BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027G06

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342320.1|  PREDICTED: TBCC domain-containing protein 1-...    251   1e-76   Solanum tuberosum [potatoes]
ref|XP_009629812.1|  PREDICTED: TBCC domain-containing protein 1-...    247   5e-75   Nicotiana tomentosiformis
ref|XP_009629687.1|  PREDICTED: TBCC domain-containing protein 1-...    244   4e-74   Nicotiana tomentosiformis
ref|XP_004249279.1|  PREDICTED: TBCC domain-containing protein 1        244   5e-74   Solanum lycopersicum
ref|XP_006351339.1|  PREDICTED: TBCC domain-containing protein 1-...    244   6e-74   Solanum tuberosum [potatoes]
ref|XP_009772589.1|  PREDICTED: TBCC domain-containing protein 1-...    243   2e-73   Nicotiana sylvestris
ref|XP_009797552.1|  PREDICTED: TBCC domain-containing protein 1-...    240   2e-72   Nicotiana sylvestris
emb|CDP20019.1|  unnamed protein product                                232   2e-69   Coffea canephora [robusta coffee]
ref|XP_008240959.1|  PREDICTED: TBCC domain-containing protein 1 ...    213   3e-62   Prunus mume [ume]
ref|XP_008240958.1|  PREDICTED: TBCC domain-containing protein 1 ...    213   3e-62   Prunus mume [ume]
ref|XP_002278205.1|  PREDICTED: TBCC domain-containing protein 1-...    212   6e-62   Vitis vinifera
ref|XP_007203759.1|  hypothetical protein PRUPE_ppa003584mg             211   3e-61   Prunus persica
ref|XP_010548390.1|  PREDICTED: TBCC domain-containing protein 1-...    209   2e-60   Tarenaya hassleriana [spider flower]
gb|KJB82777.1|  hypothetical protein B456_013G212400                    203   2e-60   Gossypium raimondii
gb|KDO57724.1|  hypothetical protein CISIN_1g041482mg                   196   1e-59   Citrus sinensis [apfelsine]
gb|KJB82778.1|  hypothetical protein B456_013G212400                    203   1e-59   Gossypium raimondii
ref|XP_008367539.1|  PREDICTED: TBCC domain-containing protein 1-...    202   1e-59   
ref|XP_008392091.1|  PREDICTED: TBCC domain-containing protein 1        206   1e-59   
ref|NP_973669.1|  C-CAP/cofactor C-like domain-containing protein       206   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181752.3|  C-CAP/cofactor C-like domain-containing protein       206   2e-59   
ref|XP_009369843.1|  PREDICTED: TBCC domain-containing protein 1-...    206   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_009369834.1|  PREDICTED: TBCC domain-containing protein 1-...    206   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_009376106.1|  PREDICTED: TBCC domain-containing protein 1-...    206   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_003554199.1|  PREDICTED: TBCC domain-containing protein 1-...    206   2e-59   Glycine max [soybeans]
ref|XP_010524365.1|  PREDICTED: TBCC domain-containing protein 1-...    206   2e-59   Tarenaya hassleriana [spider flower]
gb|KHF98763.1|  TBCC domain-containing 1                                206   3e-59   Gossypium arboreum [tree cotton]
ref|XP_003520533.1|  PREDICTED: TBCC domain-containing protein 1-...    205   4e-59   Glycine max [soybeans]
ref|XP_003554198.1|  PREDICTED: TBCC domain-containing protein 1-...    204   6e-59   Glycine max [soybeans]
ref|XP_008393107.1|  PREDICTED: uncharacterized protein LOC103455298    202   6e-59   
ref|XP_004304384.1|  PREDICTED: TBCC domain-containing protein 1 ...    204   8e-59   Fragaria vesca subsp. vesca
ref|XP_011468069.1|  PREDICTED: TBCC domain-containing protein 1 ...    204   1e-58   Fragaria vesca subsp. vesca
ref|XP_010265832.1|  PREDICTED: TBCC domain-containing protein 1-...    202   1e-58   
ref|XP_003521203.1|  PREDICTED: TBCC domain-containing protein 1-...    204   1e-58   Glycine max [soybeans]
ref|XP_010111391.1|  TBCC domain-containing protein 1                   206   1e-58   
gb|AGJ83863.1|  tublin binding cofactor C                               203   2e-58   Gossypium hirsutum [American cotton]
gb|KJB82780.1|  hypothetical protein B456_013G212400                    202   2e-58   Gossypium raimondii
ref|XP_010265831.1|  PREDICTED: TBCC domain-containing protein 1-...    203   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010257397.1|  PREDICTED: TBCC domain-containing protein 1-...    203   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010507501.1|  PREDICTED: uncharacterized protein LOC104784134    201   3e-58   Camelina sativa [gold-of-pleasure]
gb|KJB82776.1|  hypothetical protein B456_013G212400                    202   4e-58   Gossypium raimondii
ref|XP_006402830.1|  hypothetical protein EUTSA_v10005862mg             202   5e-58   Eutrema salsugineum [saltwater cress]
gb|KFK35082.1|  hypothetical protein AALP_AA5G233000                    202   6e-58   Arabis alpina [alpine rockcress]
ref|XP_007162300.1|  hypothetical protein PHAVU_001G140500g             202   6e-58   Phaseolus vulgaris [French bean]
ref|XP_007162298.1|  hypothetical protein PHAVU_001G140300g             202   6e-58   Phaseolus vulgaris [French bean]
gb|EYU39914.1|  hypothetical protein MIMGU_mgv1a003654mg                201   8e-58   Erythranthe guttata [common monkey flower]
gb|KDP24597.1|  hypothetical protein JCGZ_25513                         201   9e-58   Jatropha curcas
ref|NP_567059.1|  Tubulin binding cofactor C domain-containing pr...    201   9e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427682.1|  PREDICTED: TBCC domain-containing protein 1-...    201   1e-57   Camelina sativa [gold-of-pleasure]
gb|KHN07410.1|  TBCC domain-containing protein 1                        201   1e-57   Glycine soja [wild soybean]
gb|KJB15037.1|  hypothetical protein B456_002G156800                    200   1e-57   Gossypium raimondii
ref|XP_010516427.1|  PREDICTED: TBCC domain-containing protein 1-...    201   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006290821.1|  hypothetical protein CARUB_v10016930mg             201   2e-57   Capsella rubella
ref|XP_002876443.1|  hypothetical protein ARALYDRAFT_486241             200   2e-57   
gb|KHG16745.1|  TBCC domain-containing 1                                200   2e-57   Gossypium arboreum [tree cotton]
gb|KJB15036.1|  hypothetical protein B456_002G156800                    199   3e-57   Gossypium raimondii
gb|KJB15038.1|  hypothetical protein B456_002G156800                    199   4e-57   Gossypium raimondii
ref|XP_007028946.1|  Tubulin binding cofactor C domain-containing...    199   5e-57   
emb|CDX79886.1|  BnaA05g02700D                                          199   6e-57   
ref|XP_009104081.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    199   6e-57   Brassica rapa
ref|XP_009139004.1|  PREDICTED: TBCC domain-containing protein 1-...    199   7e-57   Brassica rapa
gb|KJB16388.1|  hypothetical protein B456_002G228100                    198   1e-56   Gossypium raimondii
ref|XP_009142814.1|  PREDICTED: TBCC domain-containing protein 1        198   1e-56   Brassica rapa
ref|XP_006411483.1|  hypothetical protein EUTSA_v10016442mg             198   1e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006437044.1|  hypothetical protein CICLE_v10031101mg             198   2e-56   Citrus clementina [clementine]
ref|XP_010672700.1|  PREDICTED: TBCC domain-containing protein 1        197   2e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN54813.1|  hypothetical protein Csa_4G507430                       197   2e-56   Cucumis sativus [cucumbers]
ref|NP_001190120.1|  Tubulin binding cofactor C domain-containing...    198   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156008.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    197   3e-56   
ref|XP_004146385.1|  PREDICTED: TBCC domain-containing protein 1-...    197   3e-56   Cucumis sativus [cucumbers]
gb|EPS74445.1|  hypothetical protein M569_00304                         197   3e-56   Genlisea aurea
ref|XP_009116487.1|  PREDICTED: TBCC domain-containing protein 1        197   3e-56   Brassica rapa
emb|CDX98257.1|  BnaC06g16180D                                          197   4e-56   
ref|XP_006485027.1|  PREDICTED: TBCC domain-containing protein 1-...    196   6e-56   Citrus sinensis [apfelsine]
ref|XP_011078850.1|  PREDICTED: TBCC domain-containing protein 1-...    196   9e-56   Sesamum indicum [beniseed]
gb|KJB36105.1|  hypothetical protein B456_006G141400                    195   2e-55   Gossypium raimondii
emb|CDX67713.1|  BnaA07g17530D                                          196   2e-55   
emb|CDY53502.1|  BnaC04g02540D                                          196   2e-55   Brassica napus [oilseed rape]
emb|CDY61748.1|  BnaA04g27540D                                          195   3e-55   Brassica napus [oilseed rape]
gb|KJB36106.1|  hypothetical protein B456_006G141400                    195   3e-55   Gossypium raimondii
ref|XP_002532335.1|  conserved hypothetical protein                     194   7e-55   Ricinus communis
ref|XP_004497930.1|  PREDICTED: TBCC domain-containing protein 1-...    193   8e-55   Cicer arietinum [garbanzo]
gb|KHG18606.1|  TBCC domain-containing 1                                193   1e-54   Gossypium arboreum [tree cotton]
ref|XP_006381055.1|  tubulin-specific chaperone C-related family ...    193   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002323291.1|  tubulin-specific chaperone C-related family ...    193   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010943570.1|  PREDICTED: TBCC domain-containing protein 1-...    192   2e-54   Elaeis guineensis
emb|CDY47657.1|  BnaC04g23940D                                          193   2e-54   Brassica napus [oilseed rape]
ref|XP_010517737.1|  PREDICTED: TBCC domain-containing protein 1-...    192   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008800652.1|  PREDICTED: TBCC domain-containing protein 1-...    192   3e-54   Phoenix dactylifera
ref|XP_006293916.1|  hypothetical protein CARUB_v10022907mg             191   5e-54   
ref|XP_010508603.1|  PREDICTED: TBCC domain-containing protein 1-...    189   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011020269.1|  PREDICTED: TBCC domain-containing protein 1 ...    189   5e-53   Populus euphratica
ref|XP_011020268.1|  PREDICTED: TBCC domain-containing protein 1 ...    189   5e-53   Populus euphratica
ref|XP_011020267.1|  PREDICTED: TBCC domain-containing protein 1 ...    189   6e-53   Populus euphratica
ref|XP_011033250.1|  PREDICTED: TBCC domain-containing protein 1 ...    187   1e-52   Populus euphratica
ref|XP_011033249.1|  PREDICTED: TBCC domain-containing protein 1 ...    187   1e-52   Populus euphratica
ref|XP_010506033.1|  PREDICTED: TBCC domain-containing protein 1-...    187   3e-52   Camelina sativa [gold-of-pleasure]
emb|CAB67617.1|  putative protein                                       186   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442093.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    184   2e-51   Cucumis melo [Oriental melon]
ref|XP_002881827.1|  hypothetical protein ARALYDRAFT_483312             183   6e-51   
gb|KHN26370.1|  TBCC domain-containing protein 1                        182   6e-51   Glycine soja [wild soybean]
ref|XP_010928451.1|  PREDICTED: TBCC domain-containing protein 1 ...    182   1e-50   
ref|XP_011075175.1|  PREDICTED: TBCC domain-containing protein 1-...    181   2e-50   Sesamum indicum [beniseed]
ref|XP_010928450.1|  PREDICTED: TBCC domain-containing protein 1 ...    182   2e-50   
gb|KHN26369.1|  TBCC domain-containing protein 1                        179   1e-49   Glycine soja [wild soybean]
ref|XP_006850073.1|  hypothetical protein AMTR_s00022p00213770          178   4e-49   Amborella trichopoda
emb|CDY06067.1|  BnaA09g37130D                                          177   5e-49   
ref|XP_009391882.1|  PREDICTED: TBCC domain-containing protein 1-...    176   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX71986.1|  BnaC08g28880D                                          176   3e-48   
ref|XP_008787292.1|  PREDICTED: TBCC domain-containing protein 1-...    172   7e-47   Phoenix dactylifera
ref|XP_008795746.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    171   1e-46   Phoenix dactylifera
ref|XP_009411800.1|  PREDICTED: TBCC domain-containing protein 1-...    171   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493562.1|  PREDICTED: TBCC domain-containing protein 1-...    170   3e-46   Cicer arietinum [garbanzo]
ref|XP_010913921.1|  PREDICTED: TBCC domain-containing protein 1-...    168   2e-45   Elaeis guineensis
gb|ABR16182.1|  unknown                                                 162   3e-43   Picea sitchensis
gb|KEH41654.1|  tubulin-binding cofactor C domain protein               160   1e-42   Medicago truncatula
ref|XP_003625224.1|  TBCC domain-containing protein                     158   5e-42   
ref|XP_010038901.1|  PREDICTED: TBCC domain-containing protein 1        154   1e-40   
ref|XP_003563624.1|  PREDICTED: TBCC domain-containing protein 1-...    146   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_002986516.1|  hypothetical protein SELMODRAFT_182480             144   5e-37   
ref|XP_002964936.1|  hypothetical protein SELMODRAFT_439144             140   2e-35   Selaginella moellendorffii
gb|EEC80975.1|  hypothetical protein OsI_23703                          140   2e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001058077.1|  Os06g0614300                                       139   3e-35   
dbj|BAJ93674.1|  predicted protein                                      134   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003571239.1|  PREDICTED: TBCC domain-containing protein 1-...    130   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010233970.1|  PREDICTED: TBCC domain-containing protein 1-...    130   3e-32   Brachypodium distachyon [annual false brome]
gb|AFW66196.1|  hypothetical protein ZEAMMB73_400795                    129   1e-31   
gb|ACN28202.1|  unknown                                                 129   2e-31   Zea mays [maize]
ref|XP_002453473.1|  hypothetical protein SORBIDRAFT_04g006490          128   3e-31   Sorghum bicolor [broomcorn]
dbj|BAJ90629.1|  predicted protein                                      128   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66013.1|  hypothetical protein OsJ_21970                          127   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643390.1|  PREDICTED: hypothetical protein isoform X2         126   2e-30   Zea mays [maize]
ref|NP_001144767.1|  hypothetical protein                               126   2e-30   Zea mays [maize]
ref|XP_008643389.1|  PREDICTED: hypothetical protein isoform X1         126   2e-30   Zea mays [maize]
ref|XP_004965884.1|  PREDICTED: TBCC domain-containing protein 1-...    125   3e-30   Setaria italica
ref|XP_001757659.1|  predicted protein                                  125   5e-30   
ref|XP_004951581.1|  PREDICTED: TBCC domain-containing protein 1-...    124   8e-30   Setaria italica
ref|XP_001778693.1|  predicted protein                                  123   2e-29   
gb|AFW76295.1|  hypothetical protein ZEAMMB73_911559                    120   1e-28   
ref|NP_001168301.1|  hypothetical protein                               120   2e-28   Zea mays [maize]
gb|EEC72669.1|  hypothetical protein OsI_06222                          117   2e-27   Oryza sativa Indica Group [Indian rice]
gb|AAB88648.1|  hypothetical protein                                    116   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046181.1|  Os02g0194800                                       115   2e-26   
gb|AFN53653.1|  putative G-patch domain protein                         113   1e-25   Linum usitatissimum
ref|XP_008657282.1|  PREDICTED: spidroin-1-like                         106   2e-24   
emb|CBI30042.3|  unnamed protein product                                107   6e-24   Vitis vinifera
ref|XP_001758135.1|  predicted protein                                  104   1e-22   
gb|EMS61357.1|  hypothetical protein TRIUR3_14905                     83.6    2e-17   Triticum urartu
ref|XP_006648417.1|  PREDICTED: TBCC domain-containing protein 1-...  87.4    9e-17   Oryza brachyantha
ref|XP_006657134.1|  PREDICTED: TBCC domain-containing protein 1-...  87.0    1e-16   Oryza brachyantha
gb|EEE56495.1|  hypothetical protein OsJ_05741                        86.7    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765734.1|  predicted protein                                84.0    2e-15   
ref|XP_008656241.1|  PREDICTED: uncharacterized protein LOC103635607  67.8    5e-11   Zea mays [maize]
ref|XP_002505027.1|  predicted protein                                49.3    7e-04   Micromonas commoda



