BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027E18

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...  84.0    7e-16   Nicotiana sylvestris
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...  83.2    1e-15   Nicotiana tomentosiformis
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...  83.2    1e-15   Sesamum indicum [beniseed]
emb|CDP01376.1|  unnamed protein product                              80.9    7e-15   Coffea canephora [robusta coffee]
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...  79.3    2e-14   Vitis vinifera
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg           77.0    2e-13   Prunus persica
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...  76.6    3e-13   Solanum lycopersicum
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...  76.6    3e-13   Prunus mume [ume]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...  76.6    3e-13   Prunus mume [ume]
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...  75.5    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...  75.9    6e-13   
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...  75.9    6e-13   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...  73.9    2e-12   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...  72.4    9e-12   Pyrus x bretschneideri [bai li]
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...  72.4    9e-12   Pyrus x bretschneideri [bai li]
gb|KEH40057.1|  polyadenylate-binding protein RBP47C                  70.9    1e-11   Medicago truncatula
gb|EYU36286.1|  hypothetical protein MIMGU_mgv1a005576mg              72.0    1e-11   Erythranthe guttata [common monkey flower]
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                 69.3    1e-11   Citrus sinensis [apfelsine]
ref|XP_006434825.1|  hypothetical protein CICLE_v10001214mg           70.1    2e-11   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...  70.9    2e-11   Glycine max [soybeans]
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg           70.1    3e-11   
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...  70.5    4e-11   Tarenaya hassleriana [spider flower]
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                  70.5    4e-11   Medicago truncatula
gb|AFK35123.1|  unknown                                               70.5    4e-11   Medicago truncatula
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...  70.1    4e-11   Citrus sinensis [apfelsine]
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg           70.1    4e-11   Citrus clementina [clementine]
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                  69.3    8e-11   Glycine soja [wild soybean]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...  68.9    1e-10   Glycine max [soybeans]
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g           68.2    2e-10   Phaseolus vulgaris [French bean]
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...  67.4    3e-10   
ref|XP_002510266.1|  nuclear acid binding protein, putative           67.4    4e-10   Ricinus communis
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...  67.4    4e-10   Cicer arietinum [garbanzo]
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...  67.0    5e-10   Solanum tuberosum [potatoes]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...  67.0    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...  67.0    5e-10   Nelumbo nucifera [Indian lotus]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg              67.0    6e-10   Erythranthe guttata [common monkey flower]
gb|KJB58433.1|  hypothetical protein B456_009G209600                  66.6    6e-10   Gossypium raimondii
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...  66.6    7e-10   Glycine max [soybeans]
gb|KJB58432.1|  hypothetical protein B456_009G209600                  66.2    1e-09   Gossypium raimondii
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                65.1    1e-09   
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...  65.9    1e-09   Nicotiana sylvestris
emb|CAC69852.1|  nucleic acid binding protein                         65.5    2e-09   Nicotiana tabacum [American tobacco]
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...  65.5    2e-09   Cucumis melo [Oriental melon]
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...  65.5    2e-09   Cucumis sativus [cucumbers]
gb|KDP38389.1|  hypothetical protein JCGZ_04314                       65.5    2e-09   Jatropha curcas
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...  65.1    2e-09   Cicer arietinum [garbanzo]
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                65.1    2e-09   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                64.7    3e-09   
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                64.7    3e-09   
ref|XP_007017335.1|  RNA-binding protein 47C isoform 7                64.3    3e-09   
gb|EPS64859.1|  nucleic acid binding protein                          64.3    3e-09   Genlisea aurea
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                  64.3    3e-09   Glycine soja [wild soybean]
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                64.3    4e-09   
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                64.3    4e-09   
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...  63.9    5e-09   Phaseolus vulgaris [French bean]
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...  63.9    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...  63.5    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...  63.5    7e-09   Populus euphratica
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...  63.5    7e-09   Populus euphratica
gb|KJB63806.1|  hypothetical protein B456_010G017300                  63.2    7e-09   Gossypium raimondii
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g           63.5    7e-09   Phaseolus vulgaris [French bean]
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C             63.5    7e-09   Morus notabilis
