78.2    1e-13   
ref|XP_002969656.1|  hypothetical protein SELMODRAFT_440863           77.4    2e-13   
ref|XP_002993263.1|  hypothetical protein SELMODRAFT_162942           76.3    2e-13   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513            77.0    3e-13   
ref|XP_002308921.2|  hypothetical protein POPTR_0006s04460g           75.9    3e-13   
ref|XP_011027332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  75.9    3e-13   Populus euphratica
emb|CBI30053.3|  unnamed protein product                              73.9    4e-13   Vitis vinifera
ref|XP_004968992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  75.5    1e-12   Setaria italica
ref|XP_002314939.2|  hypothetical protein POPTR_0010s15320g           73.6    2e-12   
ref|XP_002277446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      73.6    2e-12   Vitis vinifera
gb|KFK36125.1|  hypothetical protein AALP_AA4G081000                  73.2    3e-12   Arabis alpina [alpine rockcress]
ref|XP_006387253.1|  hypothetical protein POPTR_1409s00200g           71.6    4e-12   
emb|CDY34445.1|  BnaC01g21880D                                        72.8    4e-12   Brassica napus [oilseed rape]
emb|CDY32230.1|  BnaA01g17540D                                        72.8    5e-12   Brassica napus [oilseed rape]
gb|EYU45078.1|  hypothetical protein MIMGU_mgv1a009249mg              72.8    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_009146295.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  72.4    6e-12   Brassica rapa
ref|XP_003594772.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  70.9    7e-12   
dbj|BAC84504.1|  putative beta-1,3-glucanase                          71.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  73.2    9e-12   
dbj|BAJ33717.1|  unnamed protein product                              71.6    9e-12   Eutrema halophilum
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  73.2    9e-12   Zea mays [maize]
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  73.2    9e-12   
ref|XP_002868146.1|  AT4g16260/dl4170c                                71.6    1e-11   
ref|XP_004159384.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  72.0    1e-11   
ref|XP_002314934.2|  Glucan endo-1 family protein                     72.0    1e-11   
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  72.4    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008457422.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   72.0    1e-11   Cucumis melo [Oriental melon]
ref|XP_006292288.1|  hypothetical protein CARUB_v10018497mg           71.6    1e-11   Capsella rubella
ref|XP_009795195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  71.6    1e-11   Nicotiana sylvestris
ref|NP_001061351.1|  Os08g0244500                                     72.8    1e-11   
ref|XP_006409034.1|  hypothetical protein EUTSA_v10003126mg           71.6    1e-11   Eutrema salsugineum [saltwater cress]
emb|CAB10405.1|  beta-1, 3-glucanase class I precursor                70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   72.0    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_006396056.1|  hypothetical protein EUTSA_v10007971mg           71.6    1e-11   Eutrema salsugineum [saltwater cress]
dbj|BAC84505.1|  putative beta-1,3-glucanase                          72.4    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462968.1|  hypothetical protein SORBIDRAFT_02g035490        72.4    1e-11   Sorghum bicolor [broomcorn]
ref|NP_001059886.2|  Os07g0539400                                     72.4    2e-11   
gb|ABK96486.1|  unknown                                               71.2    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_011010204.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  71.2    2e-11   Populus euphratica
gb|EEC82195.1|  hypothetical protein OsI_26335                        72.0    2e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_193361.4|  putative beta-1,3-endoglucanase                     70.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84752.1|  unknown                                               70.9    2e-11   Medicago truncatula
ref|XP_003594771.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  70.5    2e-11   
gb|AAD10386.1|  beta-1,3-glucanase precursor                          71.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059878.1|  Os07g0538000                                     71.6    2e-11   
ref|XP_004968994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  71.6    2e-11   
ref|XP_004968993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  71.6    2e-11   Setaria italica
ref|XP_010095615.1|  Glucan endo-1,3-beta-glucosidase 11              70.9    3e-11   
gb|ABD32329.1|  Glycoside hydrolase, family 17                        70.9    3e-11   Medicago truncatula
gb|EEE67336.1|  hypothetical protein OsJ_24592                        71.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CBI28222.3|  unnamed protein product                              70.5    3e-11   Vitis vinifera
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein          71.2    3e-11   
ref|NP_001175238.1|  Os07g0539300                                     71.2    3e-11   
ref|XP_011078399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.5    4e-11   Sesamum indicum [beniseed]
ref|XP_010046640.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.1    4e-11   
ref|XP_009794602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   70.5    4e-11   Nicotiana sylvestris
gb|KDP32427.1|  hypothetical protein JCGZ_13352                       70.1    4e-11   Jatropha curcas
gb|ACU14757.1|  unknown                                               67.4    4e-11   Glycine max [soybeans]
ref|XP_003594774.1|  Glucan endo-1,3-beta-glucosidase                 70.1    4e-11   Medicago truncatula
ref|XP_009611391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.7    4e-11   Nicotiana tomentosiformis
gb|ABD32327.1|  Glycoside hydrolase, family 17                        70.1    4e-11   Medicago truncatula
ref|XP_006294379.1|  hypothetical protein CARUB_v10023397mg           70.1    4e-11   Capsella rubella
ref|XP_009364012.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_009368869.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_011078397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    5e-11   
gb|KCW86706.1|  hypothetical protein EUGRSUZ_B03315                   69.3    5e-11   Eucalyptus grandis [rose gum]
ref|XP_011078398.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    5e-11   
gb|EAZ04201.1|  hypothetical protein OsI_26344                        70.9    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006658648.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.9    5e-11   Oryza brachyantha
ref|XP_008361223.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    5e-11   
ref|XP_010449818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.7    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    6e-11   
ref|XP_006414372.1|  hypothetical protein EUTSA_v10025628mg           69.7    6e-11   Eutrema salsugineum [saltwater cress]
gb|AAY25165.1|  beta-1,3-glucanase 1                                  69.7    6e-11   Ziziphus jujuba [Chinese jujube]
ref|XP_009612877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   69.7    6e-11   Nicotiana tomentosiformis
ref|XP_002282272.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   69.7    6e-11   Vitis vinifera
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    6e-11   
ref|XP_009421254.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  70.1    7e-11   Camelina sativa [gold-of-pleasure]
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg              70.1    7e-11   Erythranthe guttata [common monkey flower]
ref|NP_001048260.1|  Os02g0771700                                     70.1    7e-11   
ref|XP_010417810.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010653914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    7e-11   Vitis vinifera
gb|AAL30426.1|AF435089_1  beta-1,3-glucanase                          69.3    7e-11   Prunus persica
emb|CDX83243.1|  BnaA03g22630D                                        69.7    8e-11   
ref|XP_006419181.1|  hypothetical protein EUTSA_v10002341mg           69.7    8e-11   Eutrema salsugineum [saltwater cress]
ref|XP_004242775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    8e-11   
ref|XP_006419179.1|  hypothetical protein EUTSA_v10002341mg           69.3    8e-11   
ref|XP_010323301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    8e-11   Solanum lycopersicum
ref|XP_009133932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   69.3    8e-11   Brassica rapa
emb|CDY38531.1|  BnaC03g26660D                                        69.3    8e-11   Brassica napus [oilseed rape]
emb|CDP14182.1|  unnamed protein product                              69.7    8e-11   Coffea canephora [robusta coffee]
ref|XP_002983128.1|  hypothetical protein SELMODRAFT_117724           68.9    8e-11   
ref|XP_010510884.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002878991.1|  glycosyl hydrolase family 17 protein             69.3    8e-11   
ref|XP_004150032.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    8e-11   Cucumis sativus [cucumbers]
ref|XP_006358284.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    8e-11   Solanum tuberosum [potatoes]
ref|XP_008443979.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    8e-11   Cucumis melo [Oriental melon]
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    8e-11   
ref|XP_002965881.1|  hypothetical protein SELMODRAFT_84311            68.9    9e-11   
emb|CBI30054.3|  unnamed protein product                              68.9    9e-11   Vitis vinifera
ref|NP_001274810.1|  glucan endo-1,3-beta-glucosidase 11-like pre...  69.3    9e-11   Solanum tuberosum [potatoes]
ref|XP_010551091.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    9e-11   Tarenaya hassleriana [spider flower]
gb|AIR93915.1|  glucanase                                             68.9    1e-10   Cicer arietinum [garbanzo]
ref|XP_004508479.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.3    1e-10   Cicer arietinum [garbanzo]
ref|XP_004968973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  69.7    1e-10   Setaria italica
gb|ADW08743.1|  1,3-beta-D-glucanase GH17_44                          68.9    1e-10   Populus tremula x Populus tremuloides
ref|XP_011039450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.6    1e-10   Populus euphratica
gb|EMS65653.1|  Glucan endo-1,3-beta-glucosidase 13                   69.3    1e-10   Triticum urartu
ref|XP_008242789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.9    1e-10   Prunus mume [ume]
gb|KCW82868.1|  hypothetical protein EUGRSUZ_C04236                   68.9    1e-10   Eucalyptus grandis [rose gum]
gb|EMT31766.1|  Glucan endo-1,3-beta-glucosidase 13                   69.3    1e-10   
ref|XP_010050031.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   68.9    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_006351289.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.6    1e-10   
ref|XP_006577670.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.6    1e-10   
ref|XP_007204356.1|  hypothetical protein PRUPE_ppa007158mg           68.9    1e-10   
ref|XP_007139000.1|  hypothetical protein PHAVU_009G256400g           68.9    1e-10   Phaseolus vulgaris [French bean]
gb|KJB64677.1|  hypothetical protein B456_010G062700                  68.9    1e-10   Gossypium raimondii
ref|XP_008240769.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.6    1e-10   Prunus mume [ume]
ref|XP_009597885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.6    1e-10   Nicotiana tomentosiformis
emb|CBZ05769.1|  glucan endo-1,3-beta glucosidase                     65.9    1e-10   Fagus sylvatica
ref|XP_006284042.1|  hypothetical protein CARUB_v10005163mg           68.6    1e-10   Capsella rubella
ref|XP_010473043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.6    2e-10   Camelina sativa [gold-of-pleasure]
emb|CAA38324.1|  glucan endo-1,3-beta-glucosidase                     68.2    2e-10   Nicotiana tabacum [American tobacco]
gb|KFK34960.1|  hypothetical protein AALP_AA5G216300                  68.2    2e-10   Arabis alpina [alpine rockcress]
dbj|BAJ92436.1|  predicted protein                                    68.6    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001059883.1|  Os07g0539100                                     68.9    2e-10   
gb|ACZ74626.1|  beta-1,3-glucanase form RRII Gln 3                    68.6    2e-10   Hevea brasiliensis [jebe]
gb|AFU52648.1|  beta-1,3-glucanase 13                                 68.2    2e-10   Solanum tuberosum [potatoes]
gb|EEE67335.1|  hypothetical protein OsJ_24590                        68.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDP14183.1|  unnamed protein product                              68.2    2e-10   Coffea canephora [robusta coffee]
ref|XP_010273328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.4    2e-10   Nelumbo nucifera [Indian lotus]
ref|NP_001130652.1|  uncharacterized protein LOC100191753 precursor   68.6    2e-10   Zea mays [maize]
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                   68.9    2e-10   
ref|XP_010279618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.6    2e-10   Nelumbo nucifera [Indian lotus]
emb|CDP14179.1|  unnamed protein product                              68.2    2e-10   Coffea canephora [robusta coffee]
emb|CDP10428.1|  unnamed protein product                              68.6    2e-10   Coffea canephora [robusta coffee]
gb|AFK34061.1|  unknown                                               66.6    2e-10   Medicago truncatula
ref|XP_010279617.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.6    2e-10   Nelumbo nucifera [Indian lotus]
emb|CAE54080.1|  beta 1-3 glucanase                                   66.2    2e-10   Fagus sylvatica
gb|AAQ90286.1|  beta-1,3-glucanase, basic                             68.2    2e-10   Coffea arabica x Coffea canephora
dbj|BAJ93567.1|  predicted protein                                    68.9    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434858.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.2    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002462970.1|  hypothetical protein SORBIDRAFT_02g035520        68.9    2e-10   Sorghum bicolor [broomcorn]
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.6    2e-10   Oryza brachyantha
emb|CDY19908.1|  BnaC09g31740D                                        68.6    2e-10   Brassica napus [oilseed rape]
ref|XP_006475876.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.2    2e-10   Citrus sinensis [apfelsine]
gb|EYU31257.1|  hypothetical protein MIMGU_mgv1a009184mg              68.2    2e-10   Erythranthe guttata [common monkey flower]
gb|KDO80199.1|  hypothetical protein CISIN_1g016232mg                 68.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_006475875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_006450891.1|  hypothetical protein CICLE_v10008555mg           68.2    2e-10   Citrus clementina [clementine]
ref|XP_006475873.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_004287297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   68.2    2e-10   Fragaria vesca subsp. vesca
ref|XP_006475874.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.2    2e-10   Citrus sinensis [apfelsine]
ref|NP_191286.1|  beta-1,3-glucanase 1                                67.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28605.1|  unknown                                               67.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31255.1|  hypothetical protein MIMGU_mgv1a009099mg              67.8    2e-10   Erythranthe guttata [common monkey flower]
gb|KHN22112.1|  Glucan endo-1,3-beta-glucosidase 14                   68.2    3e-10   Glycine soja [wild soybean]
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  68.2    3e-10   Setaria italica
ref|XP_001777261.1|  predicted protein                                68.2    3e-10   
gb|KFK32497.1|  hypothetical protein AALP_AA6G250000                  67.8    3e-10   Arabis alpina [alpine rockcress]
ref|XP_002525370.1|  Glucan endo-1,3-beta-glucosidase, acidic iso...  67.4    3e-10   
ref|XP_010440186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_007013485.1|  Glycosyl hydrolase superfamily protein           67.8    3e-10   Theobroma cacao [chocolate]
gb|KFK32496.1|  hypothetical protein AALP_AA6G250000                  67.8    3e-10   Arabis alpina [alpine rockcress]
ref|XP_009784805.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  67.4    3e-10   Nicotiana sylvestris
ref|XP_007204420.1|  hypothetical protein PRUPE_ppa1027220mg          67.4    3e-10   
emb|CAJ91137.1|  beta-1,3-glucanase                                   66.6    3e-10   Platanus x hispanica [London plane tree]
ref|XP_011013086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.4    3e-10   Populus euphratica
ref|XP_011039449.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.4    3e-10   Populus euphratica
gb|KHN15078.1|  Glucan endo-1,3-beta-glucosidase 14                   67.8    3e-10   Glycine soja [wild soybean]
gb|EMT31770.1|  Glucan endo-1,3-beta-glucosidase 13                   68.6    3e-10   
ref|XP_002277173.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.4    3e-10   
ref|XP_007139001.1|  hypothetical protein PHAVU_009G256400g           67.8    3e-10   
ref|XP_003521159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.4    3e-10   
ref|XP_006409033.1|  hypothetical protein EUTSA_v10003127mg           67.4    3e-10   
ref|XP_009382024.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.8    3e-10   
ref|XP_003554151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.4    3e-10   
tpg|DAA41054.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  65.9    4e-10   
gb|AAB03501.1|  beta-1,3-glucanase                                    67.4    4e-10   
ref|XP_002325214.2|  hypothetical protein POPTR_0018s12960g           67.8    4e-10   
gb|ABR18393.1|  unknown                                               67.8    4e-10   
sp|P23535.1|E13B_PHAVU  RecName: Full=Glucan endo-1,3-beta-glucos...  67.4    4e-10   
ref|XP_010042100.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.0    4e-10   
emb|CBI30051.3|  unnamed protein product                              65.9    4e-10   
gb|AFJ97274.1|  beta-1,3-glucanase                                    67.4    4e-10   
emb|CBI30056.3|  unnamed protein product                              68.2    4e-10   
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.4    4e-10   
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.4    4e-10   
emb|CDP14184.1|  unnamed protein product                              67.0    4e-10   
gb|ABN09653.1|  beta-1,3-glucanase                                    67.4    4e-10   
gb|AFJ97275.1|  beta-1,3-glucanase                                    67.0    5e-10   
gb|ABG49448.1|  beta-1,3-glucanase                                    67.0    5e-10   
ref|XP_006372165.1|  hypothetical protein POPTR_0018s12960g           67.4    5e-10   
gb|AAB41551.1|  acidic glucanase                                      67.0    5e-10   
gb|AAV66071.1|  acidic glucanase                                      67.0    5e-10   
emb|CDP00159.1|  unnamed protein product                              66.6    5e-10   
ref|XP_010917973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    6e-10   
ref|XP_011008451.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    6e-10   
ref|XP_006465484.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    6e-10   
ref|XP_010687954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    6e-10   
ref|XP_010687955.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    6e-10   
emb|CDP07525.1|  unnamed protein product                              67.4    6e-10   
ref|XP_008234119.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  67.0    6e-10   
gb|AFE89380.1|  beta-1,3-glucanase                                    65.9    6e-10   
gb|AFV09178.1|  beta-1,3-glucanase                                    66.6    6e-10   
ref|XP_004487771.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.6    6e-10   
gb|AAF33405.1|AF230109_1  beta-1,3 glucanase                          66.6    6e-10   
gb|ADW08746.1|  1,3-beta-D-glucanase GH17_101                         66.6    6e-10   
gb|EPS67927.1|  beta-1,3-glucanase 1                                  66.6    6e-10   
gb|KGN65972.1|  hypothetical protein Csa_1G555080                     67.8    7e-10   
gb|AFK40941.1|  unknown                                               66.2    7e-10   
ref|NP_565627.1|  glycosyl hydrolases family protein                  66.6    7e-10   
ref|XP_006415516.1|  hypothetical protein EUTSA_v10007753mg           67.0    7e-10   
ref|XP_002323325.2|  hypothetical protein POPTR_0016s05800g           66.6    7e-10   
ref|XP_008653187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.4    7e-10   
ref|XP_002878141.1|  hypothetical protein ARALYDRAFT_486169           66.2    7e-10   
ref|XP_009336583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    7e-10   
gb|AAM67102.1|  putative beta-1,3-glucanase                           66.6    7e-10   
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein          67.0    7e-10   
ref|XP_006341928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    7e-10   
gb|KHG03443.1|  hypothetical protein F383_26558                       66.6    7e-10   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280           67.0    8e-10   
gb|AEI54334.1|  acidic glucanase                                      66.6    8e-10   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025           67.0    8e-10   
ref|XP_003594775.1|  Glucan-endo-1 3-beta-glucosidase                 66.6    8e-10   
gb|KHN12886.1|  Glucan endo-1,3-beta-glucosidase, basic isoform       66.6    8e-10   
ref|XP_006597705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    8e-10   
gb|EMS58549.1|  Glucan endo-1,3-beta-glucosidase 13                   67.4    8e-10   
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg           67.0    8e-10   
tpg|DAA62995.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  64.7    8e-10   
ref|XP_007211424.1|  hypothetical protein PRUPE_ppa007088mg           66.6    8e-10   
dbj|BAJ87688.1|  predicted protein                                    67.0    8e-10   
gb|AAP87281.1|  beta-1,3-glucanase                                    66.2    9e-10   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein             66.6    9e-10   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                      66.6    9e-10   
ref|XP_007221161.1|  hypothetical protein PRUPE_ppa020503mg           66.2    9e-10   
ref|XP_008653186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    9e-10   
emb|CDY17308.1|  BnaA10g09420D                                        66.6    1e-09   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.6    1e-09   
ref|NP_001268153.1|  beta 1-3 glucanase precursor                     66.2    1e-09   
gb|ABJ74161.1|  beta-1,3-glucanase                                    65.9    1e-09   
gb|KHG21190.1|  hypothetical protein F383_01641                       66.6    1e-09   
gb|KJB13749.1|  hypothetical protein B456_002G092600                  66.6    1e-09   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg           66.6    1e-09   
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein             66.6    1e-09   
ref|XP_007162150.1|  hypothetical protein PHAVU_001G128500g           65.9    1e-09   
emb|CAH17549.1|  beta-1,3-glucanase                                   65.9    1e-09   
gb|KHG21189.1|  hypothetical protein F383_01641                       66.6    1e-09   
ref|XP_009415821.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.6    1e-09   
ref|XP_008796301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.9    1e-09   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
ref|XP_007155020.1|  hypothetical protein PHAVU_003G166400g           66.2    1e-09   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
ref|XP_010525512.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      65.9    1e-09   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g           66.2    1e-09   
ref|XP_008231643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.9    1e-09   
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
ref|XP_010046177.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg              66.2    1e-09   
dbj|BAK04571.1|  predicted protein                                    66.6    1e-09   
gb|EMT26371.1|  Glucan endo-1,3-beta-glucosidase 4                    65.9    1e-09   
ref|XP_010046172.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    1e-09   
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    1e-09   
gb|AAM61105.1|  glucan endo-1,3-beta-D-glucosidase-like protein       65.5    1e-09   
emb|CDX99881.1|  BnaC05g23030D                                        65.9    1e-09   
ref|XP_011083774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.5    1e-09   
gb|ACD45061.1|  beta-1,3-glucanase                                    65.5    1e-09   
gb|KJB06327.1|  hypothetical protein B456_001G043100                  64.7    1e-09   
ref|XP_010279591.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    1e-09   
ref|XP_009784615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    1e-09   
dbj|BAJ88052.1|  predicted protein                                    66.2    1e-09   
gb|ABN09654.1|  beta-1,3-glucanase                                    65.9    1e-09   
ref|XP_002437077.1|  hypothetical protein SORBIDRAFT_10g020900        65.9    1e-09   
ref|XP_009615622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
ref|XP_006341857.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    2e-09   
emb|CDY23618.1|  BnaC05g39760D                                        65.9    2e-09   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
gb|ABR16583.1|  unknown                                               65.5    2e-09   
gb|KJB70629.1|  hypothetical protein B456_011G084000                  65.9    2e-09   
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    66.2    2e-09   
gb|KHN14941.1|  Glucan endo-1,3-beta-glucosidase                      65.5    2e-09   
emb|CDY36734.1|  BnaA03g11520D                                        65.9    2e-09   
gb|AIT56228.1|  beta-1,3 glucanase 3                                  65.1    2e-09   
ref|XP_010090235.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  65.5    2e-09   
gb|ABK23947.1|  unknown                                               65.5    2e-09   
ref|XP_004516619.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    2e-09   
emb|CDY12009.1|  BnaC03g14350D                                        65.9    2e-09   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
ref|XP_004171028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    65.9    2e-09   
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
ref|XP_008225491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
ref|XP_009626249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
ref|XP_010672927.1|  PREDICTED: lichenase-like                        65.1    2e-09   
gb|AIT56224.1|  beta-1,3 glucanase 3                                  65.1    2e-09   
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                    66.2    2e-09   
ref|XP_004252276.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
emb|CDY26296.1|  BnaA09g26470D                                        65.5    2e-09   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  66.2    2e-09   
ref|XP_008225490.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
ref|XP_004142554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
ref|XP_009348394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein             65.9    2e-09   
ref|XP_004516618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    2e-09   
ref|XP_008240765.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
emb|CDY06601.1|  BnaC02g13250D                                        65.5    2e-09   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                   65.5    2e-09   
ref|XP_009115194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   65.5    2e-09   
ref|XP_009409321.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.9    2e-09   
ref|XP_009348395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
gb|AAG52058.1|AC022455_12  beta-1,3-glucanase precursor, putative...  65.1    2e-09   
gb|AAL77689.1|  AT5g55180/MCO15_13                                    65.5    2e-09   
ref|XP_009360891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   65.5    2e-09   
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    2e-09   
gb|ACD45060.1|  beta-1,3-glucanase                                    65.1    2e-09   
dbj|BAF95876.1|  beta 1-3 glucanase                                   65.1    2e-09   
emb|CDP18512.1|  unnamed protein product                              65.5    2e-09   
ref|XP_002893598.1|  predicted protein                                65.1    2e-09   
ref|XP_007221101.1|  hypothetical protein PRUPE_ppa017239mg           65.1    2e-09   
ref|XP_009414139.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.1    2e-09   
gb|ACY06774.1|  glucanase                                             65.1    2e-09   
gb|ABR18134.1|  unknown                                               65.5    2e-09   
ref|XP_004303631.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    2e-09   
ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
ref|NP_174300.2|  glycosyl hydrolases family protein                  65.5    2e-09   
ref|XP_009384632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    2e-09   
gb|AFA26674.1|  beta-1,3-glucanase                                    64.7    2e-09   
gb|KDP39185.1|  hypothetical protein JCGZ_00942                       65.5    2e-09   
ref|XP_009384631.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    2e-09   
gb|KJB52393.1|  hypothetical protein B456_008G260000                  65.1    2e-09   
gb|KFK28508.1|  hypothetical protein AALP_AA7G005500                  65.1    3e-09   
ref|XP_002308978.2|  hypothetical protein POPTR_0006s06670g           65.1    3e-09   
emb|CDY33832.1|  BnaCnng07500D                                        64.7    3e-09   
gb|KJB52394.1|  hypothetical protein B456_008G260000                  65.1    3e-09   
ref|XP_009104047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    3e-09   
ref|XP_008679908.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    3e-09   
gb|EYU34990.1|  hypothetical protein MIMGU_mgv1a007888mg              65.1    3e-09   
ref|XP_011020146.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    3e-09   
gb|EPS60410.1|  hypothetical protein M569_14393                       65.1    3e-09   
dbj|BAH57260.1|  AT3G13560                                            65.1    3e-09   
ref|XP_011020145.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    3e-09   
gb|AFN85666.1|  glucanase 1                                           64.7    3e-09   
gb|ABC94638.2|  basic glucanase                                       64.7    3e-09   
ref|XP_010499522.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    3e-09   
ref|XP_001780045.1|  predicted protein                                65.1    3e-09   
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    65.1    3e-09   
sp|Q03467.1|E13B_PEA  RecName: Full=Glucan endo-1,3-beta-glucosid...  64.7    3e-09   
ref|XP_006373789.1|  hypothetical protein POPTR_0016s05780g           64.7    3e-09   
emb|CDY20780.1|  BnaA02g09200D                                        65.1    3e-09   
ref|XP_010033963.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   65.1    3e-09   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890        65.1    3e-09   
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    3e-09   
ref|XP_001780506.1|  predicted protein                                64.7    3e-09   
ref|XP_006842050.1|  hypothetical protein AMTR_s00078p00023610        65.1    3e-09   
gb|AEE81082.1|  beta-1,3-glucanase                                    64.7    3e-09   
dbj|BAE53382.1|  beta-1,3-glucanase                                   64.7    3e-09   
gb|KDO39186.1|  hypothetical protein CISIN_1g018955mg                 64.7    3e-09   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    3e-09   
dbj|BAD54223.1|  putative beta-1,3-glucanase precursor                64.7    3e-09   
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                  65.1    3e-09   
gb|AAB24398.1|  beta-1,3-glucanase                                    64.7    3e-09   
gb|AFU52645.1|  beta-1,3-glucanase 10                                 65.1    3e-09   
ref|XP_008781529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    3e-09   
ref|XP_010525511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    3e-09   
emb|CAA92278.1|  1,3-beta-glucanase                                   64.7    3e-09   
gb|KDO40853.1|  hypothetical protein CISIN_1g0197552mg                64.3    3e-09   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg           65.1    3e-09   
ref|XP_010478704.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    3e-09   
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                   65.1    3e-09   
ref|XP_003554152.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  64.3    3e-09   
gb|EMS66018.1|  Glucan endo-1,3-beta-glucosidase 14                   64.7    3e-09   
ref|XP_009790437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  64.3    3e-09   
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    3e-09   
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    3e-09   
gb|AAM66024.1|  beta-1,3-glucanase-like protein                       65.1    3e-09   
emb|CAA82271.1|  beta-1,3-glucanase                                   64.3    4e-09   
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    4e-09   
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    65.1    4e-09   
ref|XP_009380509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    4e-09   
ref|XP_009599343.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.3    4e-09   
ref|XP_006657798.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    4e-09   
ref|XP_006491499.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.3    4e-09   
gb|AAZ40342.1|  beta-1,3-glucanase 2                                  64.7    4e-09   
gb|KFK45032.1|  hypothetical protein AALP_AA1G335200                  64.7    4e-09   
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530        65.1    4e-09   
ref|XP_010499813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    4e-09   
ref|XP_011017783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.7    4e-09   
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.1    4e-09   