>ref|XP_006342320.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=567

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P YIHPRR+PFEHGLL I KLIFTDGTQTLGPIKDKLLSLS++S +RVN +S++E+LQIS
Sbjct  18   PAYIHPRRDPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSLSSESTYRVNPESIAESLQIS  77

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
            PD A+L+LET+A VLH+ SDPLV+A P+E+ SVGVNVFDLVVFLYIQSYKRLLPKGHKDS
Sbjct  78   PDQAQLLLETIACVLHSVSDPLVTAKPSEIGSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  137

Query  475  AAVADVWPSTSAFDGFLSALSPLQL  549
            AAVADVWPSTSAFDGFLSALSPLQL
Sbjct  138  AAVADVWPSTSAFDGFLSALSPLQL  162



>ref|XP_009629812.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=570

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  279
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SAHR N ++++E
Sbjct  16   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSAHRANFEAIAE  75

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  76   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  135

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  136  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  166



>ref|XP_009629687.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=572

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 5/151 (3%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-----SAHRVNSKSVSE  279
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTHQRVNTESIAE  77

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
            +LQISP+HARLVLET+A VLH++SDPLV+A P+EV SVGVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISPEHARLVLETIACVLHSDSDPLVTAKPSEVGSVGVNVFDLVVFLYIQSYKRLLPK  137

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  168



>ref|XP_004249279.1| PREDICTED: TBCC domain-containing protein 1 [Solanum lycopersicum]
Length=569

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            +  +  P+YIHPRREPFEHGLL I KLIFTDG QTL  I+DKLLSLS+ S HRVN ++++
Sbjct  14   STASTSPVYIHPRREPFEHGLLPIPKLIFTDGAQTLTQIRDKLLSLSSGSTHRVNFEAIA  73

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQIS DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLP
Sbjct  74   EALQISHDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLP  133

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  134  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  165



>ref|XP_006351339.1| PREDICTED: TBCC domain-containing protein 1-like [Solanum tuberosum]
Length=569

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+YIHPRREPFEHGLL I KLIFTDG QTL PI+DKLLSLS+ S HRVN ++++E  QIS
Sbjct  20   PVYIHPRREPFEHGLLPIPKLIFTDGAQTLIPIRDKLLSLSSGSIHRVNFEAIAEAFQIS  79