gb|KJB59840.1|  hypothetical protein B456_009G275200                  63.5    8e-09   Gossypium raimondii
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein            63.2    9e-09   Gossypium arboreum [tree cotton]
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...  63.2    1e-08   Nicotiana tomentosiformis
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                   63.2    1e-08   Eucalyptus grandis [rose gum]
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                   63.2    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...  63.2    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...  63.2    1e-08   Tarenaya hassleriana [spider flower]
gb|KHG24367.1|  Polyadenylate-binding RBP47                           62.8    1e-08   Gossypium arboreum [tree cotton]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...  62.8    1e-08   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...  62.8    1e-08   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...  62.8    1e-08   Populus euphratica
gb|KJB63805.1|  hypothetical protein B456_010G017300                  62.8    1e-08   Gossypium raimondii
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                  62.0    1e-08   Medicago truncatula
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  62.4    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg           62.4    2e-08   
gb|KHG27259.1|  Polyadenylate-binding RBP47                           62.0    2e-08   Gossypium arboreum [tree cotton]
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...  62.0    2e-08   Fragaria vesca subsp. vesca
ref|XP_003603009.1|  RNA-binding protein                              61.2    4e-08   Medicago truncatula
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...  60.8    5e-08   Phoenix dactylifera
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...  60.8    5e-08   
ref|XP_006374988.1|  RNA-binding protein 47                           60.8    5e-08   
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...  60.5    7e-08   Phoenix dactylifera
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47   59.7    1e-07   Elaeis guineensis
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...  60.1    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...  59.7    1e-07   Vitis vinifera
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...  59.7    2e-07   Vitis vinifera
ref|XP_002302445.2|  RNA-binding protein 47                           59.7    2e-07   
emb|CAN74486.1|  hypothetical protein VITISV_029928                   58.9    2e-07   Vitis vinifera
gb|KGN55171.1|  hypothetical protein Csa_4G639100                     58.9    2e-07   Cucumis sativus [cucumbers]
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...  58.9    3e-07   Cucumis melo [Oriental melon]
ref|XP_006282412.1|  hypothetical protein CARUB_v100264671mg          55.8    3e-07   
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...  58.5    3e-07   Cucumis sativus [cucumbers]
emb|CDO97156.1|  unnamed protein product                              58.2    5e-07   Coffea canephora [robusta coffee]
ref|XP_002891364.1|  ATRBP47C                                         57.4    9e-07   
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...  57.4    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...  56.6    1e-06   Oryza brachyantha
ref|NP_001063403.1|  Os09g0462700                                     56.6    2e-06   
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg           56.6    2e-06   Capsella rubella
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                  56.2    2e-06   Arabis alpina [alpine rockcress]
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...  56.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...  55.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...  55.8    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47   55.5    4e-06   Malus domestica [apple tree]
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...  55.5    4e-06   Brachypodium distachyon [annual false brome]
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...  55.1    5e-06   Zea mays [maize]
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...  55.1    5e-06   Phoenix dactylifera
emb|CDX95176.1|  BnaC09g16940D                                        55.1    5e-06   
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...  55.1    5e-06   Brassica rapa
emb|CDY52067.1|  BnaA09g53390D                                        55.1    5e-06   Brassica napus [oilseed rape]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g           54.3    7e-06   Phaseolus vulgaris [French bean]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g           54.3    7e-06   Phaseolus vulgaris [French bean]
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...  54.3    8e-06   
ref|NP_973984.1|  RNA-binding protein 47C                             54.3    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...  54.3    8e-06   Setaria italica
dbj|BAJ85879.1|  predicted protein                                    54.3    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|NP_175180.1|  RNA-binding protein 47C                             53.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...  53.9    1e-05   Zea mays [maize]
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...  53.9    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132004.1|  uncharacterized protein LOC100193409             53.9    1e-05   Zea mays [maize]
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...  53.9    1e-05   Glycine max [soybeans]
emb|CBI32444.3|  unnamed protein product                              53.5    1e-05   Vitis vinifera
emb|CAL25353.1|  ACBF-like dna binding protein                        52.4    2e-05   Platanus x hispanica [London plane tree]
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...  53.5    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...  53.1    2e-05   Eucalyptus grandis [rose gum]
ref|NP_001144988.1|  uncharacterized protein LOC100278143             53.1    2e-05   Zea mays [maize]