>emb|CDP03239.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            MG  F L+   SLLL+L+G+C+GSK+GVCYGRNADDLPTPDKAVQLIQ HNIKYVRIYDS
Sbjct  1    MGRSFILVLVTSLLLMLIGVCQGSKVGVCYGRNADDLPTPDKAVQLIQNHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFAN+GIEL+IGIPNSDLLPFSQFQSN
Sbjct  61   NIQVLKAFANSGIELVIGIPNSDLLPFSQFQSN  93



>ref|NP_001275363.1| glucan endo-1,3-beta-glucosidase 13-like precursor [Solanum tuberosum]
 gb|AFU52637.1| beta-1,3-glucanase 2 [Solanum tuberosum]
Length=496

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F +IFA S+LL++LGICR S++G+CYGRNADDLPTP+KAVQLIQ HNIKYVRIYDS
Sbjct  1    MARGFSIIFAASVLLVILGICRASRVGICYGRNADDLPTPEKAVQLIQMHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTGIELMIGIPNSDLL FSQF+SN
Sbjct  61   NIQVLKAFANTGIELMIGIPNSDLLAFSQFESN  93



>ref|XP_011078239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Sesamum 
indicum]
Length=494

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            MG  F L+FA   LL+LLGIC G KIGVCYGRNADDLPTPDKAVQLIQ HNIKY+RIYDS
Sbjct  1    MGSGFVLLFASFQLLMLLGICEGGKIGVCYGRNADDLPTPDKAVQLIQLHNIKYIRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTGIELMIGIPNSDLL FSQFQ+N
Sbjct  61   NIQVLKAFANTGIELMIGIPNSDLLAFSQFQTN  93



>ref|XP_004251644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Solanum lycopersicum]
Length=496

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F +IFA ++LL++LGICR S++G+CYGRNADDLPTP+KAVQLIQ HNIKYVRIYDS
Sbjct  1    MARGFSIIFAATVLLVILGICRASRVGICYGRNADDLPTPEKAVQLIQMHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTGIELMIG+PNSDLL FSQF+SN
Sbjct  61   NIQVLKAFANTGIELMIGVPNSDLLAFSQFESN  93



>ref|XP_004287489.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            MG  FRL+FA   LL++L +C GS +G+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDS
Sbjct  1    MGCGFRLVFAILQLLVILDLCEGSIVGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIG+PNSDLLPFSQFQ+N
Sbjct  61   NIQVLKAFANTGVELMIGVPNSDLLPFSQFQTN  93



>ref|XP_009628676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana tomentosiformis]
Length=496

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 1/90 (1%)
 Frame = +3

Query  270  FRLI-FACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            FR+I FA SLLL++LGICR SK+GVCYGRNADDLPTPDK VQLIQ HNIKYVR+YDSNIQ
Sbjct  5    FRIIIFATSLLLMILGICRASKVGVCYGRNADDLPTPDKVVQLIQLHNIKYVRMYDSNIQ  64

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAFANTGIELMIGIPNSDLL F+QFQSN
Sbjct  65   VLKAFANTGIELMIGIPNSDLLAFAQFQSN  94



>ref|XP_009776400.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana sylvestris]
Length=496

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 84/90 (93%), Gaps = 1/90 (1%)
 Frame = +3

Query  270  FR-LIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            FR +IF+ SLLLL+LGICR SK+GVCYGRNADDLPTPDK VQLIQ HNIKYVRIYDSNIQ
Sbjct  5    FRVIIFSTSLLLLILGICRASKVGVCYGRNADDLPTPDKVVQLIQLHNIKYVRIYDSNIQ  64

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAFANTGIELMIGIPNSDLL F+QFQSN
Sbjct  65   VLKAFANTGIELMIGIPNSDLLAFAQFQSN  94



>gb|KDO55852.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=446

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F L FA SLLL LLG+C+GS IGVCYGRNADDLPTPDK  QL++QHNIKY+RIYDS
Sbjct  1    MARGFELFFAISLLLALLGLCKGSTIGVCYGRNADDLPTPDKVAQLVKQHNIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIGIPNSDLLPF+QFQSN
Sbjct  61   NIQVLKAFANTGVELMIGIPNSDLLPFAQFQSN  93



>ref|XP_009352572.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Pyrus x bretschneideri]
Length=502

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +3

Query  267  WFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            +FRL+ A SLL +LL +CRGS IG+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDSNIQ
Sbjct  5    FFRLLIATSLLPILLDVCRGSTIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDSNIQ  64

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAFANTG+ELMIG+PNSDLL FSQFQSN
Sbjct  65   VLKAFANTGVELMIGVPNSDLLAFSQFQSN  94



>ref|XP_006451337.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 ref|XP_006475345.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Citrus sinensis]
 gb|ESR64577.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 gb|KDO55851.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=501

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F L FA SLLL LLG+C+GS IGVCYGRNADDLPTPDK  QL++QHNIKY+RIYDS
Sbjct  1    MARGFELFFAISLLLALLGLCKGSTIGVCYGRNADDLPTPDKVAQLVKQHNIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIGIPNSDLLPF+QFQSN
Sbjct  61   NIQVLKAFANTGVELMIGIPNSDLLPFAQFQSN  93