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLPKGHKDS
Sbjct  80   HDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLPKGHKDS  139

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
            AAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  140  AAVADVWPSTSAFDGFLSALSPLQLV  165



>ref|XP_009772589.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=568

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  279
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SA R N ++++E
Sbjct  14   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSALRANFEAIAE  73

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  74   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  133

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  134  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  164



>ref|XP_009797552.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=572

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA-----DSAHRVNSKSVSE  279
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTNQRVNTESIAE  77

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
            +LQIS +HARLVLET+A VLH++SDPLV+A P+EV S+GVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISLEHARLVLETIACVLHSDSDPLVTAKPSEVGSIGVNVFDLVVFLYIQSYKRLLPK  137

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLV
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSALSPLQLV  168



>emb|CDP20019.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 4/149 (3%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS----AHRVNSKSVSETL  285
            IYIHPRREPFEHGLL I KLIF+DGTQ+L  IKDKLLSLS+ S     HRVNS +++ETL
Sbjct  35   IYIHPRREPFEHGLLPIPKLIFSDGTQSLASIKDKLLSLSSSSSSESTHRVNSAAIAETL  94

Query  286  QISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGH  465
            QISPDHARLVL+T+++VLHN++DPLV+A P+E+D VG+ VFDLVVFLY+QSYKRLLPKGH
Sbjct  95   QISPDHARLVLDTISSVLHNDTDPLVNAKPSEIDDVGIGVFDLVVFLYVQSYKRLLPKGH  154

Query  466  KDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            +DSAAVADVWPSTSAFDGFLSAL+PLQLV
Sbjct  155  RDSAAVADVWPSTSAFDGFLSALTPLQLV  183



>ref|XP_008240959.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Prunus 
mume]
Length=564

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_008240958.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Prunus 
mume]
Length=565

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_002278205.1| PREDICTED: TBCC domain-containing protein 1-like [Vitis vinifera]
Length=568

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-SAHRVNSKSVSETLQ  288
            E ++IHPRREPFEHGLL I KLIFTD   TL P++DKL++ +AD    RV+SK++S+ LQ
Sbjct  17   ESVFIHPRREPFEHGLLPIPKLIFTDPNATLAPLRDKLVAAAADHPTRRVDSKALSDALQ  76

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLV++T+ +VLH+++DPLV A  +E+D+VG +V+DL++FLYIQSYKRLLP+ HK
Sbjct  77   ISLDHARLVVDTLTSVLHDDADPLVRAKSSEIDAVGADVYDLILFLYIQSYKRLLPRTHK  136

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  DSAAVADVWPSTSAFDGYLSALSPLQLV  164



>ref|XP_007203759.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
 gb|EMJ04958.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
Length=564

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VL +ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLQSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_010548390.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=577

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD  QTL P+K KL +  A S +RV S ++SE LQIS 
Sbjct  31   LVIHPRREPFEHGLLPIQKLIFTDPIQTLTPVKQKLAA--AASNNRVGSSALSEALQISG  88

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+A+VLH+++DPL+ A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  89   DHARLVLETLASVLHSDADPLIRAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSA  148

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  149  AVADVWPSTSAFDGYLSALSPIQLV  173



>gb|KJB82777.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=357

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLV  165



>gb|KDO57724.1| hypothetical protein CISIN_1g041482mg [Citrus sinensis]
Length=192

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKLAP-----TGRVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL T+A+VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLNTLASVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSPLQ
Sbjct  142  ADVWPSTSAFDGYLSALSPLQ  162



>gb|KJB82778.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=434

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLV  165



>ref|XP_008367539.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=381

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_008392091.1| PREDICTED: TBCC domain-containing protein 1 [Malus domestica]
Length=564

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|NP_973669.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAU05480.1| At2g42230 [Arabidopsis thaliana]
 gb|AAU95425.1| At2g42230 [Arabidopsis thaliana]
 dbj|BAE98485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10091.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=568

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            +VADVWPSTSAFDG+LSALSP+QLV
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLV  164



>ref|NP_181752.3| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC10092.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=562

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            +VADVWPSTSAFDG+LSALSP+QLV
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLV  164



>ref|XP_009369843.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=564

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_009369834.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=565

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_009376106.1| PREDICTED: TBCC domain-containing protein 1-like [Pyrus x bretschneideri]
Length=564

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVNDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH++S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
             DVWPSTSAFDG+LSALSPLQLV
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_010524365.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=569

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF+D  Q LGP+K+KL++  A S +RV S ++S+ LQIS DH
Sbjct  25   IHPRREPFEHGLLPIQKLIFSDPIQALGPVKEKLVA--AASNNRVGSAALSDALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH++SDPLV A   EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSDSDPLVLAKAEEVDSVGADLRDLILFLYIQSYKKLLPRPHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  143  ADVWPSTSAFDGYLSALSPIQLV  165



>gb|KHF98763.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=598

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S HRVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTHRVNSDALADALQISSEH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLSDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLV  166



>ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D TQTL  +K KLL LS++   RV+S ++SE+LQI  +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPTQTLISLKQKLLELSSN--QRVDSAAISESLQIPIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH++S+PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVAAKLEEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Glycine 
max]
Length=566

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I + IF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRFIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
             DVWPSTSAFDG+LSALSPLQLV
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_008393107.1| PREDICTED: uncharacterized protein LOC103455298 [Malus domestica]
Length=450

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSXAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_004304384.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  143  ADVWPSTSAFDGYLSALSPLQLV  165



>ref|XP_011468069.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  143  ADVWPSTSAFDGYLSALSPLQLV  165



>ref|XP_010265832.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=520

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            SA+VADVWPSTSAFDG+LSALSP+QLV
Sbjct  138  SASVADVWPSTSAFDGYLSALSPMQLV  164



>ref|XP_003521203.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=566

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLGEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLV  161



>ref|XP_010111391.1| TBCC domain-containing protein 1 [Morus notabilis]
 gb|EXC30869.1| TBCC domain-containing protein 1 [Morus notabilis]
Length=760

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD TQTL P+K KL+  S+ +  R+++ ++++  QIS DH
Sbjct  32   MHPRREPFEHGLLPIPKLIFTDPTQTLIPLKRKLVEQSS-TGQRISASAIADAFQISIDH  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH+ESDPLV A P+E+D VG +V DLV+FLYIQSYKRLLP+ HKDSA+V
Sbjct  91   ARLVLDTLASILHSESDPLVRAKPSEIDDVGADVHDLVLFLYIQSYKRLLPRTHKDSASV  150

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  151  ADVWPSTSAFDGYLSALSPLQLV  173



>gb|AGJ83863.1| tublin binding cofactor C [Gossypium hirsutum]
Length=570

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S  RVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTQRVNSDALADALQISSEH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLRDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLV  166



>gb|KJB82780.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=534

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLV  165



>ref|XP_010265831.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=567

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            SA+VADVWPSTSAFDG+LSALSP+QLV
Sbjct  138  SASVADVWPSTSAFDGYLSALSPMQLV  164



>ref|XP_010257397.1| PREDICTED: TBCC domain-containing protein 1-like [Nelumbo nucifera]
Length=575

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 129/152 (85%), Gaps = 5/152 (3%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-----RVNSKSVS  276
            EP+++  RREPFE+GLL I+KLIF+DGT TLGP+K+KL+  ++ S+      RV++  +S
Sbjct  20   EPVFLRARREPFEYGLLPISKLIFSDGTATLGPLKEKLIQRASASSPPSSPLRVDADGIS  79

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQIS ++ARLVL+T+AAVLH++SDPLVSA+P E+DSVG +V  L++FLYIQSYKRLLP
Sbjct  80   EVLQISIENARLVLDTLAAVLHSDSDPLVSASPQELDSVGADVNYLILFLYIQSYKRLLP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            + HKDS AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  140  RTHKDSVAVADVWPSTSAFDGYLSALSPLQLV  171



>ref|XP_010507501.1| PREDICTED: uncharacterized protein LOC104784134 [Camelina sativa]
Length=512

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  33   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  91   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  150

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  151  ADVWPSTSAFDGYLSALSPIQLV  173



>gb|KJB82776.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
 gb|KJB82779.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=569

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLV  165



>ref|XP_006402830.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
 gb|ESQ44283.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
Length=573

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S +V++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAVADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  149  ADVWPSTSAFDGYLSALSPIQLV  171



>gb|KFK35082.1| hypothetical protein AALP_AA5G233000 [Arabis alpina]
Length=576

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL PIK KL   S +  +RV S +V++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPIKQKLADASTN--NRVGSVAVADVLQISGDH  89

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  150  ADVWPSTSAFDGYLSALSPIQLV  172



>ref|XP_007162300.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
 gb|ESW34294.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
Length=565

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++S++LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLQLSSN--QRVDSVAISDSLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A++LH++S+PL  A   E+DSVGV+V DLV+FLYIQSYKR+LP+ HKDS AV
Sbjct  79   AKLVLDTLASILHSDSEPLTVAKFGEIDSVGVDVHDLVLFLYIQSYKRILPRTHKDSVAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDGFLSALSPLQLV
Sbjct  139  ADVWPSTSAFDGFLSALSPLQLV  161



>ref|XP_007162298.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
 gb|ESW34292.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
Length=566

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL  +K KLL LS++   RV+S ++SE LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKRKLLQLSSN--QRVDSAAISEALQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLV++T+A++LH++S+PLV+A   E DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVIDTLASILHSDSEPLVAAKLDEADSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLV  161