dbj|BAG87507.1|  unnamed protein product                              53.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...  53.1    2e-05   Glycine max [soybeans]
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...  53.1    2e-05   Setaria italica
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    2e-05   Eucalyptus grandis [rose gum]
gb|ACF87959.1|  unknown                                               53.1    2e-05   Zea mays [maize]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg           53.1    2e-05   Prunus persica
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    2e-05   Prunus mume [ume]
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    3e-05   Prunus mume [ume]
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    3e-05   
gb|EMT21241.1|  hypothetical protein F775_43935                       50.1    3e-05   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...  52.8    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...  52.8    4e-05   Elaeis guineensis
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...  52.4    4e-05   Nicotiana tomentosiformis
gb|EPS57677.1|  hypothetical protein M569_17140                       52.4    4e-05   Genlisea aurea
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g           52.4    4e-05   Phaseolus vulgaris [French bean]
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...  52.4    4e-05   Nicotiana sylvestris
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...  52.4    4e-05   Nicotiana sylvestris
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                 52.0    4e-05   Citrus sinensis [apfelsine]
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...  52.4    4e-05   Phaseolus vulgaris [French bean]
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...  52.0    4e-05   Phaseolus vulgaris [French bean]
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                 52.0    4e-05   Citrus sinensis [apfelsine]
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg           52.0    4e-05   
gb|AIN39817.1|  hypothetical protein                                  51.6    5e-05   Zoysia matrella [Japanese carpet grass]
ref|NP_175181.1|  RNA-binding protein 47C'                            52.0    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47   51.6    6e-05   Sesamum indicum [beniseed]
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454           51.6    6e-05   
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg           51.6    6e-05   Citrus clementina [clementine]
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    6e-05   Citrus sinensis [apfelsine]
ref|XP_003608019.1|  RNA Binding Protein                              51.6    6e-05   Medicago truncatula
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg           51.6    6e-05   Citrus clementina [clementine]
dbj|BAJ87828.1|  predicted protein                                    51.6    7e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    7e-05   Citrus sinensis [apfelsine]
gb|AFK40720.1|  unknown                                               51.6    7e-05   Medicago truncatula
dbj|BAJ85753.1|  predicted protein                                    51.6    7e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY94326.1|  hypothetical protein OsI_16094                        51.6    7e-05   Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                          51.6    7e-05   Oryza sativa [red rice]
ref|NP_001052934.2|  Os04g0449900                                     51.6    7e-05   
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    8e-05   Solanum tuberosum [potatoes]
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...  51.6    8e-05   Solanum tuberosum [potatoes]
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47   51.6    8e-05   Populus euphratica
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...  51.2    8e-05   
dbj|BAK03410.1|  predicted protein                                    51.2    8e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                  51.2    8e-05   Arabis alpina [alpine rockcress]
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2        51.2    8e-05   Solanum lycopersicum
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1        51.2    8e-05   
ref|NP_001234487.1|  DNA-binding protein                              51.2    8e-05   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280        51.2    8e-05   Sorghum bicolor [broomcorn]
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                  51.2    9e-05   Arabis alpina [alpine rockcress]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg           51.2    9e-05   Eutrema salsugineum [saltwater cress]
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg           51.2    9e-05   Eutrema salsugineum [saltwater cress]
ref|NP_001275430.1|  DNA-binding protein-like                         51.2    9e-05   Solanum tuberosum [potatoes]
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131           51.2    9e-05   
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg           51.2    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Populus euphratica
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004153285.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    1e-04   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g           50.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002313840.2|  RNA-binding protein 47                           50.8    1e-04   Populus trichocarpa [western balsam poplar]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                   50.8    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47   50.8    1e-04   
ref|NP_001275480.1|  DNA binding protein ACBF-like                    50.4    1e-04   Solanum tuberosum [potatoes]
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Solanum lycopersicum
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg              50.8    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    1e-04   Solanum lycopersicum
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47   50.4    1e-04   Solanum tuberosum [potatoes]