>ref|XP_002283473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera]
 emb|CBI27983.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   FRLIFA SLLL LLG+CRGS IGVCYGRNADDLPTPDK  QL+Q H IKY+RIYDS
Sbjct  1    MARGFRLIFATSLLLTLLGLCRGSTIGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIGI NSDLLPFSQFQSN
Sbjct  61   NIQVLKAFANTGVELMIGISNSDLLPFSQFQSN  93



>ref|XP_008337610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Malus domestica]
Length=503

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  267  WFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            +FRL+FA SLLL+LL +C GS IG+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDSNIQ
Sbjct  5    FFRLLFATSLLLILLDVCWGSTIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDSNIQ  64

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  65   VLKAFANTGVELMVGVPNSDLLAFSQFQSN  94



>ref|XP_007204831.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
 gb|EMJ06030.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
Length=497

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   FRLIFA SLLL LL +CRGS IG+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDS
Sbjct  1    MASGFRLIFATSLLLALLDLCRGSTIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAF NTG+ELMIG+PNSDLL  SQ+QSN
Sbjct  61   NIQVLKAFGNTGVELMIGVPNSDLLAISQYQSN  93



>ref|XP_010049602.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Eucalyptus grandis]
 gb|KCW82303.1| hypothetical protein EUGRSUZ_C03710 [Eucalyptus grandis]
Length=500

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            MG  FRLIFA SLLL+LL +CRGS IG+CYGRNADDLPTPDK  QL++ HNIKY+RIYDS
Sbjct  1    MGRGFRLIFATSLLLMLLDLCRGSTIGICYGRNADDLPTPDKVAQLVKLHNIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG++L+IGI NSDLLPFSQFQSN
Sbjct  61   NIQVLKAFANTGVQLIIGISNSDLLPFSQFQSN  93



>ref|XP_008242469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Prunus 
mume]
Length=497

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   FRLIFA SLLL LL +CRGS IG+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDS
Sbjct  1    MTSGFRLIFATSLLLALLDLCRGSTIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAF NTG+ELMIG+PNSDLL  SQ+QSN
Sbjct  61   NIQVLKAFGNTGVELMIGVPNSDLLAISQYQSN  93



>ref|XP_010688353.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   FRLIFA SLLL LL +C GSKIG+CYGRN DDLPTPDKA +LI+QHNIKYVRIYDS
Sbjct  1    MAWRFRLIFAASLLLTLLALCSGSKIGICYGRNGDDLPTPDKAAELIKQHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIG+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMIGVPNSDLLAFSQFQSN  93



>ref|XP_007012991.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
 gb|EOY30610.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
Length=460

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+L+FA SLLLLLL  CRGS +GVCYGRNADDLPTPDK  QL+Q H IKY+RIYDS
Sbjct  1    MASRFKLVFAVSLLLLLLDFCRGSIVGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLAFSQFQSN  93



>ref|XP_007012989.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY30608.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=505

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+L+FA SLLLLLL  CRGS +GVCYGRNADDLPTPDK  QL+Q H IKY+RIYDS
Sbjct  1    MASRFKLVFAVSLLLLLLDFCRGSIVGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLAFSQFQSN  93



>ref|XP_007012992.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
 gb|EOY30611.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
Length=475

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+L+FA SLLLLLL  CRGS +GVCYGRNADDLPTPDK  QL+Q H IKY+RIYDS
Sbjct  1    MASRFKLVFAVSLLLLLLDFCRGSIVGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLAFSQFQSN  93



>gb|KDP33779.1| hypothetical protein JCGZ_07350 [Jatropha curcas]
Length=499

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+ IFA SLLL LL  CRGS IGVCYGRNADDLPTPDK  QL++QHNIKY+RIYDS
Sbjct  1    MARGFKPIFAVSLLLTLLVYCRGSTIGVCYGRNADDLPTPDKVAQLVRQHNIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL  SQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLALSQFQSN  93



>ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF48155.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=511

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M + F+LIFA SLLL LL  CRGS IGVCYGRNADDLPTPDK  QL+QQ  IKY+RIYDS
Sbjct  1    MAVGFKLIFAISLLLTLLVFCRGSTIGVCYGRNADDLPTPDKVAQLVQQQKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL  SQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLALSQFQSN  93



>gb|KJB65051.1| hypothetical protein B456_010G078300 [Gossypium raimondii]
Length=506

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F L+FA SLLLLLL  CRGS +GVCYGRNADDLPTPDK V+L+Q H IKY+RIYDS
Sbjct  1    MASRFNLVFAVSLLLLLLDFCRGSIVGVCYGRNADDLPTPDKVVKLVQLHKIKYLRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVGVPNSDLLAFSQFQSN  93



>gb|EYU30694.1| hypothetical protein MIMGU_mgv1a005031mg [Erythranthe guttata]
Length=500

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  261  GMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSN  440
            G + +L+F C  L L LG CRG KIG+CYGRNADDLP P+KAVQLIQ HNIKYVRIYDSN
Sbjct  4    GGFVQLVFICFQLFLFLGTCRGGKIGICYGRNADDLPPPEKAVQLIQLHNIKYVRIYDSN  63

Query  441  IQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            IQ+LKAFANT IEL+I IPNSDLLPFSQFQ+N
Sbjct  64   IQLLKAFANTNIELIIAIPNSDLLPFSQFQTN  95



>gb|KJB27173.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=481

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+L+FA SL  LLL  C GS +GVCYGRNADDLPTPDK V+LI+ HNIKYVRIYDS
Sbjct  1    MASAFKLLFAVSLFTLLLRFCSGSIVGVCYGRNADDLPTPDKVVELIKLHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+ +PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVAVPNSDLLAFSQFQSN  93



>gb|KJB27172.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=504

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+L+FA SL  LLL  C GS +GVCYGRNADDLPTPDK V+LI+ HNIKYVRIYDS
Sbjct  1    MASAFKLLFAVSLFTLLLRFCSGSIVGVCYGRNADDLPTPDKVVELIKLHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+ +PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGVELMVAVPNSDLLAFSQFQSN  93



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            +CR S IGVCYGRNADDLPTPDK  QL+  HNIKYVRIYDSNIQVLKAFANTG+ELMIGI
Sbjct  22   LCRASTIGVCYGRNADDLPTPDKVAQLVHLHNIKYVRIYDSNIQVLKAFANTGVELMIGI  81

Query  495  PNSDLLPFSQFQSN  536
            PNSDLLPFSQFQSN
Sbjct  82   PNSDLLPFSQFQSN  95



>gb|KHN16652.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=498

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LIFA SL LLLL  C GS +GVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MPTGFSLIFAASLFLLLLDCCSGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTGIELMIG+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGIELMIGVPNSDLLSFSQFQSN  93



>ref|XP_006584807.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
Length=498

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LIFA SL LLLL  C GS +GVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MPTGFSLIFAASLFLLLLDCCSGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTGIELMIG+PNSDLL FSQFQSN
Sbjct  61   NIQVLKAFANTGIELMIGVPNSDLLSFSQFQSN  93



>gb|AGV54422.1| glucan endo-1,3-beta-glucosidase 13-like protein [Phaseolus vulgaris]
Length=503

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LIFA SL LLLL  C GS IGVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MATRFTLIFAASLFLLLLDCCSGSFIGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIG+PNSDLL  SQFQSN
Sbjct  61   NIQVLKAFANTGVELMIGVPNSDLLSLSQFQSN  93



>ref|XP_007160277.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
 gb|ESW32271.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
Length=501

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LIFA SL LLLL  C GS IGVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MATRFTLIFAASLFLLLLDCCSGSFIGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELMIG+PNSDLL  SQFQSN
Sbjct  61   NIQVLKAFANTGVELMIGVPNSDLLSLSQFQSN  93



>ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 ref|XP_004158423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN66191.1| hypothetical protein Csa_1G575070 [Cucumis sativus]
Length=501

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = +3

Query  270  FRLIF-ACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            F LIF   SL L+LLG C+GS +GVCYGRNADDLPTP+K  QL++ HNIKY+RIYDSNIQ
Sbjct  7    FNLIFLGISLFLILLGHCQGSNVGVCYGRNADDLPTPNKVAQLVKLHNIKYIRIYDSNIQ  66

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAFANTG+ELMIG+PNSDLLPF+QFQSN
Sbjct  67   VLKAFANTGVELMIGVPNSDLLPFAQFQSN  96



>ref|XP_006371969.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP49766.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=499

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            CRGS IGVCYGRNADDLPTPDK  QL+QQH IKY+RIYDS+IQVLKAFANTG+ELMIGI 
Sbjct  22   CRGSTIGVCYGRNADDLPTPDKVAQLVQQHKIKYLRIYDSSIQVLKAFANTGVELMIGIT  81

Query  498  NSDLLPFSQFQSN  536
            NSDLLPFSQFQSN
Sbjct  82   NSDLLPFSQFQSN  94



>ref|XP_009394832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C GSK+GVCYGRNADDLPTPDK  QL+Q H+IKYVRIYDSNIQV+KAFANTG+ELM+G+P
Sbjct  24   CNGSKVGVCYGRNADDLPTPDKVAQLVQLHSIKYVRIYDSNIQVIKAFANTGVELMVGVP  83

Query  498  NSDLLPFSQFQSN  536
            NSDLLPFSQ+QSN
Sbjct  84   NSDLLPFSQYQSN  96



>ref|XP_011009861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Populus euphratica]
Length=499

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            CRGS IGVCYGRNADDLPTPDK  QL+QQH IKY+RIYDS+IQVLKAFANTG+ELMIGI 
Sbjct  22   CRGSTIGVCYGRNADDLPTPDKVAQLVQQHKIKYLRIYDSSIQVLKAFANTGVELMIGIT  81

Query  498  NSDLLPFSQFQSN  536
            NSDLLPFSQFQSN
Sbjct  82   NSDLLPFSQFQSN  94



>ref|XP_010267108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            +CR S IGVCYGRNADDLPTPDK  QL+Q H IKY+RIYDSNIQVLKAFANTG+ELMIGI
Sbjct  24   LCRASTIGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDSNIQVLKAFANTGVELMIGI  83

Query  495  PNSDLLPFSQFQSN  536
            PNSDLLPFSQFQ+N
Sbjct  84   PNSDLLPFSQFQAN  97



>ref|XP_009394833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C GSK+GVCYGRNADDLPTPDK  QL+Q H+IKYVRIYDSNIQV+KAFANTG+ELM+G+P
Sbjct  24   CNGSKVGVCYGRNADDLPTPDKVAQLVQLHSIKYVRIYDSNIQVIKAFANTGVELMVGVP  83

Query  498  NSDLLPFSQFQSN  536
            NSDLLPFSQ+QSN
Sbjct  84   NSDLLPFSQYQSN  96



>ref|XP_006401304.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
 gb|ESQ42757.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
Length=506

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+LIFA SLLLLLLG C G K+GVCYGR+ADDLPTP+K VQLI+QHNI+YVRIYD 
Sbjct  1    MARDFKLIFAISLLLLLLGYCHGGKVGVCYGRSADDLPTPEKVVQLIKQHNIQYVRIYDY  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            N QVLKAF NT IELMIG+PNSDL  FSQFQSN
Sbjct  61   NPQVLKAFGNTSIELMIGVPNSDLTAFSQFQSN  93



>gb|KHG04832.1| hypothetical protein F383_29565 [Gossypium arboreum]
Length=512

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F L+FA SLLLLL   CRGS +GVCYGRNADDLPTPDK  +L+Q H IKY+RIYDS
Sbjct  1    MASRFNLVFAVSLLLLL-DFCRGSIVGVCYGRNADDLPTPDKVAKLVQLHKIKYLRIYDS  59

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            NIQVLKAFANTG+ELM+G+PNSDLL FSQFQSN
Sbjct  60   NIQVLKAFANTGVELMVGVPNSDLLAFSQFQSN  92



>ref|XP_008242470.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Prunus 
mume]
Length=491

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            +CRGS IG+CYGRNADDLPTPDKA QL+Q HNIKYVRIYDSNIQVLKAF NTG+ELMIG+
Sbjct  14   LCRGSTIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDSNIQVLKAFGNTGVELMIGV  73

Query  495  PNSDLLPFSQFQSN  536
            PNSDLL  SQ+QSN
Sbjct  74   PNSDLLAISQYQSN  87



>ref|XP_008450796.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=501

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C+GS +GVCYGRNADDLPTP+K  QL++ HNIKY+RIYDSNIQVLKAFANTG+ELMIG
Sbjct  22   GHCQGSNVGVCYGRNADDLPTPNKVAQLVKLHNIKYIRIYDSNIQVLKAFANTGVELMIG  81

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLLPF+QFQSN
Sbjct  82   VPNSDLLPFAQFQSN  96



>gb|EPS73640.1| hypothetical protein M569_01113 [Genlisea aurea]
Length=508

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G  +G+CYGRNADDLPTPDKAVQLI+  NIKY RIYDSNIQV+KAFANTGIEL+IG
Sbjct  19   GFCNGGTVGICYGRNADDLPTPDKAVQLIKSQNIKYARIYDSNIQVIKAFANTGIELVIG  78

Query  492  IPNSDLLPFSQFQSN  536
            IPNSDLLPFSQFQSN
Sbjct  79   IPNSDLLPFSQFQSN  93



>ref|XP_008799775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Phoenix 
dactylifera]
Length=526

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G+C GSKIGVCYGRNADDLP+PDK  QL++ H+IKYVRIYDSNIQV+KAFANTG+ELMIG
Sbjct  48   GLCSGSKIGVCYGRNADDLPSPDKVAQLVKLHSIKYVRIYDSNIQVIKAFANTGVELMIG  107

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL FSQ+QSN
Sbjct  108  VPNSDLLAFSQYQSN  122



>ref|XP_008795501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Phoenix dactylifera]
Length=502

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G+CRGSKIGVCYGRNADDLP PDK  QL+  H IKYVRIYDSNIQV+KAFANTG+ELM+G
Sbjct  24   GLCRGSKIGVCYGRNADDLPIPDKVAQLVNLHQIKYVRIYDSNIQVIKAFANTGVELMVG  83

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL FSQ+QSN
Sbjct  84   VPNSDLLAFSQYQSN  98



>gb|KHG26459.1| hypothetical protein F383_04538 [Gossypium arboreum]
Length=488

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G CRGS +GVCYGR+ADDLPTPDK V+LI+ HNIKYVRIYDSNIQVLKAFANTG+ELM+ 
Sbjct  3    GFCRGSIVGVCYGRSADDLPTPDKVVELIKLHNIKYVRIYDSNIQVLKAFANTGVELMVA  62

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL FSQFQSN
Sbjct  63   VPNSDLLAFSQFQSN  77



>ref|XP_009120169.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Brassica rapa]
Length=503

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  RLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVL  452
            +LIF+ SLLLLLL  C G K+GVCYGR+ADDLPTP K VQLI+QHNIKYVRIYDSN QVL
Sbjct  3    KLIFSISLLLLLLDGCYGGKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDSNSQVL  62

Query  453  KAFANTGIELMIGIPNSDLLPFSQFQSN  536
            KAFANT IELMIG+PNSDL PFSQFQSN
Sbjct  63   KAFANTTIELMIGVPNSDLKPFSQFQSN  90



>ref|XP_010545323.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=501

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            MG      FA SLLLLLLG C G K+GVCYGR+ADDLPTPDK  QLI+QHNIKYVRIYDS
Sbjct  1    MGRDLSFCFAISLLLLLLGCCNGGKVGVCYGRSADDLPTPDKVSQLIRQHNIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            ++QVLKAFAN+GIELMIG+PNSDLL FS  QSN
Sbjct  61   DVQVLKAFANSGIELMIGVPNSDLLSFSHHQSN  93



>ref|XP_004513066.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cicer arietinum]
Length=506

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  261  GMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSN  440
            G WF ++ + SL LLLL  C GS +G+CYGRNADDLP+PDK  QL+Q H IKYVRIYDSN
Sbjct  4    GFWF-ILTSASLFLLLLDCCHGSFVGICYGRNADDLPSPDKVAQLVQDHKIKYVRIYDSN  62

Query  441  IQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            IQVLKAF NTG+ELMIGIPN DLLPFSQFQ+N
Sbjct  63   IQVLKAFTNTGVELMIGIPNLDLLPFSQFQTN  94



>gb|KHM99816.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=455

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LI A SL LLLL  C GS +GVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MPTGFTLISAASLFLLLLDCCSGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            N+QVLKAFANTGIELMIG+PNSDLL  SQFQSN
Sbjct  61   NLQVLKAFANTGIELMIGVPNSDLLSLSQFQSN  93



>emb|CDY32869.1| BnaC09g33160D [Brassica napus]
Length=503

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  RLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVL  452
            +LIF+ SLLLLLL  C G K+GVCYGR+ADDLPTP K VQLI+QHNIKYVRIYD N QVL
Sbjct  3    KLIFSISLLLLLLDGCYGGKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDYNSQVL  62