>gb|EYU39914.1| hypothetical protein MIMGU_mgv1a003654mg [Erythranthe guttata]
Length=571

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  109  AEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            A    +HPRREPFEHGLL I KLIF DG QTL  +K  LL+  ++S HRV+S++++  LQ
Sbjct  22   ASTFQLHPRREPFEHGLLPIPKLIFNDGVQTLSGLKSTLLA--SNSNHRVSSENLAGVLQ  79

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGH  465
            I  +H+RLV+ET+++VL+++SDPLV+A+ +E VD +GVNVFDL+VFL IQSYKRLLPKGH
Sbjct  80   IPIEHSRLVIETLSSVLYDDSDPLVTASTSEEVDEIGVNVFDLLVFLCIQSYKRLLPKGH  139

Query  466  KDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            KDSAAVADVWPSTSAFDGFLS LSPLQLV
Sbjct  140  KDSAAVADVWPSTSAFDGFLSVLSPLQLV  168



>gb|KDP24597.1| hypothetical protein JCGZ_25513 [Jatropha curcas]
Length=568

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL  ++ KL+S       RV+S +++++LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDPTQTLTQLRQKLVSHP-----RVDSATLADSLQISTDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+E DPLV A P ++DSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  82   ARLVLDTLASVLHSECDPLVKAQPGDIDSVGADLHDLILFLYIQSYKRLLPRTHKDSAAV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLV  164



>ref|NP_567059.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK96632.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AAL36073.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AEE79713.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=573

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  149  ADVWPSTSAFDGYLSALSPIQLV  171



>ref|XP_010427682.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=575

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  89

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  150  ADVWPSTSAFDGYLSALSPIQLV  172



>gb|KHN07410.1| TBCC domain-containing protein 1 [Glycine soja]
Length=566

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
             DVWPSTSAFDG+LSALSPLQLV
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLV  161



>gb|KJB15037.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=536

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPS SAFDG+LSALSPLQLV
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLV  163



>ref|XP_010516427.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516428.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  68   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  125

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  126  ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  185

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  186  ADVWPSTSAFDGYLSALSPIQLV  208



>ref|XP_006290821.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 ref|XP_006290822.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23719.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23720.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
Length=573

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNYRVGSAAIADVLQISGDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDS+G ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVKAKPEEVDSLGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  147  ADVWPSTSAFDGYLSALSPIQLV  169



>ref|XP_002876443.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52702.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S  +++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAVIADVLQISGDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  147  ADVWPSTSAFDGYLSALSPIQLV  169



>gb|KHG16745.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=569

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSLALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P + DS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDFDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLV  165



>gb|KJB15036.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=567

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPS SAFDG+LSALSPLQLV
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLV  163



>gb|KJB15038.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=582

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPS SAFDG+LSALSPLQLV
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLV  163



>ref|XP_007028946.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 ref|XP_007028947.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09448.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09449.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
Length=567

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 125/159 (79%), Gaps = 10/159 (6%)
 Frame = +1

Query  97   AAGTAEPI-------YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHR  255
            +  T++PI        +HPRREPFEHGLL I KLIFTD  Q L P+K K  S    S HR
Sbjct  8    STSTSDPIPSRSPTTLLHPRREPFEHGLLPIQKLIFTDPVQALTPLKQKHAS---SSTHR  64

Query  256  VNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQ  435
            V+S ++++ LQIS DHARLVL+T+A+VLH+ESD LV+A   +VDSVG ++ DL++FLYIQ
Sbjct  65   VDSVALADALQISADHARLVLDTLASVLHSESDQLVTARSDDVDSVGADLRDLILFLYIQ  124

Query  436  SYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            SYKRLLP+ HKDSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  125  SYKRLLPRSHKDSAAVADVWPSTSAFDGYLSALSPLQLV  163



>emb|CDX79886.1| BnaA05g02700D [Brassica napus]
Length=582

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++SE L IS DH
Sbjct  23   IHPRRAPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISEALSISSDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  81   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPS SAFDG+LSALSP+Q
Sbjct  141  ADVWPSASAFDGYLSALSPIQ  161



>ref|XP_009104081.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Brassica rapa]
Length=554

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  141  ADVWPSTSAFDGYLSALSPIQLV  163



>ref|XP_009139004.1| PREDICTED: TBCC domain-containing protein 1-like [Brassica rapa]
Length=569

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+++P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKMMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  143  ADVWPSTSAFDGYLSALSPIQLV  165



>gb|KJB16388.1| hypothetical protein B456_002G228100 [Gossypium raimondii]
Length=572

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKL--LSLSADSAHRVNSKSVSETLQISP  297
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL   S S+ S HRVNS ++++ LQIS 
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSSSTHRVNSDALADALQISS  83

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            +HARL+L+T+A+VLH+E DPLV+A+P +V SVG ++ DL++FLYIQSYKRLLP+ HKDSA
Sbjct  84   EHARLILDTLASVLHSEPDPLVNAHPDDVGSVGSDLRDLILFLYIQSYKRLLPRSHKDSA  143

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  AVADVWPSTSAFDGYLSALSPLQLV  168



>ref|XP_009142814.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=569

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++S+ L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISDALSISSDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVD VG +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDLVGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPS SAFDG+LSALSP+QLV
Sbjct  143  ADVWPSASAFDGYLSALSPIQLV  165



>ref|XP_006411483.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
 gb|ESQ52936.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
Length=572

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            I+PRR PFEHGLL I KL+FTD  Q L PIK KL S++ +  +RV S ++S+ L IS DH
Sbjct  28   IYPRRVPFEHGLLPIQKLVFTDPIQNLAPIKQKLASVAKN--NRVGSAAISDALLISGDH  85

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLETLGSVLHSETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  145

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  146  ADVWPSTSAFDGYLSALSPIQLV  168



>ref|XP_006437044.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
 gb|ESR50284.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
Length=568

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKLAPTG-----RVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLV  164



>ref|XP_010672700.1| PREDICTED: TBCC domain-containing protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS-LSADSAHRVNSKSVSETLQ  288
            +PI +H RREPFE+GLL I+KLIFTDGT TLG +K+KLL   S+  + RV+  ++++ LQ
Sbjct  19   DPITLHTRREPFEYGLLPISKLIFTDGTATLGSLKEKLLQHASSSDSFRVDLSAIADILQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS +H+RLVL+T+A+VL  +SDPLV A P +V ++G NVFDL++FL IQSYKRLLP+ HK
Sbjct  79   ISQEHSRLVLDTLASVLPFDSDPLVVAKPDDVPAIGANVFDLILFLCIQSYKRLLPRTHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLV  166



>gb|KGN54813.1| hypothetical protein Csa_4G507430 [Cucumis sativus]
Length=561

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLV  166



>ref|NP_001190120.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79714.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  149  ADVWPSTSAFDGYLSALSPIQ  169



>ref|XP_004156008.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis sativus]
Length=570

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLV  166



>ref|XP_004146385.1| PREDICTED: TBCC domain-containing protein 1-like [Cucumis sativus]
Length=570

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLV  166



>gb|EPS74445.1| hypothetical protein M569_00304, partial [Genlisea aurea]
Length=572

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +H RREPFEHGLL I KLIFTDG QTL  +K  LLS S+D   RVN++ VS  LQI  +H
Sbjct  24   LHARREPFEHGLLPIPKLIFTDGVQTLSNVKSALLSASSD--ERVNTEIVSAVLQIPIEH  81

Query  304  ARLVLETVAAVLHNESDPLVSAN-PAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            + +++ET++AVLH+ESDPL  A  P E+  +G NVFDL+V LYIQSYKRL+PKGHKDSAA
Sbjct  82   SCILMETLSAVLHDESDPLGRAKTPEEIGGIGANVFDLLVLLYIQSYKRLVPKGHKDSAA  141

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDGFLSALSPLQLV
Sbjct  142  VADVWPSTSAFDGFLSALSPLQLV  165



>ref|XP_009116487.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=570

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGAIADALQISGDH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EV+SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPLVGAKPEEVESVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  144  ADVWPSTSAFDGYLSALSPIQLV  166



>emb|CDX98257.1| BnaC06g16180D [Brassica napus]
Length=590

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKHKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  141  ADVWPSTSAFDGYLSALSPIQ  161



>ref|XP_006485027.1| PREDICTED: TBCC domain-containing protein 1-like [Citrus sinensis]
Length=568

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKLKLAPTG-----RVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLV  164



>ref|XP_011078850.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=573

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  121  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  300
            +++PRREPF+HGLL I KLIFTDGTQTL  +K  LLS S++   RVNS +++  LQI   
Sbjct  27   HLYPRREPFDHGLLPIPKLIFTDGTQTLSHLKSMLLSSSSN--QRVNSDTLARVLQIPIG  84

Query  301  HARLVLETVAAVLHNESDPLVSAN-PAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            HARL++ET+++VLH++SDPLV A  P E+D +GVNVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  85   HARLLIETISSVLHDDSDPLVKACVPDEIDEIGVNVFDLLVFLYIQSYKRLLPKGHKDSA  144

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDGFLSALSPLQLV
Sbjct  145  AVADVWPSTSAFDGFLSALSPLQLV  169



>gb|KJB36105.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=555

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  138  ADVWPSTSAFDGYLSALSPLQLV  160