Query  453  KAFANTGIELMIGIPNSDLLPFSQFQSN  536
            KAFANT IELMIG+PNSDL PFSQFQSN
Sbjct  63   KAFANTSIELMIGVPNSDLKPFSQFQSN  90



>ref|XP_006580483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Glycine max]
Length=499

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F LI A SL LLLL  C GS +GVCYGR+ADDLPTPDK  QL+Q H IKYVRIYDS
Sbjct  1    MPTGFTLISAASLFLLLLDCCSGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDS  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            N+QVLKAFANTGIELMIG+PNSDLL  SQFQSN
Sbjct  61   NLQVLKAFANTGIELMIGVPNSDLLSLSQFQSN  93



>ref|XP_010110871.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC28690.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=1369

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            +C GS +GVCYGRNADDLP PDKA +L++ HNIKYVRIYDSN+QVLKAFANTGIELMIG+
Sbjct  522  LCSGSFVGVCYGRNADDLPVPDKAAELVKLHNIKYVRIYDSNVQVLKAFANTGIELMIGV  581

Query  495  PNSDLLPFSQFQSN  536
            PNSDLLPFSQFQSN
Sbjct  582  PNSDLLPFSQFQSN  595



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G+CRGSKIGVCYGRNADDLPTPDK  QL++   IKYVRIYDSNIQV+KAFAN G+ELM+G
Sbjct  18   GLCRGSKIGVCYGRNADDLPTPDKVAQLVKLQQIKYVRIYDSNIQVIKAFANIGVELMVG  77

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL FSQ+QSN
Sbjct  78   VPNSDLLAFSQYQSN  92



>emb|CDY64970.1| BnaAnng19910D [Brassica napus]
Length=503

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  RLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVL  452
            +LIF+ SLLLLLL  C G K+GVCYGR+ADDLPTP K VQLI+QHNIKYVRIYDSN QVL
Sbjct  3    KLIFSISLLLLLLDGCYGGKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDSNSQVL  62

Query  453  KAFANTGIELMIGIPNSDLLPFSQFQSN  536
            KAFANT IELMIG+PNSDL  FSQFQSN
Sbjct  63   KAFANTTIELMIGVPNSDLKAFSQFQSN  90



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C G KIGVCYGRNADDLPTPDK  QL++ H+IKYVRIYDSNIQV+KAFANTG+ELMIG+P
Sbjct  50   CSGGKIGVCYGRNADDLPTPDKVAQLVRLHSIKYVRIYDSNIQVIKAFANTGVELMIGVP  109

Query  498  NSDLLPFSQFQSN  536
            NSDLL FSQ+QSN
Sbjct  110  NSDLLAFSQYQSN  122



>gb|AIR93910.1| glucanase [Cicer arietinum]
Length=454

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C GS IG+CYGRNADDLPTPDK  QL+Q H IKYVRIYDSNIQVLKAFANTG+ELMIG+P
Sbjct  21   CSGSFIGICYGRNADDLPTPDKVAQLVQLHKIKYVRIYDSNIQVLKAFANTGVELMIGVP  80

Query  498  NSDLLPFSQFQSN  536
            NSDLL  SQFQSN
Sbjct  81   NSDLLSLSQFQSN  93



>gb|ABD91577.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  261  GMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSN  440
            G WF L+ A S+LL+LL  C GS +G+CYGRNADDLP  DK  QL+Q H IKYVRIYDSN
Sbjct  4    GFWFILVVA-SVLLMLLDCCNGSFVGICYGRNADDLPPLDKVSQLVQDHKIKYVRIYDSN  62

Query  441  IQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            IQVLK+FANTG+ELMIGIPN DLLPFSQFQ+N
Sbjct  63   IQVLKSFANTGVELMIGIPNLDLLPFSQFQTN  94



>gb|ABD91576.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  261  GMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSN  440
            G WF L+ A S+LL+LL  C GS +G+CYGRNADDL  PDK  QL+Q H IKYVRIYDSN
Sbjct  4    GFWFILVVA-SVLLMLLDCCYGSFVGICYGRNADDLLPPDKVSQLVQDHKIKYVRIYDSN  62

Query  441  IQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            IQVLK+FANTG+ELMIGIPN DLLPFSQFQ+N
Sbjct  63   IQVLKSFANTGVELMIGIPNLDLLPFSQFQTN  94



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K+G+CYGRNADDLP PDK VQLIQQ ++KYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  16   GHCLGGKVGICYGRNADDLPAPDKVVQLIQQQSLKYVRIYDTNIDVIKAFANTGVELMVG  75

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLLPF+Q+QSN
Sbjct  76   VPNSDLLPFAQYQSN  90



>ref|NP_001044198.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAD86947.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAF06112.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAG88936.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K+G+CYGRNADDLP PDK VQLIQQ ++KYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  16   GHCLGGKVGICYGRNADDLPAPDKVVQLIQQQSLKYVRIYDTNIDVIKAFANTGVELMVG  75

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLLPF+Q+QSN
Sbjct  76   VPNSDLLPFAQYQSN  90



>gb|EAZ13481.1| hypothetical protein OsJ_03397 [Oryza sativa Japonica Group]
Length=474

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K+G+CYGRNADDLP PDK VQLIQQ ++KYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  16   GHCLGGKVGICYGRNADDLPAPDKVVQLIQQQSLKYVRIYDTNIDVIKAFANTGVELMVG  75

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLLPF+Q+QSN
Sbjct  76   VPNSDLLPFAQYQSN  90



>ref|XP_002864470.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40729.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M   F+LIF+ SLLLLLL  C G K+GVCYGR+ADDLPTP K VQLIQQHNIKYVRIYD 
Sbjct  1    MARDFKLIFSISLLLLLLDCCYGGKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDY  60

Query  438  NIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            N QVLKAF NT IELMIG+PNSDL  FSQ QSN
Sbjct  61   NSQVLKAFGNTSIELMIGVPNSDLNAFSQSQSN  93



>ref|XP_004969893.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=496

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G CRG KIG+CYGRNADDLP PDK  QLIQQ +IKYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  19   GHCRGGKIGICYGRNADDLPGPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL F+Q+QSN
Sbjct  79   VPNSDLLAFAQYQSN  93



>gb|AGA95870.1| beta-1,3-glucanase [Arachis hypogaea]
 gb|AGA95871.1| beta-1,3-glucanase [Arachis hypogaea]
Length=348

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C GS IG+CYGRNADDLPTPDK  QL+Q H IKYVRIYDSNIQVLKAFANT +ELM+G+P
Sbjct  24   CSGSFIGICYGRNADDLPTPDKVSQLVQLHKIKYVRIYDSNIQVLKAFANTPVELMVGVP  83

Query  498  NSDLLPFSQFQSN  536
            NSDLL  SQFQSN
Sbjct  84   NSDLLSLSQFQSN  96



>gb|KEH27229.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=507

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C GS +G+CYGRNADDLP PDK  QL+Q H IKYVRIYDSNIQVLK+FANTG+ELMIGIP
Sbjct  22   CYGSFVGICYGRNADDLPPPDKVSQLVQDHKIKYVRIYDSNIQVLKSFANTGVELMIGIP  81

Query  498  NSDLLPFSQFQSN  536
            N DLLPFSQFQ+N
Sbjct  82   NLDLLPFSQFQTN  94



>ref|XP_006853717.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
 gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             S IG+CYGRN DDLPTPDKAVQLIQ H+IKYVRIYDSNIQVLKAFANTGIELMIGIPN+
Sbjct  11   ASIIGICYGRNGDDLPTPDKAVQLIQGHSIKYVRIYDSNIQVLKAFANTGIELMIGIPNA  70

Query  504  DLLPFSQFQSN  536
            DLL FSQ+QSN
Sbjct  71   DLLAFSQYQSN  81



>ref|XP_002456331.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
 gb|EES01451.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Length=497

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G KIGVCYGRNADDLP PDK  QLIQQ +IKYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  20   GQCHGGKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVG  79

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL F+Q+QSN
Sbjct  80   VPNSDLLAFAQYQSN  94



>gb|EEC71452.1| hypothetical protein OsI_03677 [Oryza sativa Indica Group]
Length=493

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K+G+CYGRNADDLP PDK +QLIQQ ++KYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  16   GHCLGGKVGICYGRNADDLPAPDKVMQLIQQQSLKYVRIYDTNIDVIKAFANTGVELMVG  75

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLLPF+Q+QSN
Sbjct  76   VPNSDLLPFAQYQSN  90



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G KIGVCYGRNADDLP PDK  QLIQQ +IKYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  19   GQCHGGKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL F+Q+QSN
Sbjct  79   VPNSDLLAFAQYQSN  93



>gb|AAC04713.1| beta-1,3-glucanase 7 [Glycine max]
Length=245

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLL  512
            I VCYGR+ADDLPTPDK  QL+Q H IKYVRIYDSNIQVLKAFANTGIELMIG+PNSDLL
Sbjct  2    IRVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDSNIQVLKAFANTGIELMIGVPNSDLL  61

Query  513  PFSQFQSN  536
             FSQFQSN
Sbjct  62   SFSQFQSN  69



>ref|NP_001144992.1| uncharacterized protein LOC100278152 precursor [Zea mays]
 gb|ACG44298.1| hypothetical protein [Zea mays]
Length=477

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G KIGVCYGRNADDLP PDK  QLIQQ +IKYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  19   GQCHGGKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL F+Q+QSN
Sbjct  79   VPNSDLLAFAQYQSN  93



>ref|XP_008672637.1| PREDICTED: uncharacterized protein LOC100278152 isoform X1 [Zea 
mays]
Length=653

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G KIGVCYGRNADDLP PDK  QLIQQ +IKYVRIYD+NI V+KAFANTG+ELM+G
Sbjct  176  GQCHGGKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVG  235

Query  492  IPNSDLLPFSQFQSN  536
            +PNSDLL F+Q+QSN
Sbjct  236  VPNSDLLAFAQYQSN  250



>ref|XP_003569762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G CRG K G+CYGRNADDLP PDK VQLIQ+ +IK+VRIYD+NI V+KAFANTG+ELM+G
Sbjct  21   GHCRGGKTGICYGRNADDLPAPDKVVQLIQKQSIKHVRIYDTNIDVIKAFANTGVELMVG  80

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL F+Q+QSN
Sbjct  81   VPNADLLAFAQYQSN  95



>ref|XP_010232285.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Brachypodium 
distachyon]
Length=497

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G CRG K G+CYGRNADDLP PDK VQLIQ+ +IK+VRIYD+NI V+KAFANTG+ELM+G
Sbjct  21   GHCRGGKTGICYGRNADDLPAPDKVVQLIQKQSIKHVRIYDTNIDVIKAFANTGVELMVG  80

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL F+Q+QSN
Sbjct  81   VPNADLLAFAQYQSN  95



>ref|XP_010476823.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=503

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = +3

Query  270  FRLIFACSllllllGI--CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNI  443
            F+LIF+ SLLLLLL +  C G K+GVCYGR+ADDLPTP K VQLIQQHNIKYVRIYD N 
Sbjct  6    FKLIFSISLLLLLLLLDCCYGGKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNS  65

Query  444  QVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            QVLKAF NT IELMIG+PNSDL  FSQ Q+N
Sbjct  66   QVLKAFGNTSIELMIGVPNSDLNAFSQSQTN  96



>ref|XP_010446151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=473

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = +3

Query  270  FRLIFACSllllllGI--CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNI  443
            F+LIF+ SLLLLLL +  C G K+GVCYGR+ADDLPTP K VQLIQQHNIKYVRIYD N 
Sbjct  6    FKLIFSISLLLLLLLLDCCYGGKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNS  65

Query  444  QVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            QVLKAF NT IELMIG+PNSDL  FSQ Q+N
Sbjct  66   QVLKAFGNTSIELMIGVPNSDLNAFSQSQAN  96



>dbj|BAJ85556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K G+CYGRNADDLP PDK  QLIQQ +IKYVRIYD+N+ V+KAFANT +ELM+G
Sbjct  19   GHCHGGKTGICYGRNADDLPGPDKVAQLIQQQSIKYVRIYDANVDVIKAFANTSVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL FSQ+QSN
Sbjct  79   VPNADLLAFSQYQSN  93



>ref|NP_200470.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q9FJU9.1|E1313_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 13; AltName: Full=(1->3)-beta-glucan 
endohydrolase 13; Short=(1->3)-beta-glucanase 
13; AltName: Full=Beta-1,3-endoglucanase 13; Short=Beta-1,3-glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09876.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAL91612.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AAM91467.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AED96784.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=506

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C G K+GVCYGR+ADDLPTP K VQLIQQHNIKYVRIYD N QVLKAF NT IELMIG+P
Sbjct  21   CYGGKVGVCYGRSADDLPTPSKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVP  80

Query  498  NSDLLPFSQFQSN  536
            NSDL  FSQ QSN
Sbjct  81   NSDLNAFSQSQSN  93



>ref|XP_010483135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Camelina sativa]
Length=509

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +3

Query  270  FRLIFACSllllllGI--CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNI  443
            F LIF+ SLLLLLL +  C G K+GVCYGR+ADDLPTP K VQLIQQHNIKYVRIYD N 
Sbjct  6    FNLIFSISLLLLLLLLDCCYGGKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNS  65

Query  444  QVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            QVLKAF NT IELMIG+PNSDL  FSQ Q+N
Sbjct  66   QVLKAFGNTSIELMIGVPNSDLNAFSQSQTN  96



>ref|XP_002867412.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43671.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +3

Query  258  MGMWFRLIFA-CSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYD  434
            MG    LIF  C  ++  L   + SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD
Sbjct  1    MGTRLNLIFCICVSIVAFLDFGKASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYD  60

Query  435  SNIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            +NI VLKAFANTG+ELMIG+PN+DLL F+QFQSN
Sbjct  61   ANIDVLKAFANTGVELMIGVPNADLLAFAQFQSN  94



>gb|EMT15518.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=530

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K G+CYGRNADDLP PDK  QLI+Q +IKYVRIYD+NI V+KAFANT +ELM+G
Sbjct  19   GHCHGGKTGICYGRNADDLPGPDKVAQLIRQQSIKYVRIYDTNIDVIKAFANTSVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL FSQ+QSN
Sbjct  79   VPNADLLAFSQYQSN  93



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K G+CYGRNADDLP PDK  QL++Q +IKYVRIYDSN+ V+KAFANT +ELM+G
Sbjct  19   GHCHGGKTGICYGRNADDLPGPDKVAQLVRQQSIKYVRIYDSNVDVIKAFANTSVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL FSQ+QSN
Sbjct  79   VPNADLLAFSQYQSN  93



>gb|EMS49856.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=494

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G C G K G+CYGRNADDLP PDK  QLIQQ +IKYVRIYD+N  V+KAFANT +ELM+G
Sbjct  19   GHCHGGKTGICYGRNADDLPGPDKVAQLIQQQSIKYVRIYDTNADVIKAFANTSVELMVG  78

Query  492  IPNSDLLPFSQFQSN  536
            +PN+DLL FSQ+QSN
Sbjct  79   VPNADLLAFSQYQSN  93



>ref|XP_010541008.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=535

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  267  WFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQ  446
            W  +   C L L+ L +   S IG+CYGRNAD+LP+PD+  +LIQQ +IKYVRIYD+NI 
Sbjct  6    WMLIFSVCVLSLVFLDLSSASTIGICYGRNADNLPSPDRVSELIQQLSIKYVRIYDANID  65

Query  447  VLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            VLKAF+NTG+ELMIG+PNSDLL FSQFQSN
Sbjct  66   VLKAFSNTGVELMIGVPNSDLLAFSQFQSN  95



>ref|XP_006412850.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
 gb|ESQ54303.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
Length=539

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  258  MGMWFRLIF-ACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYD  434
            MG   +LIF  C  +L  L     S IG+CYGRNAD+LP+P+K  +LIQ  NIK+VRIYD
Sbjct  1    MGKRLKLIFWICVYILAFLDFGMASNIGICYGRNADNLPSPNKVSELIQHLNIKFVRIYD  60

Query  435  SNIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            +NI VLKAFANTGIELMIG+PN+DLL F+QFQSN
Sbjct  61   ANIDVLKAFANTGIELMIGVPNADLLAFAQFQSN  94



>gb|KFK29497.1| hypothetical protein AALP_AA7G142000 [Arabis alpina]
Length=535

 Score =   123 bits (308),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P+K  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNKVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|XP_010438307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Camelina sativa]
Length=540

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|XP_010447863.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=538

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|XP_010433104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=541

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|XP_006280336.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
 gb|EOA13234.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
Length=508

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +3

Query  270  FRLIFACSllllllGI--CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNI  443
            F+LIF+ SL+LLLL +  C G K+GVCYGR+ADDLPTP K VQLI+QHNI YVRIYD N 
Sbjct  5    FKLIFSISLMLLLLLLDCCYGGKVGVCYGRSADDLPTPAKVVQLIKQHNIDYVRIYDYNS  64