>emb|CDX67713.1| BnaA07g17530D [Brassica napus]
Length=598

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  141  ADVWPSTSAFDGYLSALSPIQ  161



>emb|CDY53502.1| BnaC04g02540D [Brassica napus]
Length=599

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+F D  QTL PIK KL S + +  +RV S +VSE L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFADPIQTLAPIKQKLASSATN--NRVGSPAVSEALSISSDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKKLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPS SAFDG+LSALSP+Q
Sbjct  143  ADVWPSASAFDGYLSALSPIQ  163



>emb|CDY61748.1| BnaA04g27540D [Brassica napus]
Length=595

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLTPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  143  ADVWPSTSAFDGYLSALSPIQ  163



>gb|KJB36106.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=606

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  138  ADVWPSTSAFDGYLSALSPLQLV  160



>ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30037.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S +     R+++  ++E+LQIS DH
Sbjct  30   IHPRREPFEHGLLPIPKLIFPDPTQALSQLKQKLASHNG----RIDTAILAESLQISTDH  85

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH+++DPLV A P ++D VG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLDTLASILHSDADPLVKAQPGDIDLVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  145

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  146  ADVWPSTSAFDGYLSALSPLQLV  168



>ref|XP_004497930.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=561

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPF+HGLL I KLIF+D TQ+L  +K KLL  S++  HRV+S ++S++LQIS DH
Sbjct  16   IHPRREPFDHGLLPIQKLIFSDPTQSLTALKKKLLDSSSN--HRVDSAAISDSLQISTDH  73

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+L+L+T+A+V H++S+PLV   P + D+VG +V DLV+ LYIQSYKRLLP+ HKDSA+V
Sbjct  74   AKLLLDTLASVHHSDSEPLVRNEPGQNDAVGADVHDLVLLLYIQSYKRLLPRSHKDSASV  133

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+ SALSPLQL+
Sbjct  134  ADVWPSTSAFDGYFSALSPLQLM  156



>gb|KHG18606.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=582

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L  +K KL+S    S  RV+S ++++ L+IS DH
Sbjct  21   LHPRREPFEHGLLPIQKLIFTDPLQALTSLKQKLVS---SSTQRVDSAALADALEISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHAESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRSHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAF+G+LSALSPLQLV
Sbjct  138  ADVWPSTSAFEGYLSALSPLQLV  160



>ref|XP_006381055.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|ERP58852.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=585

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++E+LQIS DH
Sbjct  37   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLAESLQISTDH  91

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  92   ARLILDTLASVLHSDSDPLVKARPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  151

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  152  ADVWPSTSAFDGYLSALSPLQLV  174



>ref|XP_002323291.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|EEF05052.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=571

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S      +RVNS  ++++LQI  DH
Sbjct  29   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKLAS-----HNRVNSSLLADSLQIPADH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VL++ESDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+AAV
Sbjct  84   ARLILDTLASVLNSESDPLVKAPPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLV  166



>ref|XP_010943570.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=579

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
             AG   P+ + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  21   GAGAGAPLLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSTRPGRVDAPALA  80

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQISPDHARLVL+T+A+VL   SDP   A  A+       V+DLV+FLYIQ+YKRLLP
Sbjct  81   EALQISPDHARLVLDTLASVL--PSDPPDPAGTAD-------VYDLVLFLYIQTYKRLLP  131

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            K HKDS  VADVWPSTSAFDGF SALSP+QLV
Sbjct  132  KAHKDSVTVADVWPSTSAFDGFFSALSPIQLV  163



>emb|CDY47657.1| BnaC04g23940D [Brassica napus]
Length=648

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPR   FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRLVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSAAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  143  ADVWPSTSAFDGYLSALSPIQ  163



>ref|XP_010517737.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=572

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 3/144 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S +VS+ L IS D+
Sbjct  30   IHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAVSDALLISGDN  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            ARLVLET+ +VLH E+DPLV A  +E VDSVGV++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  88   ARLVLETLGSVLHCENDPLVLAKKSEEVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAA  147

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSP+QLV
Sbjct  148  VADVWPSTSAFDGYLSALSPIQLV  171



>ref|XP_008800652.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=577

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            AAG   P  + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  19   AAGAGAPFLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCPGRVDAPALA  78

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQISPD ARLVL+T+A+VL   SDP   A  A+       V+DLV+FLYIQ+YKRLLP
Sbjct  79   EALQISPDRARLVLDTLASVL--PSDPPDPAGTAD-------VYDLVLFLYIQTYKRLLP  129

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            K HKDSA VADVWPSTSAFDGF SALSP+QLV
Sbjct  130  KAHKDSANVADVWPSTSAFDGFFSALSPIQLV  161



>ref|XP_006293916.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
 gb|EOA26814.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
Length=570

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +1

Query  103  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSET  282
              + PI IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++S+ 
Sbjct  24   ANSNPI-IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDA  80

Query  283  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  462
            L IS D ARLVLET+ +VLH E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+L P+ 
Sbjct  81   LLISGDQARLVLETLGSVLHCETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLQPRT  140

Query  463  HKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            HKD+A+VADVWPSTSAFDG+LSALSP+QLV
Sbjct  141  HKDAASVADVWPSTSAFDGYLSALSPIQLV  170



>ref|XP_010508603.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=565

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++++ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSTAIADALLISGDN  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH E+DPLV A   EVDSVGV++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQ--EVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAAV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSP+QLV
Sbjct  142  ADVWPSTSAFDGYLSALSPIQLV  164



>ref|XP_011020269.1| PREDICTED: TBCC domain-containing protein 1 isoform X3 [Populus 
euphratica]
Length=577

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLV  170



>ref|XP_011020268.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=579

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLV  170



>ref|XP_011020267.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=581

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLV  170



>ref|XP_011033250.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=569

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 7/144 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  300
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  301  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  VADVWPSTSAFDGYLSALSPLQLV  164



>ref|XP_011033249.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=575

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 7/144 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  300
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  301  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSPLQLV
Sbjct  141  VADVWPSTSAFDGYLSALSPLQLV  164



>ref|XP_010506033.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=568

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGL+ I KL+FTD  Q L PIK KL + + +  +RV S ++S+ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQALAPIKQKLAASATN--NRVGSAAISDALLISVDN  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            ARLVLET+ +VLH E+DPLV A  +E VDSVG ++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQKSEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAA  143

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSP+QLV
Sbjct  144  VADVWPSTSAFDGYLSALSPIQLV  167



>emb|CAB67617.1| putative protein [Arabidopsis thaliana]
Length=570

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSA  531
            ADVWPSTSAFDG+ ++
Sbjct  149  ADVWPSTSAFDGYFNS  164



>ref|XP_008442093.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis melo]
Length=570

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+  + R+NS ++SE+LQIS DH
Sbjct  25   IHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSS-PSSRLNSSAISESLQISIDH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++SDPLV+A P +VDS+GV+V DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLVLDTLASVLHSDSDPLVNAAPHDVDSIGVDVLDLLLFLYIQSYKRLLPRSHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLV  166



>ref|XP_002881827.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58086.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S ++S+ L IS 
Sbjct  22   LVIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDALSISN  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+ +VLH E+DPLV A P EVDSVG ++ DL++FL+IQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLGSVLHCETDPLVLAKPEEVDSVGADLRDLLLFLFIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            +VADVWPSTSAFDG+LSALSP+QLV
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLV  164



>gb|KHN26370.1| TBCC domain-containing protein 1 [Glycine soja]
Length=553

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 14/143 (10%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL            S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARL------------SEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  126

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
             DVWPSTSAFDG+LSALSPLQLV
Sbjct  127  TDVWPSTSAFDGYLSALSPLQLV  149



>ref|XP_010928451.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 118/147 (80%), Gaps = 11/147 (7%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  295  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            PD ARLVL+T+A+VL +++ DP  +A          +V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTA----------DVYDLVLFLYIQSYKRLLPKAHKD  147

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            SAAVADVWPSTSAFDG+ SALSP+QLV
Sbjct  148  SAAVADVWPSTSAFDGYFSALSPIQLV  174



>ref|XP_011075175.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=570

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 123/145 (85%), Gaps = 3/145 (2%)
 Frame = +1

Query  121  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  300
            ++HPRREPFEHGLL I KLIFTDGTQTL     K   LS+ S +RV+S+++S  LQI  +
Sbjct  24   HLHPRREPFEHGLLPIPKLIFTDGTQTL--SLLKSTLLSSSSNYRVSSETLSRVLQIPIE  81

Query  301  HARLVLETVAAVLHNESDPLVSANPA-EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            H+R+++ET+++VLH++SDPLV A  + E++ +G NVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  82   HSRILIETLSSVLHDDSDPLVKARTSKEIEEIGANVFDLLVFLYIQSYKRLLPKGHKDSA  141

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDGFLSALSPLQLV
Sbjct  142  AVADVWPSTSAFDGFLSALSPLQLV  166



>ref|XP_010928450.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Elaeis 
guineensis]
Length=592

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 118/147 (80%), Gaps = 11/147 (7%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  295  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            PD ARLVL+T+A+VL +++ DP  +A          +V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTA----------DVYDLVLFLYIQSYKRLLPKAHKD  147

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            SAAVADVWPSTSAFDG+ SALSP+QLV
Sbjct  148  SAAVADVWPSTSAFDGYFSALSPIQLV  174



>gb|KHN26369.1| TBCC domain-containing protein 1 [Glycine soja]
Length=551

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 17/143 (12%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+                 E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLLD---------------EIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  123

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
             DVWPSTSAFDG+LSALSPLQLV
Sbjct  124  TDVWPSTSAFDGYLSALSPLQLV  146



>ref|XP_006850073.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
 gb|ERN11654.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
Length=589

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 119/163 (73%), Gaps = 14/163 (9%)
 Frame = +1

Query  106  TAEPIY-IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS--------AHRV  258
            TA P + +H RREPFE+GLL I+KLIFTDGT TL P++DK   LS +         + R+
Sbjct  14   TAPPTFSLHIRREPFEYGLLPISKLIFTDGTSTLAPLRDKFFQLSFNKDSFSLSSSSLRI  73

Query  259  NSKSVSETLQISPDHARLVLETVAAVLHNE-----SDPLVSANPAEVDSVGVNVFDLVVF  423
            ++  +S+ L+IS ++A LVL+T+A VL +      SDPLV A P E+D +G NV DL++F
Sbjct  74   DASGISQALEISIENAHLVLDTLATVLPDYGDVGLSDPLVYAKPDEIDKIGANVCDLILF  133

Query  424  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            LYIQSYK+LLP+ HKDSA++ADVWPSTS FDG+L ALSPLQ V
Sbjct  134  LYIQSYKKLLPRPHKDSASIADVWPSTSVFDGYLCALSPLQFV  176



>emb|CDY06067.1| BnaA09g37130D [Brassica napus]
Length=513

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 107/141 (76%), Gaps = 11/141 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S  ++E LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGVIAEALQISGDH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  134

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  135  ADVWPSTSAFDGYLSALSPIQ  155



>ref|XP_009391882.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 110/145 (76%), Gaps = 10/145 (7%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + + PRREPFEHGLL I KLIF+DGTQTL  + DKLL  S  S HRV+  ++++  QIS 
Sbjct  34   LLLRPRREPFEHGLLPIPKLIFSDGTQTLAALADKLLHRSISSPHRVDVPALADAFQISL  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL L+T+A+VL  E DP         D V  NV D+V+FLY+QSYKRL+P+ HKDSA
Sbjct  94   DHARLALDTLASVLPFEPDP---------DGVA-NVHDIVLFLYVQSYKRLVPRPHKDSA  143

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            A+ADVWPSTSAFDG+LSALSPLQLV
Sbjct  144  AIADVWPSTSAFDGYLSALSPLQLV  168



>emb|CDX71986.1| BnaC08g28880D [Brassica napus]
Length=565

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 109/143 (76%), Gaps = 15/143 (10%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSA--HRVNSKSVSETLQISP  297
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    AD+A  +RV S  ++E LQIS 
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKRKL----ADAATNNRVGSGVIAEVLQISG  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  82   DHARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSA  132

Query  478  AVADVWPSTSAFDGFLSALSPLQ  546
            AVADVWPSTSAFDG+LSALSP+Q
Sbjct  133  AVADVWPSTSAFDGYLSALSPIQ  155



>ref|XP_008787292.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=574

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 12/144 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            + PRRE FEHGLL I+KLIF+DGT TL  IK+KLL  S  S +RV++ ++++TLQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASIKNKLLQRSIPSPNRVDAPTIADTLQISPDI  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            A LVL+T+AAVL           P++  S G  +V DLV+FLYIQSYKRL+P+ HKDSAA
Sbjct  91   AFLVLDTLAAVL-----------PSDSGSAGTADVHDLVLFLYIQSYKRLVPRAHKDSAA  139

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSPLQLV
Sbjct  140  VADVWPSTSAFDGYLSALSPLQLV  163



>ref|XP_008795746.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1 [Phoenix dactylifera]
Length=577

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 9/146 (6%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLG ++DKLL LS+     V++ +++E LQIS
Sbjct  22   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGTLRDKLLGLSSPCPGSVDALALAEALQIS  81

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             D ARLVL+T+A+VL     P  + +PA       +V+DLV+FLYIQSYKRLLPK H+DS
Sbjct  82   ADLARLVLDTLASVL-----PSGTQDPAGT----ADVYDLVLFLYIQSYKRLLPKAHRDS  132

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
            AAVADVWPSTSAFDG+ SAL P+QLV
Sbjct  133  AAVADVWPSTSAFDGYFSALLPIQLV  158



>ref|XP_009411800.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 10/152 (7%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            AAG +  + + PRREPFEHGLL I KLIF+DGT TL  + DKLL  S  S HRV++ S++
Sbjct  26   AAGGSLQLLLRPRREPFEHGLLPIPKLIFSDGTLTLAALADKLLRRSIPSPHRVDATSLA  85

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            + LQIS D+ARL L+T+A+VL +E DP  +A          +V  LV+FL IQSYKRL+P
Sbjct  86   DALQISLDYARLALDTLASVLPSEPDPDGTA----------DVHVLVLFLCIQSYKRLVP  135

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            + HKDSAA+ADVWPSTSAFDG+LSALSP+QLV
Sbjct  136  RPHKDSAAIADVWPSTSAFDGYLSALSPIQLV  167



>ref|XP_004493562.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=555

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 13/143 (9%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL  +K KL+  S++  +RV+S ++S++LQIS + 
Sbjct  22   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKHKLIESSSN--NRVDSVAISDSLQISVEQ  79

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A+VL           P E DS  V+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  80   AKLVLDTLASVL-----------PHESDSDTVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  128

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  129  ADVWPSTSAFDGYLSALSPLQLV  151



>ref|XP_010913921.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=577

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 12/144 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            + PRRE FEHGLL I+KLIF+DGT TL  +K+KLL  S  S+ RV++ ++++ LQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASLKNKLLQRSIPSSDRVDALTIADALQISPDI  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            A LVL T+AAVL           P++  S G  +V DLV+FLYIQSYKRLLP+ HKDSAA
Sbjct  91   ALLVLGTLAAVL-----------PSDPGSAGTADVHDLVLFLYIQSYKRLLPRAHKDSAA  139

Query  481  VADVWPSTSAFDGFLSALSPLQLV  552
            VADVWPSTSAFDG+LSALSPLQLV
Sbjct  140  VADVWPSTSAFDGYLSALSPLQLV  163



>gb|ABR16182.1| unknown [Picea sitchensis]
Length=609

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 119/178 (67%), Gaps = 32/178 (18%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS---------------------  231
            P+++H RREPFE+GLL +  L+FTDGT TL  +++KLL                      
Sbjct  7    PLFLHLRREPFEYGLLPLPHLMFTDGTSTLKSVREKLLQNSFTYTVNNNNHNSNNDDNNN  66

Query  232  -----LSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL------HNESDPLVSANPA  378
                 +S   + RVN+  ++E+LQ+S DHAR+V++T+AAVL         +DPLV A+  
Sbjct  67   DNNGEVSRSFSRRVNATGIAESLQLSEDHARVVIDTLAAVLPEYGRGGGAADPLVHASYV  126

Query  379  EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            +VDS+G +V+DL++FL IQ+YK+L+P+ HKD+A+VADVWPSTSAFDG  + LSPLQL+
Sbjct  127  DVDSIGADVYDLILFLLIQTYKKLVPRPHKDAASVADVWPSTSAFDGIFATLSPLQLM  184



>gb|KEH41654.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=553

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 115/146 (79%), Gaps = 9/146 (6%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P  IHPRREPFEHGL+ I KLIF+D TQ+L  +K  LL+ S+++   ++S  +S++LQIS
Sbjct  13   PTMIHPRREPFEHGLIPIPKLIFSDPTQSLLTLKQTLLASSSNNL--ISSAIISDSLQIS  70

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             +HA+L+L+T+++V+H+E+D  V  + AE D     V+DL++ LYIQSYK+LLP+ +KD 
Sbjct  71   TEHAQLLLDTLSSVVHHEND--VVFDGAECD-----VYDLILLLYIQSYKKLLPRSNKDP  123

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
            A+VADVWPSTSAFDG+ SALSPLQL+
Sbjct  124  ASVADVWPSTSAFDGYFSALSPLQLM  149



>ref|XP_003625224.1| TBCC domain-containing protein [Medicago truncatula]
 gb|ABN08645.1| Tubulin binding cofactor C [Medicago truncatula]
 gb|AES81442.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=558

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 109/143 (76%), Gaps = 11/143 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF+D  QTL   K KLL  S++  +RV S ++SE+LQIS + 
Sbjct  23   IHPRREPFEHGLLPIPKLIFSDPAQTLISFKHKLLESSSN--NRVGSVAISESLQISVEQ  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A+VL     P  S + ++   V     DLV+FLY+QSYKRLLP+ HKDSAAV
Sbjct  81   AKLVLDTLASVL-----PSESDSESDSVDVN----DLVLFLYVQSYKRLLPRTHKDSAAV  131

Query  484  ADVWPSTSAFDGFLSALSPLQLV  552
            ADVWPSTSAFDG+LSALSPLQLV
Sbjct  132  ADVWPSTSAFDGYLSALSPLQLV  154



>ref|XP_010038901.1| PREDICTED: TBCC domain-containing protein 1 [Eucalyptus grandis]
Length=523

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +1

Query  202  LGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAE  381
            L P+K KL      +  R   + ++E+LQISPDHARLVL+T+ +VLH++SDPLV A P E
Sbjct  6    LLPLKQKLWGSPVTTRRR---RRLAESLQISPDHARLVLDTLVSVLHSDSDPLVRAKPDE  62