Query  444  QVLKAFANTGIELMIGIPNSDLLPFSQFQS  533
            QVLKAF NT IELMIG+PNSDL  FSQ QS
Sbjct  65   QVLKAFGNTSIELMIGVPNSDLNAFSQSQS  94



>ref|XP_006285688.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
 gb|EOA18586.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
Length=538

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|XP_009128829.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=532

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LPTP+K  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  25   ASKIGICYGRNADNLPTPNKVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  84

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  85   DLLAFAQFQSN  95



>ref|NP_567828.3| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 gb|AAM65893.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AEE85621.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=488

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>emb|CAB79694.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
Length=512

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  2    ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  61

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  62   DLLAFAQFQSN  72



>emb|CDY06818.1| BnaC01g09170D [Brassica napus]
Length=502

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P+K   LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNKVSDLIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>ref|NP_849556.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 sp|Q8VYE5.1|E1312_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 12; AltName: Full=(1->3)-beta-glucan 
endohydrolase 12; Short=(1->3)-beta-glucanase 
12; AltName: Full=Beta-1,3-endoglucanase 12; Short=Beta-1,3-glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL59955.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM20105.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE85622.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=534

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             SKIG+CYGRNAD+LP+P++  +LIQ  NIK+VRIYD+NI VLKAFANTGIELMIG+PN+
Sbjct  24   ASKIGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>emb|CDY14214.1| BnaA08g13450D [Brassica napus]
Length=513

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  258  MGMWFRLIF-ACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYD  434
            M    +LIF  C  +L  L     S IG+CYGRNAD+LP+P+K  +LIQ  NIK+VRIYD
Sbjct  1    MSTRLKLIFWTCVSILAFLEFGVASNIGICYGRNADNLPSPNKVSELIQHLNIKFVRIYD  60

Query  435  SNIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
            SNI VLKAFANT IELMIG+PN+DLL F+QFQSN
Sbjct  61   SNIDVLKAFANTNIELMIGVPNADLLAFAQFQSN  94



>ref|XP_009109043.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Brassica 
rapa]
Length=534

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  258  MGMWFRLIF-ACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYD  434
            M    +LIF  C  +L  L +   S IG+CYGRNAD+LP+P+K  +LIQ  NIK+VRIYD
Sbjct  1    MSTRLKLIFWTCVSILAFLELGAASNIGICYGRNADNLPSPNKVSELIQHLNIKFVRIYD  60

Query  435  SNIQVLKAFANTGIELMIGIPNSDLLPFSQFQSN  536
             NI VLKAFANT IELMIG+PN+DLL F+QFQSN
Sbjct  61   YNIDVLKAFANTNIELMIGVPNADLLAFAQFQSN  94



>emb|CDY62033.1| BnaC03g77660D [Brassica napus]
Length=533

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             S IG+CYGRNAD+LP+P+K  +LIQ  NIK+VRIYD+NI VLKA ANT IELMIG+PN+
Sbjct  24   ASNIGICYGRNADNLPSPNKVSELIQHLNIKFVRIYDANIDVLKALANTNIELMIGVPNA  83

Query  504  DLLPFSQFQSN  536
            DLL F+QFQSN
Sbjct  84   DLLAFAQFQSN  94



>gb|EAY85760.1| hypothetical protein OsI_07118 [Oryza sativa Indica Group]
Length=603

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  GRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLPFSQF  527
             RNADDLP PDK VQLIQQ ++KY RIYD+NI V+KAFANTG+ELM+G+PNSDLLPF+ F
Sbjct  517  ARNADDLPAPDKVVQLIQQQSLKYARIYDTNIDVIKAFANTGVELMVGVPNSDLLPFAPF  576



>gb|EEE56938.1| hypothetical protein OsJ_06635 [Oryza sativa Japonica Group]
Length=700

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  GRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLPFSQF  527
             RNADDLP PDK VQLIQQ ++KY RIYD+NI V+KAFANTG+ELM+G+PNSDLLPF+ F
Sbjct  614  ARNADDLPAPDKVVQLIQQQSLKYARIYDTNIDVIKAFANTGVELMVGVPNSDLLPFAPF  673



>gb|KJB54308.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=489

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 3/73 (4%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
             CRGS +GV YG +AD+LP+PD+  QL++ HNI+Y+RIY+   +VLKAF+NTGIELM+G+
Sbjct  20   FCRGSNVGVDYGMDADNLPSPDQVAQLVRNHNIQYLRIYNYRPEVLKAFSNTGIELMVGV  79

Query  495  PNSDLLPFSQFQS  533
            PN+DL   SQFQS
Sbjct  80   PNADL---SQFQS  89



>gb|KJB54309.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=477

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 3/73 (4%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
             CRGS +GV YG +AD+LP+PD+  QL++ HNI+Y+RIY+   +VLKAF+NTGIELM+G+
Sbjct  20   FCRGSNVGVDYGMDADNLPSPDQVAQLVRNHNIQYLRIYNYRPEVLKAFSNTGIELMVGV  79

Query  495  PNSDLLPFSQFQS  533
            PN+DL   SQFQS
Sbjct  80   PNADL---SQFQS  89



>gb|KHG29271.1| hypothetical protein F383_14120 [Gossypium arboreum]
Length=545

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = +3

Query  321  RGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            +G K+GV +G +A++LP+PD+   L+Q+HNI+Y+RIYDS+ +VLK+ +N GIELM+G+ N
Sbjct  2    QGGKVGVDFGTDANNLPSPDQVSDLVQKHNIQYLRIYDSDPKVLKSLSNIGIELMVGVHN  61

Query  501  SDLLPFSQFQS  533
             DL   S+FQS
Sbjct  62   DDL---SKFQS  69



>gb|KJB54307.1| hypothetical protein B456_009G028200 [Gossypium raimondii]
Length=542

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 3/60 (5%)
 Frame = +3

Query  354  NADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLPFSQFQS  533
            +AD LP+P+K  QL++ HNI+Y+RIY+   +VL+AF+NTGIELM+G+PN+DL   SQFQS
Sbjct  2    DADYLPSPEKVAQLVRNHNIQYLRIYNYRPEVLRAFSNTGIELMVGVPNADL---SQFQS  58



>ref|XP_002994218.1| hypothetical protein SELMODRAFT_163389 [Selaginella moellendorffii]
 gb|EFJ04723.1| hypothetical protein SELMODRAFT_163389 [Selaginella moellendorffii]
Length=345

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M +WF L+F   +   + G   G+ +GV YGR A  LP+P + V+L++   +  VRIYD+
Sbjct  1    MDLWFWLVFIMIVAPTVPGSAAGT-VGVNYGRLASKLPSPGEVVELVRSLGVTKVRIYDT  59

Query  438  NIQVLKAFANTGIELMIGIPNSDL  509
            +  VL+AFANT IEL + +PN+D+
Sbjct  60   DATVLQAFANTSIELTVSVPNNDI  83



>ref|XP_002974888.1| hypothetical protein SELMODRAFT_102117 [Selaginella moellendorffii]
 gb|EFJ24408.1| hypothetical protein SELMODRAFT_102117 [Selaginella moellendorffii]
Length=469

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I   + IGVCYGR AD+LP+P KAVQL+Q   I  VR++  +   L A AN+ I++M+G+
Sbjct  2    ISADAAIGVCYGRMADNLPSPQKAVQLMQSQGISKVRLFSPDADALSALANSNIDVMVGV  61

Query  495  PNSDLLPFSQFQSN  536
            PN++L   +Q QS+
Sbjct  62   PNTELQGIAQSQSS  75



>ref|XP_002962275.1| hypothetical protein SELMODRAFT_76256, partial [Selaginella moellendorffii]
 gb|EFJ37535.1| hypothetical protein SELMODRAFT_76256, partial [Selaginella moellendorffii]
Length=410

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLL  512
            +GVCYGRN D+LP+P  AVQLIQ  +I  VRI+  + + L+AFANT IEL+IG  N+ ++
Sbjct  1    VGVCYGRNGDNLPSPQVAVQLIQAQSITKVRIFSYDAETLQAFANTQIELVIGTTNAQVV  60

Query  513  PFSQFQSN  536
             F Q Q +
Sbjct  61   DFGQSQGD  68



>ref|XP_002963799.1| hypothetical protein SELMODRAFT_79527 [Selaginella moellendorffii]
 gb|EFJ35670.1| hypothetical protein SELMODRAFT_79527 [Selaginella moellendorffii]
Length=469

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I   + IGVCYGR AD+LP+P KAVQL+Q   I  VR++  +   L A AN+ I++M+G+
Sbjct  2    ISADAAIGVCYGRMADNLPSPQKAVQLMQSQGISKVRLFSPDADALTALANSNIDVMVGV  61

Query  495  PNSDLLPFSQFQSN  536
            PN++L   +Q QS+
Sbjct  62   PNTELQGIAQSQSS  75



>ref|XP_002969656.1| hypothetical protein SELMODRAFT_440863 [Selaginella moellendorffii]
 gb|EFJ28780.1| hypothetical protein SELMODRAFT_440863 [Selaginella moellendorffii]
Length=410

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M +WF L+F   +   + G   G+ +GV YGR A  LP+P + V+L++   +  VRIYD+
Sbjct  1    MDLWFWLVFIMIVAPTVPGSAAGT-VGVNYGRLASKLPSPGEVVELVRSLGVTKVRIYDT  59

Query  438  NIQVLKAFANTGIELMIGIPNSDL  509
            +  VL+AFANT IEL + +PN+D+
Sbjct  60   DATVLQAFANTSIELTVSVPNNDI  83



>ref|XP_002993263.1| hypothetical protein SELMODRAFT_162942 [Selaginella moellendorffii]
 gb|EFJ05684.1| hypothetical protein SELMODRAFT_162942 [Selaginella moellendorffii]
Length=345

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  258  MGMWFRLIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDS  437
            M +WF L+F   +   + G   G+ +GV YGR A  LP+P + V+L++   +  V+IYD+
Sbjct  1    MDLWFWLVFIMIVAPTVPGSAAGT-VGVNYGRLASKLPSPGEVVELVRSLGVTKVKIYDT  59

Query  438  NIQVLKAFANTGIELMIGIPNSDL  509
            +  VL+AFANT IEL + +PN+D+
Sbjct  60   DATVLQAFANTSIELTVSVPNNDI  83



>ref|XP_002965189.1| hypothetical protein SELMODRAFT_82513, partial [Selaginella moellendorffii]
 gb|EFJ34027.1| hypothetical protein SELMODRAFT_82513, partial [Selaginella moellendorffii]
Length=410

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLL  512
            +GVCYGRN D+LP P  AVQLIQ  +I  VRI+  + + L+AFANT IEL+IG  N+ ++
Sbjct  1    VGVCYGRNGDNLPPPQVAVQLIQAQSITKVRIFSYDAETLQAFANTQIELVIGTTNAQVV  60

Query  513  PFSQFQSN  536
             F Q Q +
Sbjct  61   DFGQSQGD  68



>ref|XP_002308921.2| hypothetical protein POPTR_0006s04460g [Populus trichocarpa]
 gb|EEE92444.2| hypothetical protein POPTR_0006s04460g [Populus trichocarpa]
Length=345

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++GVCYG   D+LP+  + V L  Q+NI+ +RIYD N + L+A   + IELM+G+PNS
Sbjct  31   GAQMGVCYGTLGDNLPSEQEVVDLFNQYNIRRMRIYDPNPRTLQALGGSSIELMLGVPNS  90

Query  504  DLLPFSQFQSN  536
            DL   S  Q+N
Sbjct  91   DLPSISSSQAN  101



>ref|XP_011027332.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Populus euphratica]
Length=345

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++GVCYG   D+LP+  + V L  Q+NI+ +RIYD N + L+A   + IELM+G+PNS
Sbjct  31   GAQMGVCYGTLGDNLPSEQEVVDLFNQYNIRRMRIYDPNPRTLQALGGSSIELMLGVPNS  90

Query  504  DLLPFSQFQSN  536
            DL   S  Q+N
Sbjct  91   DLPSISSSQAN  101



>emb|CBI30053.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++IGVCYGRN ++LP P + V L  Q+NI+ +R+YD+    L+A   + IEL++G+PN 
Sbjct  19   GAQIGVCYGRNGNNLPAPGEVVALYNQYNIRRMRLYDTRQDALQALGGSNIELILGVPND  78

Query  504  DLLPFSQFQSN  536
            +L   +  Q+N
Sbjct  79   NLQNIASSQAN  89



>ref|XP_004968992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Setaria italica]
Length=541

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +GV YGR AD+LP P   VQL+Q + I  VRIYD+N QVL + ANTGI++M+ +PN +L
Sbjct  26   VGVSYGRVADNLPDPGSVVQLLQHNGITMVRIYDTNPQVLTSLANTGIKVMVMVPNENL  84



>ref|XP_002314939.2| hypothetical protein POPTR_0010s15320g [Populus trichocarpa]
 gb|EEF01110.2| hypothetical protein POPTR_0010s15320g [Populus trichocarpa]
Length=324

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++G+CYG   +DLP   + + L +QHNIK +R+YD N   L A  ++GIE+M+G+PNS
Sbjct  3    GAQVGICYGMMGNDLPPATEVIALYKQHNIKRMRLYDPNQAALNALRDSGIEVMLGVPNS  62

Query  504  DL  509
            DL
Sbjct  63   DL  64



>ref|XP_002277446.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=340

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++IGVCYGRN ++LP P + V L  Q+NI+ +R+YD+    L+A   + IEL++G+PN 
Sbjct  32   GAQIGVCYGRNGNNLPAPGEVVALYNQYNIRRMRLYDTRQDALQALGGSNIELILGVPND  91

Query  504  DLLPFSQFQSN  536
            +L   +  Q+N
Sbjct  92   NLQNIASSQAN  102



>gb|KFK36125.1| hypothetical protein AALP_AA4G081000 [Arabis alpina]
Length=350

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+  + + L +Q+NIK VR+YD N   L A  NTGIE++IG+P
Sbjct  23   TSGESVGVCYGMMGNNLPSQSETITLFKQNNIKRVRLYDPNQNALNALKNTGIEVLIGVP  82

Query  498  NSDL  509
            NS+L
Sbjct  83   NSEL  86



>ref|XP_006387253.1| hypothetical protein POPTR_1409s00200g [Populus trichocarpa]
 gb|ERP46167.1| hypothetical protein POPTR_1409s00200g [Populus trichocarpa]
Length=226

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++GVCYG   D+LP+  + V L  Q+NI+ +RIYD N + L+A   + IELM+ +PNS
Sbjct  31   GAQMGVCYGTLGDNLPSDQEVVDLFNQYNIRRMRIYDPNPRALQALGGSNIELMLSVPNS  90

Query  504  DLLPFSQFQSN  536
            DL   S   +N
Sbjct  91   DLPSISSSHAN  101



>emb|CDY34445.1| BnaC01g21880D [Brassica napus]
Length=346

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N + L A  NTGIE+++G+P
Sbjct  21   TSGEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVP  80

Query  498  NSDL  509
            NSDL
Sbjct  81   NSDL  84



>emb|CDY32230.1| BnaA01g17540D [Brassica napus]
Length=346

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N + L A  NTGIE+++G+P
Sbjct  21   TSGEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVP  80

Query  498  NSDL  509
            NSDL
Sbjct  81   NSDL  84



>gb|EYU45078.1| hypothetical protein MIMGU_mgv1a009249mg [Erythranthe guttata]
Length=348

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++ GVCYGR  D+LP+P + V L  Q+NI+ +RIYD +   L+A A + IEL +G+PN D
Sbjct  34   AQTGVCYGRLGDNLPSPAEVVALCNQNNIRRMRIYDPDQATLRALAGSNIELTLGVPNPD  93

Query  507  LLPFSQFQSN  536
            L   +  QSN
Sbjct  94   LQSIAASQSN  103



>ref|XP_009146295.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Brassica rapa]
Length=357

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N + L A  NTGIE+++G+PNS
Sbjct  23   GEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVPNS  82

Query  504  DL  509
            DL
Sbjct  83   DL  84



>ref|XP_003594772.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Medicago truncatula]
Length=230

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG    +LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  20   AQIGVCYGMEGTNLPSQREAIDLCKSNNIKRMRLYDPNPDALEALRNSGIELMLGVPNSD  79

Query  507  L  509
            L
Sbjct  80   L  80



>dbj|BAC84504.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=286

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR+A++L  P  AV L++ + I  VRI+D++  VL A ANTGI++M+ IPN+DL
Sbjct  29   EIGVCYGRDANNLIDPPAAVSLLKANGISAVRIFDADQTVLDAMANTGIKVMVAIPNADL  88

Query  510  LPFSQ  524
                Q
Sbjct  89   AAAGQ  93



>tpg|DAA63006.1| TPA: putative O-glycosyl hydrolase family 17 protein, partial 
[Zea mays]
Length=649

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G     ++GV YGR A+DLP P   VQL++Q  I  VR+YD+N +VL + ANTGI++M+ 
Sbjct  23   GAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTSLANTGIKVMVM  82

Query  492  IPNSDL  509
            +PN +L
Sbjct  83   LPNEEL  88



>dbj|BAJ33717.1| unnamed protein product [Thellungiella halophila]
Length=341

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G ++GVCYGR  D+LP+P + ++L +Q NI+ VR+Y  +  VL A   + IE+M+G+P
Sbjct  23   AAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHDVLAALRGSDIEVMLGLP  82

Query  498  NSDLLPFSQFQS  533
            N DL   +  QS
Sbjct  83   NQDLQRIASSQS  94



>ref|XP_008653189.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Zea mays]
Length=660

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G     ++GV YGR A+DLP P   VQL++Q  I  VR+YD+N +VL + ANTGI++M+ 
Sbjct  23   GAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTSLANTGIKVMVM  82

Query  492  IPNSDL  509
            +PN +L
Sbjct  83   LPNEEL  88



>tpg|DAA63007.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=695

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G     ++GV YGR A+DLP P   VQL++Q  I  VR+YD+N +VL + ANTGI++M+ 
Sbjct  23   GAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTSLANTGIKVMVM  82

Query  492  IPNSDL  509
            +PN +L
Sbjct  83   LPNEEL  88



>ref|XP_002868146.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44405.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N   L A  NTGIE++IG+P
Sbjct  18   TSGEPVGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALKNTGIEVIIGVP  77

Query  498  NSDL  509
            NSDL
Sbjct  78   NSDL  81



>ref|XP_004159384.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Cucumis 
sativus]
 gb|KGN60690.1| hypothetical protein Csa_2G006850 [Cucumis sativus]
Length=399

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PD+ V L++   IK VRIYD++ +VLKAF+ TG+EL++G+PN  L  
Sbjct  38   GINYGRIADNIPSPDEVVSLLKAAKIKNVRIYDADHKVLKAFSGTGLELVVGLPNGFLRE  97

Query  516  FSQFQSN  536
             S  + +
Sbjct  98   MSASEEH  104



>ref|XP_002314934.2| Glucan endo-1 family protein [Populus trichocarpa]
 gb|EEF01105.2| Glucan endo-1 family protein [Populus trichocarpa]
Length=372

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++G+CYG   ++LP   + + L +QHNIK +R+YD N   L A  ++GIE+M+G+PNS
Sbjct  33   GAQVGICYGMMGNNLPPATEVIALYKQHNIKRMRLYDPNQAALNALRDSGIEVMLGVPNS  92

Query  504  DL  509
            DL
Sbjct  93   DL  94



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            KIG+ YGR A+DLPTP K VQL++   +  +++YD++  VLKAF+N+GI L + +PN +L
Sbjct  26   KIGINYGRIANDLPTPVKVVQLLKTQGVSRIKLYDTDSDVLKAFSNSGISLTVALPNENL  85

Query  510  LPFSQFQS  533
               +  QS
Sbjct  86   TAAAASQS  93



>ref|XP_008457422.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Cucumis melo]
Length=399

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PD+ V L++   IK VRIYD++ +VLKAF+ TG+EL++G+PN  L  
Sbjct  38   GINYGRIADNIPSPDEVVSLLKAAKIKNVRIYDADHKVLKAFSGTGLELVVGLPNGFLRE  97

Query  516  FSQFQSN  536
             S  + +
Sbjct  98   MSASEEH  104



>ref|XP_006292288.1| hypothetical protein CARUB_v10018497mg [Capsella rubella]
 gb|EOA25186.1| hypothetical protein CARUB_v10018497mg [Capsella rubella]
Length=342

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GVCYGR  ++LP+P + V+L +Q NI+ VR+Y  +  VL A   +GIE+M+G+PN DL
Sbjct  28   QVGVCYGRYGNNLPSPAETVELFKQKNIRRVRLYSPDHDVLTALRGSGIEVMLGLPNPDL  87

Query  510  --LPFSQFQSN  536
              +  SQ ++N
Sbjct  88   QRVASSQLEAN  98



>ref|XP_009795195.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Nicotiana sylvestris]
Length=353

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGRN + LP+P   V L +Q NI+ +RIYD +   L+A   + IELM+G+PN 
Sbjct  27   GAQTGVCYGRNGNGLPSPADVVALCKQKNIQRMRIYDPHQPTLQALRGSNIELMLGVPNP  86

Query  504  DLLPFSQFQSN  536
            DL   +  Q N
Sbjct  87   DLQNIASSQGN  97



>ref|NP_001061351.1| Os08g0244500 [Oryza sativa Japonica Group]
 dbj|BAD05183.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD05454.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23265.1| Os08g0244500 [Oryza sativa Japonica Group]
 gb|EAZ42021.1| hypothetical protein OsJ_26572 [Oryza sativa Japonica Group]
Length=577

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR+A DL  P  AV L++ + I  VRI+D++  VL A ANTGI++M+ IPN+DL
Sbjct  28   EIGVCYGRDAKDLIDPPAAVSLLKANGISAVRIFDADPTVLAAMANTGIKVMVAIPNADL  87

Query  510  LPFSQ  524
                Q
Sbjct  88   AAAGQ  92



>ref|XP_006409034.1| hypothetical protein EUTSA_v10003126mg [Eutrema salsugineum]
 gb|ESQ50487.1| hypothetical protein EUTSA_v10003126mg [Eutrema salsugineum]
Length=370

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G ++GVCYGR  D+LP+P + ++L +Q NI+ VR+Y  +  VL A   + IE+M+G+P
Sbjct  52   AAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHDVLAALRGSDIEVMLGLP  111

Query  498  NSDLLPFSQFQS  533
            N DL   +  QS
Sbjct  112  NQDLQRIASSQS  123



>emb|CAB10405.1| beta-1, 3-glucanase class I precursor [Arabidopsis thaliana]
 emb|CAB78668.1| beta-1, 3-glucanase class I precursor [Arabidopsis thaliana]
 gb|AAM64664.1| beta-1,3-glucanase class I precursor [Arabidopsis thaliana]
Length=306

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N   L A  NTGIE++IG+PN+
Sbjct  21   GESVGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALRNTGIEVIIGVPNT  80

Query  504  DL  509
            DL
Sbjct  81   DL  82



>ref|XP_010541911.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Tarenaya hassleriana]
Length=402

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VLKAF+ +G+EL++G+PN  L
Sbjct  50   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHSVLKAFSGSGLELVVGLPNEYL  107



>ref|XP_006396056.1| hypothetical protein EUTSA_v10007971mg [Eutrema salsugineum]
 gb|ESQ33342.1| hypothetical protein EUTSA_v10007971mg [Eutrema salsugineum]
Length=370

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G ++GVCYGR  D+LP+P + ++L +Q NI+ VR+Y  +  VL A   + IE+M+G+P
Sbjct  52   AAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHDVLAALRGSDIEVMLGLP  111

Query  498  NSDLLPFSQFQS  533
            N DL   +  QS
Sbjct  112  NQDLQRIASSQS  123



>dbj|BAC84505.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=583

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  321  RGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
               ++GVCYGR+ADDL  P   V L++++ I  VRIYD++  VL++ +NTGI++M+ +PN
Sbjct  47   EAGEVGVCYGRDADDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVALPN  106

Query  501  SDL  509
             DL
Sbjct  107  KDL  109



>ref|XP_002462968.1| hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
 gb|EER99489.1| hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
Length=581

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GV YGR A+DLP P   VQL++ + I  VRIYD++  VL++FANTGI+LM+ +PN +L
Sbjct  28   EVGVNYGRVANDLPDPAAVVQLLRDNGITMVRIYDTDDAVLRSFANTGIKLMVMLPNENL  87



>ref|NP_001059886.2| Os07g0539400 [Oryza sativa Japonica Group]
 gb|EAZ40149.1| hypothetical protein OsJ_24593 [Oryza sativa Japonica Group]
 dbj|BAF21800.2| Os07g0539400 [Oryza sativa Japonica Group]
Length=561

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  321  RGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
               ++GVCYGR+ADDL  P   V L++++ I  VRIYD++  VL++ +NTGI++M+ +PN
Sbjct  25   EAGEVGVCYGRDADDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVALPN  84

Query  501  SDL  509
             DL
Sbjct  85   KDL  87



>gb|ABK96486.1| unknown [Populus trichocarpa x Populus deltoides]
Length=372

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++G+CYG   ++LP   + + L +QHNIK +R+YD N   L A   +GIE+M+G+PNS
Sbjct  33   GAQVGICYGMMGNNLPPATEVIALYKQHNIKRMRLYDPNQAALNALRGSGIEVMLGVPNS  92

Query  504  DL  509
            DL
Sbjct  93   DL  94



>ref|XP_011010204.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Populus euphratica]
Length=372

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++G+CYG   ++LP   + + L +QHNIK +R+YD N   L A   +GIE+M+G+PNS
Sbjct  33   GAQVGICYGMMGNNLPPATEVIALYKQHNIKRMRLYDPNQAALNALRGSGIEVMLGVPNS  92

Query  504  DL  509
            DL
Sbjct  93   DL  94



>gb|EEC82195.1| hypothetical protein OsI_26335 [Oryza sativa Indica Group]
Length=569

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GVCYGR+AD+L  P   V L++ + I  VRI+D++  VL+A ANTGI++M+ +PN+DL
Sbjct  28   ELGVCYGRDADNLMDPQSVVSLLRANGITMVRIFDADPAVLRALANTGIKVMVALPNTDL  87



>ref|NP_193361.4| putative beta-1,3-endoglucanase [Arabidopsis thaliana]
 gb|AAL36038.1| AT4g16260/dl4170c [Arabidopsis thaliana]
 gb|AAN28806.1| At4g16260/dl4170c [Arabidopsis thaliana]
 gb|AEE83722.1| putative beta-1,3-endoglucanase [Arabidopsis thaliana]
Length=344

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+    + L +Q+NI+ VR+YD N   L A  NTGIE++IG+P
Sbjct  19   TSGESVGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALRNTGIEVIIGVP  78

Query  498  NSDL  509
            N+DL
Sbjct  79   NTDL  82



>gb|ACJ84752.1| unknown [Medicago truncatula]
Length=343

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG    +LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  28   AQIGVCYGMEGTNLPSQREAIDLCKSNNIKRMRLYDPNPDALEALRNSGIELMLGVPNSD  87

Query  507  L  509
            L
Sbjct  88   L  88



>ref|XP_003594771.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Medicago truncatula]
 gb|AES65022.1| glucan endo-1,3-beta-glucosidase, basic protein [Medicago truncatula]
Length=335

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG    +LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  20   AQIGVCYGMEGTNLPSQREAIDLCKSNNIKRMRLYDPNPDALEALRNSGIELMLGVPNSD  79

Query  507  L  509
            L
Sbjct  80   L  80



>gb|AAD10386.1| beta-1,3-glucanase precursor [Oryza sativa Japonica Group]
Length=377

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  276  LIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLK  455
            LI A +L LL L       +G+ YGR A+DLP P   VQL++Q  I  V++YD+   VL+
Sbjct  10   LILAVALPLLFLSASEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQVKLYDTEPTVLR  69

Query  456  AFANTGIELMIGIPNSDLL  512
            A ANTGI++++ +PN  LL
Sbjct  70   ALANTGIKVVVALPNEQLL  88



>ref|NP_001059878.1| Os07g0538000 [Oryza sativa Japonica Group]
 dbj|BAC84487.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAD30397.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21792.1| Os07g0538000 [Oryza sativa Japonica Group]
 gb|EEE67331.1| hypothetical protein OsJ_24583 [Oryza sativa Japonica Group]
Length=558

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GVCYGR+AD+L  P   V L++ + I  VRI+D++  VL+A ANTGI++M+ +PN+DL
Sbjct  28   ELGVCYGRDADNLMDPQSVVSLLRANGITMVRIFDADPAVLRALANTGIKVMVALPNTDL  87



>ref|XP_004968994.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Setaria italica]
Length=536

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             S++GV YGR A+DLP P K  QL++ + I  VRIYD+  +VL++ ANTGI++M+ +PN 
Sbjct  26   ASEVGVSYGRVANDLPDPAKVTQLLKDNGITMVRIYDAKQEVLRSLANTGIKVMVMVPNE  85

Query  504  DL  509
            ++
Sbjct  86   NI  87



>ref|XP_004968993.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Setaria italica]
Length=551

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
             S++GV YGR A+DLP P K  QL++ + I  VRIYD+  +VL++ ANTGI++M+ +PN 
Sbjct  26   ASEVGVSYGRVANDLPDPAKVTQLLKDNGITMVRIYDAKQEVLRSLANTGIKVMVMVPNE  85

Query  504  DL  509
            ++
Sbjct  86   NI  87



>ref|XP_010095615.1| Glucan endo-1,3-beta-glucosidase 11 [Morus notabilis]
 gb|EXB61343.1| Glucan endo-1,3-beta-glucosidase 11 [Morus notabilis]
Length=378

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PD+ V L++   IK VRIYD++  VLKAF+ TG+EL+IG+PN  L  
Sbjct  43   GINYGRIADNIPSPDEVVTLLRAAKIKNVRIYDADHSVLKAFSGTGLELVIGLPNQYLKD  102

Query  516  FS  521
             S
Sbjct  103  MS  104



>gb|ABD32329.1| Glycoside hydrolase, family 17 [Medicago truncatula]
Length=389

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG    +LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  74   AQIGVCYGMEGTNLPSQREAIDLCKSNNIKRMRLYDPNPDALEALRNSGIELMLGVPNSD  133

Query  507  L  509
            L
Sbjct  134  L  134



>gb|EEE67336.1| hypothetical protein OsJ_24592 [Oryza sativa Japonica Group]
Length=604

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR+A++L  P  AV L++ + I  VRI+D++  VL A ANTGI++M+ IPN+DL
Sbjct  56   EIGVCYGRDANNLIDPPAAVSLLKANGISAVRIFDADQTVLDAMANTGIKVMVAIPNADL  115

Query  510  LPFSQ  524
                Q
Sbjct  116  AAAGQ  120



>emb|CBI28222.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PD+ V L++   IK VRIYD++  VL+AF+ TG+E+++G+PN +L
Sbjct  34   GINYGRIADNIPSPDEVVTLLRALKIKNVRIYDADHSVLEAFSGTGLEIVVGVPNGNL  91



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G    S IG+ YGR A+DLP+PDK V+L++   ++ V++YD++  VL A AN+GI +M+ 
Sbjct  26   GFSDASSIGINYGRVANDLPSPDKVVELLKSIGVEKVKLYDTDATVLTALANSGISVMVA  85

Query  492  IPNSDLLPFSQFQS  533
            +PN  L   +  QS
Sbjct  86   LPNELLASAAADQS  99



>ref|NP_001175238.1| Os07g0539300 [Oryza sativa Japonica Group]
 dbj|BAC84503.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAG89880.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93966.1| Os07g0539300 [Oryza sativa Japonica Group]
Length=577

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR+A++L  P  AV L++ + I  VRI+D++  VL A ANTGI++M+ IPN+DL
Sbjct  29   EIGVCYGRDANNLIDPPAAVSLLKANGISAVRIFDADQTVLDAMANTGIKVMVAIPNADL  88

Query  510  LPFSQ  524
                Q
Sbjct  89   AAAGQ  93



>ref|XP_011078399.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X3 [Sesamum 
indicum]
Length=390

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD++  VL AF  TG+EL+IG+PN
Sbjct  28   GINYGRIADNIPSPDKVVRLLKAAKIKNVRIYDADHSVLNAFKGTGLELVIGLPN  82



>ref|XP_010046640.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=365

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G   G+ +G+CYGR A++LP P   V+L++ + I  VR++++   +L++F   GI LMIG
Sbjct  42   GANSGATVGICYGRVANNLPPPSSTVELLKSNQISNVRLFNAEPAILRSFNGAGISLMIG  101

Query  492  IPNSDLLPFSQ  524
            +PN DL   S 
Sbjct  102  VPNEDLPALSS  112



>ref|XP_009794602.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Nicotiana sylvestris]
Length=394

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD++  VL AF  TG+EL++G+PN
Sbjct  35   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDADPSVLNAFKGTGLELVVGLPN  89



>gb|KDP32427.1| hypothetical protein JCGZ_13352 [Jatropha curcas]
Length=367

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PD+ V L++   IK VRIYD++  VLKAF+ TG+EL++G+PN
Sbjct  31   GINYGRIADNIPSPDEVVTLLRAAKIKNVRIYDADHSVLKAFSGTGLELVVGLPN  85



>gb|ACU14757.1| unknown [Glycine max]
Length=145

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR A+++P+PD+ V L++   I+ VRIYD+   VLKAF+ TG+E+++G+PN  L
Sbjct  57   GINYGRIANNIPSPDEVVTLLRAEKIRNVRIYDAGHSVLKAFSGTGLEIVVGLPNGQL  114