Query  382  VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQL  549
            VDS+G +V DLV+FLYIQSYK+LLP+ HKDS AVADVWPSTSAFDG+LSALSPLQL
Sbjct  63   VDSLGADVNDLVLFLYIQSYKKLLPRSHKDSVAVADVWPSTSAFDGYLSALSPLQL  118



>ref|XP_003563624.1| PREDICTED: TBCC domain-containing protein 1-like [Brachypodium 
distachyon]
Length=583

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 11/146 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KL+F +GT  QTL  +K +LL      + RV + +++E LQI  
Sbjct  36   LRPRRESFEHGLLPIPKLVFPEGTLTQTLAQLKGRLLE---SGSGRVGAPALAEALQIPV  92

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPKGHKDS  474
            + A LVL T+AAVL  + DP +      VD  G  ++ D+++FLYIQSYKRL+P+ HKDS
Sbjct  93   EQAALVLGTLAAVLPTDEDPALG-----VDGAGEADLRDVLLFLYIQSYKRLVPRAHKDS  147

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
             +VADVWPSTSAFDG+LSALSP+QLV
Sbjct  148  PSVADVWPSTSAFDGYLSALSPIQLV  173



>ref|XP_002986516.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
 gb|EFJ12373.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
Length=570

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 7/153 (5%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL        RV   ++ 
Sbjct  13   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLD-----NRRVGVAAIV  67

Query  277  ETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRL  450
            E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D+VG +V DL++FLYIQ Y+R+
Sbjct  68   ECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEIDTVGAHVDDLLLFLYIQIYRRV  127

Query  451  LPKGHKDSAAVADVWPSTSAFDGFLSALSPLQL  549
             P+ HKD AAVADVWPSTS FDGF S LSPLQ+
Sbjct  128  PPRSHKDPAAVADVWPSTSPFDGFFSTLSPLQV  160



>ref|XP_002964936.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
 gb|EFJ33774.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
Length=599

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 108/174 (62%), Gaps = 23/174 (13%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL----------------  228
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL                
Sbjct  16   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLDKSIPQTSWQSGGGNA  75

Query  229  -----SLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVD  387
                 +++   + RV   ++ E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D
Sbjct  76   SEDSSAMAQQPSRRVGVAAIVECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEID  135

Query  388  SVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQL  549
            +VG +V DL++FLYIQ Y+R+ P+ HKD AAVADVWPSTS FDGF S LSPLQ+
Sbjct  136  TVGAHVDDLLLFLYIQIYRRVPPRSHKDPAAVADVWPSTSPFDGFFSTLSPLQV  189



>gb|EEC80975.1| hypothetical protein OsI_23703 [Oryza sativa Indica Group]
Length=568

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 18/152 (12%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  276
            + + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++
Sbjct  31   LLLRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALA  90

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            + HKDS AV DVWPSTSAFDG+LSALSP+QLV
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSALSPIQLV  171



>ref|NP_001058077.1| Os06g0614300 [Oryza sativa Japonica Group]
 dbj|BAD35569.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAD35914.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAF19991.1| Os06g0614300 [Oryza sativa Japonica Group]
Length=581

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 104/150 (69%), Gaps = 18/150 (12%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVSET  282
            + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++E 
Sbjct  33   LRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALAEA  92

Query  283  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  462
            LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P+ 
Sbjct  93   LQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVPRA  141

Query  463  HKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            HKDS AV DVWPSTSAFDG+LSALSP+QLV
Sbjct  142  HKDSPAVTDVWPSTSAFDGYLSALSPIQLV  171



>dbj|BAJ93674.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 8/141 (6%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPDHAR  309
            E FEHGLL I KLIF +GT  QTL  +K+KL+  +A +   RV + +++E LQI PD A 
Sbjct  28   EAFEHGLLPIPKLIFPEGTLAQTLSQLKEKLVPAAAAAGDGRVGAAALAEALQIPPDQAA  87

Query  310  LVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVAD  489
            L +  +AAVL  + DP + A          ++ D+++FLYIQSYKRL+P+ HKDS AVAD
Sbjct  88   LAIGMLAAVLPGD-DPALDAGGGG----SADLRDVLLFLYIQSYKRLVPRPHKDSPAVAD  142

Query  490  VWPSTSAFDGFLSALSPLQLV  552
            VWPSTSAFDG+LS LSP+QLV
Sbjct  143  VWPSTSAFDGYLSVLSPIQLV  163



>ref|XP_003571239.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=568

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 9/145 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPIQLV  161



>ref|XP_010233970.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=560

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 9/145 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  137  AVADVWPSTSAFDGYLSALSPIQLV  161



>gb|AFW66196.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=499

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 97/148 (66%), Gaps = 8/148 (5%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPAL--GDGAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DS  VADVWPSTSAFDG+LSALSP+QLV
Sbjct  146  DSPVVADVWPSTSAFDGYLSALSPIQLV  173



>gb|ACN28202.1| unknown [Zea mays]
 gb|AFW66195.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=579

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 97/148 (66%), Gaps = 8/148 (5%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPALGD--GAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLV  552
            DS  VADVWPSTSAFDG+LSALSP+QLV
Sbjct  146  DSPVVADVWPSTSAFDGYLSALSPIQLV  173



>ref|XP_002453473.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
 gb|EES06449.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
Length=582

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 7/146 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + SA    RV + +++E LQI P
Sbjct  36   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-SAAPDGRVPAAALAEALQI-P  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  94   QEQAALALATLAAVLPAEDPAL--GDGAVDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  151

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
             AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  152  PAVADVWPSTSAFDGYLSALSPIQLV  177



>dbj|BAJ90629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 10/147 (7%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KL+F +GT  QTL  +K KL   +A    RV + +++E LQI
Sbjct  40   LVLRPRRESFEHGLLPIPKLVFPEGTLTQTLTQLKAKL---AAPGHGRVGAAALAEALQI  96

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
              D A L L T+AAVL  E D      PA   +   ++ D+++FLYIQSYKRL+P+ HKD
Sbjct  97   PADQAALALGTLAAVLPGEGD-----GPAADGAWEADLRDVLLFLYIQSYKRLVPRAHKD  151

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            S +VADVWPSTSAFDG+LSALSP+QLV
Sbjct  152  SPSVADVWPSTSAFDGYLSALSPIQLV  178



>gb|EEE66013.1| hypothetical protein OsJ_21970 [Oryza sativa Japonica Group]
Length=581

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 18/152 (12%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  276
            + + PR    EHGLL I K +  +GT  QTL   K++L++ +     + +A RV + +++
Sbjct  31   LLLGPRGVALEHGLLAIPKRVSPEGTLTQTLAQTKERLIAAAGGDGDSSAAPRVGAAALA  90

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            + HKDS AV DVWPSTSAFDG+LSALSP+QLV
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSALSPIQLV  171



>ref|XP_008643390.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=566

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 8/146 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVL--GDGAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
             AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLV  175



>ref|NP_001144767.1| hypothetical protein [Zea mays]
 gb|ACG42825.1| hypothetical protein [Zea mays]
 gb|AFW70774.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=569

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 8/146 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVL--GDGAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
             AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLV  175



>ref|XP_008643389.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN30975.1| unknown [Zea mays]
 gb|AFW70773.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=581

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 8/146 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLV  552
             AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLV  175



>ref|XP_004965884.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=583

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KL+  +G  +QTL  +K++L    A    RV + +++E LQI  
Sbjct  38   LRPRREAFEHGLLPIPKLVIPEGALSQTLAQMKERL----APGGARVGAAALAEALQIPA  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAV+  E   L      E D     + DL++FLYIQSYKRL+P+GHKDS 
Sbjct  94   EQAALALGTLAAVIPAEDPALGEDGAGEAD-----LRDLLLFLYIQSYKRLVPRGHKDSP  148

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AVADVWPSTSAFDG LSALSP+Q +
Sbjct  149  AVADVWPSTSAFDGCLSALSPIQFI  173



>ref|XP_001757659.1| predicted protein [Physcomitrella patens]
 gb|EDQ77716.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 107/171 (63%), Gaps = 23/171 (13%)
 Frame = +1

Query  103  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL-----------SLSADSA  249
            G  EP ++H RRE FE+G+L +  L+ +D    L  ++ KLL           S++A+++
Sbjct  11   GAREPPWLHVRREAFEYGMLPLPSLLHSDVVTGLRNLRVKLLQQAPSISTWPLSITANAS  70

Query  250  H---------RVNSKSVSETLQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSV  393
            H         RV ++ ++  L+++  HA LVL+T+A+VL+ E    DPL      E+DSV
Sbjct  71   HSTPASGGRERVGTEGIAAALEVAEAHAHLVLDTLASVLNEEGAGVDPLAITPVTEIDSV  130

Query  394  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQ  546
            G ++ +L++FLYIQ+Y+R+  + H+ +A VADVWPSTSA DGFL ALS +Q
Sbjct  131  GADIDELLIFLYIQTYRRVPSRPHRGAADVADVWPSTSAIDGFLPALSSMQ  181



>ref|XP_004951581.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=578

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 12/147 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + +     RV + +++E LQI  
Sbjct  34   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-AVPGGGRVGAAALAEALQIPQ  92

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPK-GHKD  471
            + A L L T+AAVL  E       +PA  D  G  ++ D+++FLY+QSYKRL+P+  HKD
Sbjct  93   EQAALALGTLAAVLPAE-------DPALGDGAGDADIHDVLLFLYVQSYKRLVPRSAHKD  145

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLV  552
            S AVADVWPSTSAFDG+LSALSP+QLV
Sbjct  146  SPAVADVWPSTSAFDGYLSALSPIQLV  172



>ref|XP_001778693.1| predicted protein [Physcomitrella patens]
 gb|EDQ56486.1| predicted protein, partial [Physcomitrella patens]
Length=584

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 109/162 (67%), Gaps = 16/162 (10%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH---------  252
            A   EP  +H RRE FE+G+L +  L+ +D      PI    LS+++++++         
Sbjct  11   ACNTEPC-LHVRREAFEYGILPLPNLLHSDEAP---PISTWALSINSNASYTVPASGDRK  66

Query  253  RVNSKSVSETLQISPDHARLVLETVAAVLHN--ESDPLVSANP-AEVDSVGVNVFDLVVF  423
            RV ++ ++  L+++  HA LVL+T+A+VL++  E+  L++  P  E+DSVG +V DL++F
Sbjct  67   RVGTEGIAAALEVTEAHAHLVLDTLASVLNDGGEAVDLLATTPVTEIDSVGADVDDLLIF  126

Query  424  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQL  549
            LYIQ+Y+R+  + H+D+A VADVWPSTSA DGFL ALSPLQ+
Sbjct  127  LYIQTYRRVPSRPHRDAADVADVWPSTSAIDGFLPALSPLQV  168



>gb|AFW76295.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=508

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AV DVWPSTSAFDG+LSALSP+Q V
Sbjct  140  AVTDVWPSTSAFDGYLSALSPIQFV  164



>ref|NP_001168301.1| hypothetical protein [Zea mays]
 gb|ACN27744.1| unknown [Zea mays]
 gb|ACN28930.1| unknown [Zea mays]
 gb|AFW76296.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=574

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLV  552
            AV DVWPSTSAFDG+LSALSP+Q V
Sbjct  140  AVTDVWPSTSAFDGYLSALSPIQFV  164



>gb|EEC72669.1| hypothetical protein OsI_06222 [Oryza sativa Indica Group]
Length=579

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 92/140 (66%), Gaps = 8/140 (6%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  312
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI P     
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQI-PHEQAA  96

Query  313  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  492
            +     A +    DP + +        G ++ D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  97   LALATLAAVLPADDPALDSGGGG----GADLRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  493  WPSTSAFDGFLSALSPLQLV  552
            WPSTSAFDG+LSALSP+QLV
Sbjct  153  WPSTSAFDGYLSALSPIQLV  172



>gb|AAB88648.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSV  393
            DHARLVLET+++VLH E+DPLV A P EVDS+
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSL  111



>ref|NP_001046181.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAD25242.1| tubulin-specific chaperone C-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08095.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAH00408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  312
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI  + A L
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQIPHEQAAL  97

Query  313  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  492
             L T+AAVL  +   L S      D     + D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  98   ALATLAAVLPADDPALDSGGGGRAD-----LRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  493  WPSTSAFDGFLSALSPLQLV  552
            WPSTSAFDG+LSALSP+QLV
Sbjct  153  WPSTSAFDGYLSALSPIQLV  172



>gb|AFN53653.1| putative G-patch domain protein [Linum usitatissimum]
Length=565

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIFTD TQTLG ++ KL      S  RV++ ++++ LQIS DH
Sbjct  32   IHPRREPFEHGLLPIPKLIFTDPTQTLGQLRQKL-----SSQPRVDATALADALQISTDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSV-GVNVFDLVVFL  426
            ARLVL+T+A+VLH+ESDPLV A   E+DSV  +  F+ + FL
Sbjct  87   ARLVLDTLASVLHSESDPLVKAGSGEIDSVLTMEGFEHLGFL  128



>ref|XP_008657282.1| PREDICTED: spidroin-1-like [Zea mays]
Length=273

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQ--ITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + PRRE F+HGL +  I KLIF +G   QTL  +K+KL +   D   RV + +++E  QI
Sbjct  134  LRPRREAFKHGLKEKLIPKLIFPEGMLAQTLAQLKEKLSASVPDG--RVRAAALAEAQQI  191

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP++      +D    ++ D+++FLYIQSYKRL+ +  HK
Sbjct  192  -PQEQAALALGTLAAVLPAEDPVLGDG--AIDGAAADIRDVLLFLYIQSYKRLVQRSAHK  248

Query  469  DSAAVADVWPSTSAFDGFLSALS  537
            DS AVADVWPSTSAFDG+LSALS
Sbjct  249  DSPAVADVWPSTSAFDGYLSALS  271



>emb|CBI30042.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +1

Query  376  AEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            +E+D+VG +V+DL++FLYIQSYKRLLP+ HKDSAAVADVWPSTSAFDG+LSALSPLQLV
Sbjct  4    SEIDAVGADVYDLILFLYIQSYKRLLPRTHKDSAAVADVWPSTSAFDGYLSALSPLQLV  62



>ref|XP_001758135.1| predicted protein [Physcomitrella patens]
 gb|EDQ76957.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 103/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  106  TAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS-AHRVNSKSVSET  282
            T EP ++H RREPFE+G L I  L+ +D   +L  ++ KLLS +  S   RV+   ++  
Sbjct  14   TREPPWLHVRREPFEYGTLPIPSLMHSDVLASLMTLRGKLLSQAPPSLTSRVSITGIAAA  73

Query  283  LQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            L+++ ++A+L+LET+A+ L++E    D L S+   E++SVG ++ DL+++LY+Q+Y+R  
Sbjct  74   LELTEEYAQLILETLASTLNDEGTIVDRLASSLVNEIESVGADIDDLLLYLYLQTYRRAP  133

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQ  546
             + H+D+++VADVWP TSA DG L A + L+
Sbjct  134  SRPHRDASSVADVWPCTSAIDGILPASTLLK  164



>gb|EMS61357.1| hypothetical protein TRIUR3_14905 [Triticum urartu]
Length=71

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  394  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQ  546
            G ++ D+++FLYIQSYKRL+P+ HKDS  VADVWPSTSAFDG+LSALSP+Q
Sbjct  4    GADLRDVLLFLYIQSYKRLVPRPHKDSPVVADVWPSTSAFDGYLSALSPIQ  54



>ref|XP_006648417.1| PREDICTED: TBCC domain-containing protein 1-like [Oryza brachyantha]
Length=484

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  400  NVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLV  552
            ++ D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG+LSALSP+QLV
Sbjct  27   DIRDVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSALSPIQLV  77



>ref|XP_006657134.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Oryza 
brachyantha]
Length=481

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +1

Query  358  LVSANPAEVDSVG------VNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDG  519
            L +  PAE  ++G       ++ D+++FLYIQSYKRL+P+ HKDS AVADVWPSTSAFDG
Sbjct  1    LAAVLPAEDPALGEDGTGDADLRDVLLFLYIQSYKRLVPRAHKDSPAVADVWPSTSAFDG  60

Query  520  FLSALSPLQLV  552
            +LSALSP++LV
Sbjct  61   YLSALSPIKLV  71



>gb|EEE56495.1| hypothetical protein OsJ_05741 [Oryza sativa Japonica Group]
Length=544

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +1

Query  370  NPAEVDSVG---VNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSP  540
            +PA +DS G    ++ D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG+LSALSP
Sbjct  75   DPA-LDSGGGGRADLRDVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSALSP  133

Query  541  LQLV  552
            +QLV
Sbjct  134  IQLV  137



>ref|XP_001765734.1| predicted protein [Physcomitrella patens]
 gb|EDQ69325.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA--DSAHRVNSKSVSETL  285
            +P ++H RRE FE+G+L +  L+ +D    L   + KLL  +    +  RV +  ++  L
Sbjct  16   DPPWLHVRREVFEYGILPLPSLVHSDVVTGLRNFRVKLLQQAPPISTWKRVATAGIATAL  75

Query  286  QISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRL  450
            +++  HA+L+L+T+A+VL+ E    D L  A   E+DSVGV+V DL++FLYIQ+Y+R+
Sbjct  76   EVTEAHAQLMLDTLASVLNEEGGVVDSLAIAPATEIDSVGVDVDDLLIFLYIQTYRRV  133



>ref|XP_008656241.1| PREDICTED: uncharacterized protein LOC103635607 [Zea mays]
Length=168

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + P+RE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + ++++  QI P
Sbjct  33   LRPQREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAKAQQI-P  89

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+
Sbjct  90   QEQAALALGTLAAMLPAEDPVLGDG--AMDGAAADIRDVLLFLYIQSYKRLV  139



>ref|XP_002505027.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66285.1| predicted protein [Micromonas sp. RCC299]
Length=634

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = +1

Query  133  RREPFEHGLLQITKLI-FTDGTQTLGPIKDKLLSLSADSAHR-----VNSKSVSETLQIS  294
            RREPF+ G+L  + L+   +    L PI+ +LL  +  S H      V+    ++ + I+
Sbjct  13   RREPFDFGILPASFLLPRAESVAALVPIQRRLLQCAHPSRHDPTKLVVSVADAAQCMGIA  72

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSV----GVNVFDLVVFLYIQSYKR  447
            P HA  V++T+ AV   E  P    +PAE D +     V V  L+ FL++Q++ R
Sbjct  73   PQHAEHVIDTMHAVAPAEPTP----HPAEDDGLPNEPEVRVQHLLQFLFVQTFAR  123



Lambda      K        H        a         alpha
   0.317    0.132    0.379    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760