>ref|XP_003594774.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES65025.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=362

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG   ++LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  28   AQIGVCYGMMGNNLPSQREAIDLCKSNNIKRMRLYDPNQAALEALRNSGIELMLGVPNSD  87

Query  507  L  509
            L
Sbjct  88   L  88



>ref|XP_009611391.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Nicotiana tomentosiformis]
Length=343

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYG N + LP+P   V L +Q NI+ +RIYD     L+A + + IELM+G+PN 
Sbjct  27   GAQTGVCYGTNGNGLPSPADVVALCKQKNIQRMRIYDPRQSTLQALSGSNIELMLGVPNP  86

Query  504  DLLPFSQFQSN  536
            DL   +  Q N
Sbjct  87   DLQNIASSQGN  97



>gb|ABD32327.1| Glycoside hydrolase, family 17 [Medicago truncatula]
 gb|ACJ84484.1| unknown [Medicago truncatula]
 gb|AFK39879.1| unknown [Medicago truncatula]
Length=362

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG   ++LP+  +A+ L + +NIK +R+YD N   L+A  N+GIELM+G+PNSD
Sbjct  28   AQIGVCYGMMGNNLPSQREAIDLCKSNNIKRMRLYDPNQAALEALRNSGIELMLGVPNSD  87

Query  507  L  509
            L
Sbjct  88   L  88



>ref|XP_006294379.1| hypothetical protein CARUB_v10023397mg [Capsella rubella]
 gb|EOA27277.1| hypothetical protein CARUB_v10023397mg [Capsella rubella]
Length=388

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L+IG+PN
Sbjct  35   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLEAFSGTGLDLVIGLPN  89



>ref|XP_009364012.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=396

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK   L++   IK VRIYD++  VLKAF+ TG+EL++G+PN  L
Sbjct  34   GINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLELVVGLPNGYL  91



>ref|XP_009368869.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=398

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK   L++   IK VRIYD++  VLKAF+ TG+EL++G+PN  L
Sbjct  34   GINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLELVVGLPNGYL  91



>ref|XP_011078397.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X1 [Sesamum 
indicum]
Length=410

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD++  VL AF  TG+EL+IG+PN
Sbjct  28   GINYGRIADNIPSPDKVVRLLKAAKIKNVRIYDADHSVLNAFKGTGLELVIGLPN  82



>gb|KCW86706.1| hypothetical protein EUGRSUZ_B03315, partial [Eucalyptus grandis]
Length=313

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+ +G+CYGR A++LP P   V+L++ + I  VR++++   +L++F   GI LMIG+PN 
Sbjct  1    GATVGICYGRVANNLPPPSSTVELLKSNQISNVRLFNAEPAILRSFNGAGISLMIGVPNE  60

Query  504  DLLPFSQ  524
            DL   S 
Sbjct  61   DLPALSS  67



>ref|XP_011078398.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X2 [Sesamum 
indicum]
Length=409

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD++  VL AF  TG+EL+IG+PN
Sbjct  27   GINYGRIADNIPSPDKVVRLLKAAKIKNVRIYDADHSVLNAFKGTGLELVIGLPN  81



>gb|EAZ04201.1| hypothetical protein OsI_26344 [Oryza sativa Indica Group]
Length=561

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  321  RGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
               ++GVCYGR+ DDL  P   V L++++ I  VRIYD++  VL++ +NTGI++M+ +PN
Sbjct  25   EAGEVGVCYGRDGDDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVALPN  84

Query  501  SDL  509
             DL
Sbjct  85   KDL  87



>ref|XP_006658648.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Oryza brachyantha]
Length=562

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GVCYGR+A+DL  P   V L+++H I  VRIYD++  VL + +N GI++M+ +PN DL
Sbjct  28   EVGVCYGRDANDLMDPSAVVNLLKEHGITMVRIYDADQAVLGSLSNKGIKVMVALPNRDL  87



>ref|XP_008361223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Malus domestica]
Length=398

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK   L++   IK VRIYD++  VLKAF+ TG+EL++G+PN  L
Sbjct  34   GINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLELVVGLPNGYL  91



>ref|XP_010449818.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=346

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G  +GVCYG   ++LP+    + L ++ NI+ VR+YD N   L A  NTGIE+++G+PNS
Sbjct  23   GEPVGVCYGMMGNNLPSKPDTIALFREKNIRRVRLYDPNQAALNALKNTGIEVIVGVPNS  82

Query  504  DL  509
            DL
Sbjct  83   DL  84



>ref|XP_010925705.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Elaeis guineensis]
Length=398

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I  GS +G+ YG+ A++LP+P++ + L+    I  +RIYD+N QVL AFAN+GI+LM+ +
Sbjct  28   IQLGSTLGINYGQVANNLPSPEQVLTLLTSLRISKIRIYDTNPQVLTAFANSGIDLMVTV  87

Query  495  PN  500
            PN
Sbjct  88   PN  89



>ref|XP_006414372.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
 gb|ESQ55825.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
Length=345

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G  +GVCYG   ++LP+  + + L +Q+NI+ +R+YD N   L A  N+GIE+++G+PNS
Sbjct  22   GEPVGVCYGMLGNNLPSQSETIALFRQNNIRRIRLYDPNQAALNALKNSGIEVIVGVPNS  81

Query  504  DL  509
            DL
Sbjct  82   DL  83



>gb|AAY25165.1| beta-1,3-glucanase 1 [Ziziphus jujuba]
Length=378

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PD+ V L++   IK VRIYD+   VLKAF+ TG+EL++G+PN
Sbjct  34   GINYGRIADNIPSPDEVVTLLRAAKIKNVRIYDAEHSVLKAFSGTGLELVVGLPN  88



>ref|XP_009612877.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Nicotiana tomentosiformis]
Length=394

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD+   VL AF  TG+EL++G+PN
Sbjct  35   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDAEPSVLNAFKGTGLELVVGLPN  89



>ref|XP_002282272.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Vitis vinifera]
Length=394

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PD+ V L++   IK VRIYD++  VL+AF+ TG+E+++G+PN +L
Sbjct  34   GINYGRIADNIPSPDEVVTLLRALKIKNVRIYDADHSVLEAFSGTGLEIVVGVPNGNL  91



>ref|XP_010925707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Elaeis guineensis]
Length=385

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I  GS +G+ YG+ A++LP+P++ + L+    I  +RIYD+N QVL AFAN+GI+LM+ +
Sbjct  28   IQLGSTLGINYGQVANNLPSPEQVLTLLTSLRISKIRIYDTNPQVLTAFANSGIDLMVTV  87

Query  495  PN  500
            PN
Sbjct  88   PN  89



>ref|XP_009421254.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  312  GICR-GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMI  488
            G  R G  +G+ YG+ A+DLPTPD+ + ++    I   RIYD+N +VL AFANTGIEL++
Sbjct  16   GFLRLGFALGINYGQVANDLPTPDQVLSILTSLKITNTRIYDTNPKVLAAFANTGIELIV  75

Query  489  GIPNSDL  509
             +PN  +
Sbjct  76   TVPNESV  82



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            IGV YGR AD+LP PDK V+L++   I  V++YD+   VL A AN+GI++++ +PN DL
Sbjct  24   IGVNYGRIADNLPAPDKVVELLKSQGINRVKLYDTETTVLTALANSGIKVVVSLPNEDL  82



>gb|EYU27371.1| hypothetical protein MIMGU_mgv1a005776mg [Erythranthe guttata]
Length=471

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  276  LIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLK  455
            LIF C    ++     G  IG+ YGR AD+LP+P + VQL++   I  V++YD+N  VL 
Sbjct  15   LIFVCFSNSIVPVFSDGGTIGINYGRIADNLPSPPQVVQLLKAQGITKVKLYDTNSDVLS  74

Query  456  AFANTGIELMIGIPNSDL  509
            AF+ +GI L + +PN  L
Sbjct  75   AFSGSGIALTVALPNEQL  92



>ref|NP_001048260.1| Os02g0771700 [Oryza sativa Japonica Group]
 dbj|BAD16854.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD16859.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10174.1| Os02g0771700 [Oryza sativa Japonica Group]
 dbj|BAG86736.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74084.1| hypothetical protein OsI_09107 [Oryza sativa Indica Group]
 gb|EEE57879.1| hypothetical protein OsJ_08543 [Oryza sativa Japonica Group]
Length=488

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  276  LIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLK  455
            LI A +L LL L       +G+ YGR A+DLP P   VQL++Q  I  V++YD+   VL+
Sbjct  10   LILAVALPLLFLSASEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQVKLYDTEPTVLR  69

Query  456  AFANTGIELMIGIPNSDLL  512
            A ANTGI++++ +PN  LL
Sbjct  70   ALANTGIKVVVALPNEQLL  88



>ref|XP_010417810.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Camelina 
sativa]
Length=396

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  44   GINYGRIADNIPSPDKVVLLLKQTKIRNVRIYDADHSVLEAFSGTGLDLVVGLPN  98



>ref|XP_010653914.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Vitis vinifera]
Length=337

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG   D+LP P++ V+L  Q+N + +R+YD NI  L+A   + IELM+G+PN+ 
Sbjct  32   AQIGVCYGTLGDNLPPPEEVVELYTQNNFQRMRLYDPNIAALQALEGSNIELMLGVPNNA  91

Query  507  L  509
            L
Sbjct  92   L  92



>gb|AAL30426.1|AF435089_1 beta-1,3-glucanase [Prunus persica]
Length=343

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G++IGVCYG   D LP P + + L +Q+NI+ +R+YD N   L A   + IELM+G+P
Sbjct  30   TTGAQIGVCYGMLGDRLPPPSEVIALYKQNNIRRMRLYDPNQAALAALKGSYIELMLGVP  89

Query  498  NSDLLPFSQFQSN  536
            N +L   +  Q+N
Sbjct  90   NDNLQSLASSQAN  102



>emb|CDX83243.1| BnaA03g22630D [Brassica napus]
Length=378

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLQAFSGTGLDLVVGLPN  85



>ref|XP_006419181.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
 gb|ESQ37639.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
Length=389

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  36   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHSVLQAFSGTGLDLVVGLPN  90



>ref|XP_004242775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X2 [Solanum 
lycopersicum]
Length=366

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD+   VL AF  TG+EL++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDAEPSVLNAFKGTGLELVVGLPN  85



>ref|XP_006419179.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
 ref|XP_006419180.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
 gb|ESQ37637.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
 gb|ESQ37638.1| hypothetical protein EUTSA_v10002341mg [Eutrema salsugineum]
Length=371

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  36   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHSVLQAFSGTGLDLVVGLPN  90



>ref|XP_010323301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X1 [Solanum 
lycopersicum]
Length=390

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD+   VL AF  TG+EL++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDAEPSVLNAFKGTGLELVVGLPN  85



>ref|XP_009133932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Brassica rapa]
Length=378

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLQAFSGTGLDLVVGLPN  85



>emb|CDY38531.1| BnaC03g26660D [Brassica napus]
Length=382

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  32   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLQAFSGTGLDLVVGLPN  86



>emb|CDP14182.1| unnamed protein product [Coffea canephora]
Length=391

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR    LP+P   V L +Q+NIK +RIYD +   L+A A + IE+++G+PN+
Sbjct  59   GAQTGVCYGRLGSGLPSPADVVALCKQNNIKRMRIYDPDHSTLQALAGSNIEVILGVPNT  118

Query  504  DLLPFSQFQSN  536
            DL   +  Q N
Sbjct  119  DLQNVAASQDN  129



>ref|XP_002983128.1| hypothetical protein SELMODRAFT_117724, partial [Selaginella 
moellendorffii]
 gb|EFJ15937.1| hypothetical protein SELMODRAFT_117724, partial [Selaginella 
moellendorffii]
Length=324

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G+ IGV YGR  D+LP+P + V L++ +NI   RI+D++  V++AFAN+GI+L + IP
Sbjct  1    ADGASIGVNYGRLGDNLPSPAQVVALLKSNNITKARIFDADPAVIQAFANSGIDLSVSIP  60

Query  498  NSDL  509
            N  L
Sbjct  61   NEQL  64



>ref|XP_010510884.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Camelina 
sativa]
Length=389

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  37   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLEAFSGTGLDLVVGLPN  91



>ref|XP_002878991.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55250.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VRIYD++  VL+AF+ TG++L++G+PN
Sbjct  35   GINYGRIADNIPSPDKVVLLLKQAKIRNVRIYDADHTVLEAFSGTGLDLVVGLPN  89



>ref|XP_004150032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Cucumis 
sativus]
 ref|XP_004167142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Cucumis 
sativus]
Length=396

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR A+++P+PDK V L++   IK VRIYD++  VLKAF+ TG+E++I IPN +L
Sbjct  35   GINYGRIANNIPSPDKVVTLLRAAKIKNVRIYDADHSVLKAFSGTGLEIVISIPNENL  92



>ref|XP_006358284.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Solanum 
tuberosum]
Length=390

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD+   VL AF  TG+EL++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDAEPSVLNAFKGTGLELVVGLPN  85



>ref|XP_008443979.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Cucumis 
melo]
Length=396

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR A+++P+PDK V L++   IK VRIYD++  VLKAF+ TG+E++I IPN +L
Sbjct  35   GINYGRIANNIPSPDKVVTLLRAAKIKNVRIYDADHSVLKAFSGTGLEIVISIPNENL  92



>ref|XP_010915632.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Elaeis guineensis]
Length=361

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            GS +GV YG+ A++LP+P++ V L+    I  +RIYD+N QVL AFAN+GI+L++ +PN 
Sbjct  21   GSTLGVNYGQVANNLPSPEQVVTLLTSLGITKIRIYDANPQVLTAFANSGIDLVVTVPNE  80



>ref|XP_002965881.1| hypothetical protein SELMODRAFT_84311, partial [Selaginella moellendorffii]
 gb|EFJ33301.1| hypothetical protein SELMODRAFT_84311, partial [Selaginella moellendorffii]
Length=324

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G+ IGV YGR  D+LP+P + V L++ +NI   RI+D++  V++AFAN+GI+L + IP
Sbjct  1    ADGASIGVNYGRLGDNLPSPAQVVALLKSNNITKARIFDADPAVIQAFANSGIDLSVSIP  60

Query  498  NSDL  509
            N  L
Sbjct  61   NEQL  64



>emb|CBI30054.3| unnamed protein product [Vitis vinifera]
Length=332

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IGVCYG   D+LP P++ V+L  Q+N + +R+YD NI  L+A   + IELM+G+PN+ 
Sbjct  32   AQIGVCYGTLGDNLPPPEEVVELYTQNNFQRMRLYDPNIAALQALEGSNIELMLGVPNNA  91

Query  507  L  509
            L
Sbjct  92   L  92



>ref|NP_001274810.1| glucan endo-1,3-beta-glucosidase 11-like precursor [Solanum tuberosum]
 gb|AFU52642.1| beta-1,3-glucanase 7 [Solanum tuberosum]
Length=365

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V+L++   IK VRIYD+   VL AF  TG+EL++G+PN
Sbjct  31   GINYGRIADNIPSPDKVVKLLRAAKIKNVRIYDAEPTVLNAFKGTGLELVVGLPN  85



>ref|XP_010551091.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Tarenaya hassleriana]
Length=359

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G  +GVCYG   ++LP+  + + L  Q+NI+ +R+YD N + L A  N+GIEL++G+PNS
Sbjct  20   GEPVGVCYGMMGNNLPSKQEVIGLYGQYNIRRMRLYDPNGEALNALRNSGIELVLGVPNS  79

Query  504  DL  509
            DL
Sbjct  80   DL  81



>gb|AIR93915.1| glucanase [Cicer arietinum]
Length=373

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PD+ V L++   I+ VRIYD++  VLKAF+ TG+E+++G+PN  L  
Sbjct  31   GINYGRIADNIPSPDEVVTLLRAAKIRNVRIYDADHSVLKAFSGTGLEIVVGLPNGQLQD  90

Query  516  FSQ  524
             S 
Sbjct  91   MSS  93



>ref|XP_004508479.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Cicer arietinum]
Length=390

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PD+ V L++   I+ VRIYD++  VLKAF+ TG+E+++G+PN  L  
Sbjct  31   GINYGRIADNIPSPDEVVTLLRAAKIRNVRIYDADHSVLKAFSGTGLEIVVGLPNGQLQD  90

Query  516  FSQ  524
             S 
Sbjct  91   MSS  93



>ref|XP_004968973.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Setaria italica]
Length=566

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            ++GV YGR A+DLP P K  QL++ + I  VRIYD+  +VL++ ANTGI++M+ +PN ++
Sbjct  26   QMGVSYGRVANDLPDPAKVTQLLKDNGITMVRIYDAKQEVLRSLANTGIKVMVMVPNENI  85



>gb|ADW08743.1| 1,3-beta-D-glucanase GH17_44 [Populus tremula x Populus tremuloides]
Length=372

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G+++G+CYG   ++LP   + + L +Q NIK +R+YD N   L A  ++GIE+M+G+PNS
Sbjct  33   GAQVGICYGMMGNNLPPATEVIALYKQRNIKRMRLYDPNQAALNALRDSGIEVMVGVPNS  92

Query  504  DL  509
            DL
Sbjct  93   DL  94



>ref|XP_011039450.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Populus euphratica]
Length=343

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++IGVCYG N + LP   + + L +Q  I+ +R+YD N   L+A A T IELM+G+PNS
Sbjct  31   GAQIGVCYGMNGN-LPPAQEVIDLYRQRGIRRMRLYDPNQDALRALAGTNIELMLGLPNS  89

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  90   DLQRIASSQTN  100



>gb|EMS65653.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=482

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  312  GICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIG  491
            G     ++GVCYG   D+LP P   VQL++QH I  VR+YD++   L+A ANTGI++ + 
Sbjct  23   GSAEAGEVGVCYGMMGDNLPQPPAVVQLLKQHGITMVRLYDADAGGLRALANTGIKVGVS  82

Query  492  IPNSDL  509
            +PN ++
Sbjct  83   LPNDNI  88



>ref|XP_008242789.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Prunus mume]
Length=398

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK   L++   IK VRIYD++  VLKAF+ TG++L++G+PN  L
Sbjct  35   GINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLDLVVGLPNGYL  92



>gb|KCW82868.1| hypothetical protein EUGRSUZ_C04236 [Eucalyptus grandis]
 gb|KCW82869.1| hypothetical protein EUGRSUZ_C04236 [Eucalyptus grandis]
Length=370

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PDK V L++   I+ VRIYD++  VL AF+ TG++L++G+PN +L  
Sbjct  35   GINYGRLADNIPSPDKVVTLLRAAKIRNVRIYDADHTVLTAFSGTGLDLVVGLPNGNLKD  94

Query  516  FSQFQSN  536
             +  + N
Sbjct  95   VNASEDN  101



>gb|EMT31766.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=528

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G ++GVCYGR A DLP P   VQL++++ I  VRIYD++  VL++ ANT I++M+ + 
Sbjct  24   AEGGEVGVCYGRVATDLPDPASVVQLLKKNGITMVRIYDTDPTVLRSLANTNIKVMVELT  83

Query  498  NSDLLPFSQFQSN  536
            N +L   +  Q+N
Sbjct  84   NEELPLAAANQNN  96



>ref|XP_010050031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Eucalyptus grandis]
 gb|KCW82867.1| hypothetical protein EUGRSUZ_C04236 [Eucalyptus grandis]
Length=397

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD++P+PDK V L++   I+ VRIYD++  VL AF+ TG++L++G+PN +L  
Sbjct  35   GINYGRLADNIPSPDKVVTLLRAAKIRNVRIYDADHTVLTAFSGTGLDLVVGLPNGNLKD  94

Query  516  FSQFQSN  536
             +  + N
Sbjct  95   VNASEDN  101



>ref|XP_010545233.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=461

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I     +G+ YGR AD+LPTPDK V+L+++  I  V++YDS+  VL A AN+GI++++ +
Sbjct  19   IADSGMVGINYGRIADNLPTPDKVVELLKKQGIDRVKLYDSDKSVLTALANSGIKVVVAL  78

Query  495  PNSDLLPFSQFQS  533
            PN  L   +  QS
Sbjct  79   PNELLSSAAADQS  91



>ref|XP_006351289.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Solanum tuberosum]
Length=344

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGRN + LP+P   V L  ++NI+ +RIYD +   L+A   + IEL++G+PN 
Sbjct  28   GAQTGVCYGRNGNGLPSPVDVVALCNRNNIRRMRIYDPHQPTLQALRGSNIELILGVPNP  87

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  88   DLQNIASSQAN  98



>ref|XP_006577670.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
Length=185

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
            C     GVCYGR  ++LP+P + V L +Q++ + +RIYD N QVL+A   + IEL++ +P
Sbjct  8    CHFVPSGVCYGRVGNNLPSPQEVVSLSKQYDFRRMRIYDRNQQVLQALRGSSIELLLDLP  67

Query  498  NSDLLPFSQFQSN  536
            N DL   +  Q N
Sbjct  68   NIDLQRVASSQDN  80



>ref|XP_007204356.1| hypothetical protein PRUPE_ppa007158mg [Prunus persica]
 gb|EMJ05555.1| hypothetical protein PRUPE_ppa007158mg [Prunus persica]
Length=379

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR AD++P+PDK   L++   IK VRIYD++  VLKAF+ TG++L++G+PN  L
Sbjct  35   GINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLDLVVGLPNGYL  92



>ref|XP_007139000.1| hypothetical protein PHAVU_009G256400g [Phaseolus vulgaris]
 gb|ESW10994.1| hypothetical protein PHAVU_009G256400g [Phaseolus vulgaris]
Length=370

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  315  ICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGI  494
            I   ++IGVCYG   ++LP+ ++ + L + +NI+ +R+YD N   L+A  N+GIEL++G+
Sbjct  28   ITTDAQIGVCYGMMGNNLPSANEVINLYRSNNIRRMRLYDPNQAALQALRNSGIELILGV  87

Query  495  PNSDL  509
            PNSDL
Sbjct  88   PNSDL  92



>gb|KJB64677.1| hypothetical protein B456_010G062700 [Gossypium raimondii]
Length=390

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            G+ YGR A++LP+PD+ V L++   I+ VRIYD++  VLKAF+ TG+E+++G+PN +L
Sbjct  30   GINYGRIANNLPSPDEVVTLLKAAKIRNVRIYDADQSVLKAFSGTGLEIVVGLPNGNL  87



>ref|XP_008240769.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=343

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G++IGVCYG   D LP P + + L +Q+NI  +R+YD N   L A   + IELM+G+P
Sbjct  30   TTGAQIGVCYGMLGDRLPPPSEVIALYKQNNIGRMRLYDPNQAALAALRGSNIELMLGVP  89

Query  498  NSDLLPFSQFQSN  536
            N +L   +  Q+N
Sbjct  90   NDNLQSLASSQAN  102



>ref|XP_009597885.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q' 
[Nicotiana tomentosiformis]
 sp|P36401.1|E13H_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
PR-Q'; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
AltName: Full=PR-35; Flags: Precursor [Nicotiana tabacum]
Length=339

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR  + LP+P   V L  ++NI+ +RIYD +   L+A   + IELM+G+PN 
Sbjct  23   GAQAGVCYGRQGNGLPSPADVVSLCNRNNIRRMRIYDPDQPTLEALRGSNIELMLGVPNP  82

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  83   DLENVAASQAN  93



>emb|CBZ05769.1| glucan endo-1,3-beta glucosidase [Fagus sylvatica]
Length=126

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +GVCYG   +DLP+  + + L + +NI  +RIYD N  VL+A  ++ IE+MIG+PNSDL
Sbjct  21   VGVCYGMLGNDLPSVQEVISLYKSNNINRMRIYDPNQAVLQALRDSNIEVMIGVPNSDL  79



>ref|XP_006284042.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
 gb|EOA16940.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
Length=346

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G  +GVCYG   ++LP+    + L ++ NI+ VR+YD N   L A  N+GIE+++G+P
Sbjct  21   TSGEPVGVCYGMMGNNLPSHSDTIALFREKNIRRVRLYDPNQAALNALKNSGIEVIVGVP  80

Query  498  NSDL  509
            NSDL
Sbjct  81   NSDL  84



>ref|XP_010473043.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Camelina 
sativa]
Length=391

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPN  500
            G+ YGR AD++P+PDK V L++Q  I+ VR+YD++  VL+AF+ TG++L++G+PN
Sbjct  39   GINYGRIADNIPSPDKVVLLLKQAKIRNVRLYDADHTVLEAFSGTGLDLVVGLPN  93



>emb|CAA38324.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
Length=346

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR  + LP+P   V L  ++NI+ +RIYD +   L+A   + IELM+G+PN 
Sbjct  30   GAQAGVCYGRQGNGLPSPADVVSLCNRNNIRRMRIYDPDQPTLEALRGSNIELMLGVPNP  89

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  90   DLENVAASQAN  100



>gb|KFK34960.1| hypothetical protein AALP_AA5G216300 [Arabis alpina]
Length=319

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR  ++LP P  AV L +Q NI+ +R+YD N +VL A   + IEL++ +PN DL
Sbjct  11   QIGVCYGRIGNNLPRPADAVALYRQRNIRRMRLYDPNPEVLAALRGSNIELLLDVPNPDL  70



>dbj|BAJ92436.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  318  CRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIP  497
              G ++GVCYGR A +LP P   VQLI+++ I  VRIYD+N  VL A ANT I++ + + 
Sbjct  30   AEGGEVGVCYGRMAGNLPDPTSVVQLIKRNGITMVRIYDTNPTVLAALANTDIKVTVELT  89

Query  498  NSDL  509
            N +L
Sbjct  90   NEEL  93



>ref|NP_001059883.1| Os07g0539100 [Oryza sativa Japonica Group]
 dbj|BAC84500.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21797.1| Os07g0539100 [Oryza sativa Japonica Group]
 dbj|BAG88368.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90302.1| unnamed protein product [Oryza sativa Japonica Group]
Length=553

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
            +IGVCYGR+A +L  P + V+L+  ++I  VRIYD++  VL A ANTGI++M+ +PN DL
Sbjct  28   EIGVCYGRDASNLIDPPEVVKLLNANSITMVRIYDTDPTVLNALANTGIKVMVMLPNKDL  87



>gb|ACZ74626.1| beta-1,3-glucanase form RRII Gln 3 [Hevea brasiliensis]
Length=374

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            +++GVCYG+  ++LP   + + L +Q NIK +RIYD N +VL+A   + IEL++G+PNSD
Sbjct  36   AQVGVCYGKLGNNLPPASEVIALYKQSNIKRMRIYDPNQEVLQALRGSNIELILGVPNSD  95

Query  507  L  509
            L
Sbjct  96   L  96



>gb|AFU52648.1| beta-1,3-glucanase 13 [Solanum tuberosum]
 gb|AGI42666.1| beta-1,3-glucanase class III, partial [Solanum tuberosum]
Length=344

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGRN + LP+P   V L  ++NI+ +RIYD +   L+A   + IEL++G+PN 
Sbjct  28   GAQTGVCYGRNGNGLPSPVDVVGLCNRNNIRRMRIYDPHQPTLQALRGSNIELILGVPNP  87

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  88   DLQNIASSQAN  98



>gb|EEE67335.1| hypothetical protein OsJ_24590 [Oryza sativa Japonica Group]
Length=521

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  276  LIFACSllllllGICRGSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLK  455
            L+ A +L LLLL      +IGVCYGR+A +L  P + V+L+  ++I  VRIYD++  VL 
Sbjct  10   LLVATALPLLLLSTADAGEIGVCYGRDASNLIDPPEVVKLLNANSITMVRIYDTDPTVLN  69

Query  456  AFANTGIELMIGIPNSDL  509
            A ANTGI++M+ +PN DL
Sbjct  70   ALANTGIKVMVMLPNKDL  87



>emb|CDP14183.1| unnamed protein product [Coffea canephora]
Length=343

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR   +LP+P   V L  Q+NIK +RIYD +   L+A   + IE+++G+PN+
Sbjct  27   GAQTGVCYGRLGSNLPSPADVVALCNQNNIKRMRIYDPDQSTLQALGGSNIEVILGVPNT  86

Query  504  DLLPFSQFQSN  536
            DL   +  Q N
Sbjct  87   DLQNVAASQDN  97



>ref|XP_010273328.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=291

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  IGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLL  512
            IGVCYG + ++LP PD+ + L +++NI+ +R+Y  N  VL+A  ++ IELM+G+PN +L 
Sbjct  9    IGVCYGMSGNNLPHPDEVIDLYKRNNIQKMRLYAPNESVLEALKDSSIELMLGVPNHELQ  68

Query  513  PFSQFQSN  536
              ++ Q+N
Sbjct  69   VVAKDQNN  76



>ref|NP_001130652.1| uncharacterized protein LOC100191753 precursor [Zea mays]
 gb|ACF78958.1| unknown [Zea mays]
 gb|ACN34183.1| unknown [Zea mays]
 gb|AFW86789.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=407

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +3

Query  288  CSllllllGICR-GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFA  464
            C+ L   +G  R  + +G+ YG+ A++LP P + VQL+    I  VRIYD N QVL AFA
Sbjct  20   CTFLSSEVGFVRQATALGINYGQVANNLPPPAQVVQLLSSLRIGKVRIYDVNPQVLTAFA  79

Query  465  NTGIELMIGIPNSDLLP  515
             TGIEL++ +P+ DL+P
Sbjct  80   GTGIELVVTVPD-DLVP  95



>gb|EMT12040.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=541

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G ++GVCYGR A +LP P   VQL+++++I  VRIYD++  VL++ ANTGI++ + + N 
Sbjct  26   GGEVGVCYGRMATNLPDPATVVQLLKKNSITMVRIYDTDPTVLRSLANTGIKVTVELTNE  85

Query  504  DL  509
            +L
Sbjct  86   EL  87



>ref|XP_010279618.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X2 
[Nelumbo nucifera]
Length=398

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +3

Query  312  GICRG-SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMI  488
            G  RG + +G+ YG+ A+DLP+PDK ++L++   I   RIYD+N QVL AFAN+G++L++
Sbjct  22   GFLRGVAALGINYGQVANDLPSPDKVLELLRSLRISKARIYDTNPQVLTAFANSGVDLIV  81

Query  489  GIPNSDL  509
             + N  L
Sbjct  82   TVENEML  88



>emb|CDP14179.1| unnamed protein product [Coffea canephora]
Length=343

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR   +LP+P   V L  Q NIK +RIYD +   L+A   + IE+++G+PN+
Sbjct  27   GAQTGVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIEVILGVPNT  86

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  87   DLQNVAASQAN  97



>emb|CDP10428.1| unnamed protein product [Coffea canephora]
Length=393

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  GVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDLLP  515
            G+ YGR AD+LP PDK  +L++   IK VRIYD++  VL+ F+ TG+EL+IG+PN  +  
Sbjct  36   GINYGRIADNLPPPDKVAKLLRAAKIKNVRIYDADHSVLQGFSGTGLELIIGLPNDHVKE  95

Query  516  FS  521
             S
Sbjct  96   MS  97



>gb|AFK34061.1| unknown [Medicago truncatula]
Length=250

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  327  SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSD  506
            ++IG+CYG   ++LP  ++ + L + +NIK +R+YD N   L A  N+GIEL++G+PNSD
Sbjct  25   AQIGICYGMMGNNLPPANEVINLYKANNIKRMRLYDPNQAALNALRNSGIELILGVPNSD  84

Query  507  L  509
            L
Sbjct  85   L  85



>ref|XP_010279617.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X1 
[Nelumbo nucifera]
Length=399

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +3

Query  312  GICRG-SKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMI  488
            G  RG + +G+ YG+ A+DLP+PDK ++L++   I   RIYD+N QVL AFAN+G++L++
Sbjct  22   GFLRGVAALGINYGQVANDLPSPDKVLELLRSLRISKARIYDTNPQVLTAFANSGVDLIV  81

Query  489  GIPNSDL  509
             + N  L
Sbjct  82   TVENEML  88



>emb|CAE54080.1| beta 1-3 glucanase [Fagus sylvatica]
Length=179

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  KIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNSDL  509
             +GVCYG   ++LP+  + + L + +NIK +RIYD N  VL+A   + IE+MIG+PNSDL
Sbjct  38   SVGVCYGMLGNNLPSVQEVISLYKSNNIKRMRIYDPNQAVLQALRGSNIEVMIGVPNSDL  97



>gb|AAQ90286.1| beta-1,3-glucanase, basic [Coffea arabica x Coffea canephora]
Length=343

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G++ GVCYGR   +LP+P   V L  Q NIK +RIYD +   L+A   + IE+++G+PN+
Sbjct  27   GAQTGVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIEVILGVPNT  86

Query  504  DLLPFSQFQSN  536
            DL   +  Q+N
Sbjct  87   DLQNVAASQAN  97



>dbj|BAJ93567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  324  GSKIGVCYGRNADDLPTPDKAVQLIQQHNIKYVRIYDSNIQVLKAFANTGIELMIGIPNS  503
            G ++GVCYGR A +LP P   VQLI+++ I  VRIYD+N  VL A ANT I++ + + N 
Sbjct  32   GGEVGVCYGRMAGNLPDPTSVVQLIKRNGITMVRIYDTNPTVLAALANTDIKVTVELTNE  91

Query  504  DL  509
            +L
Sbjct  92   EL  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800