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...  50.8    1e-04   Fragaria vesca subsp. vesca
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540        50.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Fragaria vesca subsp. vesca
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Nicotiana sylvestris
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45   50.4    2e-04   Phoenix dactylifera
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Populus euphratica
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Sesamum indicum [beniseed]
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Sesamum indicum [beniseed]
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Nicotiana sylvestris
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47   50.4    2e-04   Nicotiana tomentosiformis
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Glycine max [soybeans]
ref|XP_006845940.1|  hypothetical protein AMTR_s00157p00080130        50.1    2e-04   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...  50.4    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Glycine max [soybeans]
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Setaria italica
gb|AFW58430.1|  nucleic acid binding protein                          49.7    2e-04   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Vitis vinifera
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg           50.1    2e-04   Eutrema salsugineum [saltwater cress]
gb|AAC49850.1|  DNA binding protein ACBF                              50.1    2e-04   Nicotiana tabacum [American tobacco]
gb|AAB92518.1|  putative RNA binding protein                          50.1    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    2e-04   Populus euphratica
emb|CBI16387.3|  unnamed protein product                              50.1    2e-04   Vitis vinifera
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...  50.1    2e-04   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47   50.1    2e-04   Solanum lycopersicum
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                  49.7    2e-04   Medicago truncatula
gb|ACG32072.1|  nucleic acid binding protein                          50.1    2e-04   Zea mays [maize]
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45   50.1    2e-04   Elaeis guineensis
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                 50.1    2e-04   Citrus sinensis [apfelsine]
ref|NP_001150649.1|  nucleic acid binding protein                     50.1    2e-04   Zea mays [maize]
ref|XP_002513488.1|  nuclear acid binding protein, putative           50.1    2e-04   
ref|XP_002305583.2|  RNA-binding protein 45                           50.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Setaria italica
gb|ACF85767.1|  unknown                                               50.1    2e-04   Zea mays [maize]
gb|KDP22083.1|  hypothetical protein JCGZ_25914                       50.1    2e-04   Jatropha curcas
ref|XP_002518499.1|  nuclear acid binding protein, putative           50.1    2e-04   Ricinus communis
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    2e-04   Populus euphratica
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g           50.1    2e-04   Phaseolus vulgaris [French bean]
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Glycine max [soybeans]
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                 50.1    2e-04   Citrus sinensis [apfelsine]
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg           50.1    2e-04   Capsella rubella
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   Cicer arietinum [garbanzo]
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                  49.7    2e-04   Glycine soja [wild soybean]
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...  50.1    2e-04   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg           49.7    3e-04   
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Populus euphratica
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Glycine max [soybeans]
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Brassica rapa
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Brassica rapa
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                  49.7    3e-04   
gb|KDP20762.1|  hypothetical protein JCGZ_21233                       49.7    3e-04   Jatropha curcas
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Fragaria vesca subsp. vesca
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45   49.7    3e-04   
ref|NP_001141359.1|  uncharacterized protein LOC100273450             49.7    3e-04   Zea mays [maize]
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...  49.7    3e-04   Zea mays [maize]
dbj|BAE71244.1|  putative DNA binding protein                         49.7    3e-04   Trifolium pratense [peavine clover]
gb|KJB79290.1|  hypothetical protein B456_013G042300                  49.7    3e-04   Gossypium raimondii
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Nelumbo nucifera [Indian lotus]
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                  49.7    3e-04   Arabis alpina [alpine rockcress]
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                  49.7    3e-04   Arabis alpina [alpine rockcress]
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Nelumbo nucifera [Indian lotus]
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                  49.7    3e-04   Arabis alpina [alpine rockcress]
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   
ref|XP_004153512.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    3e-04   
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                  49.3    3e-04   Medicago truncatula
gb|AFW61057.1|  hypothetical protein ZEAMMB73_234884                  49.3    3e-04   
gb|KDO49121.1|  hypothetical protein CISIN_1g013061mg                 49.3    3e-04   Citrus sinensis [apfelsine]
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                  49.7    3e-04   Medicago truncatula
emb|CDX70874.1|  BnaC03g09580D                                        49.7    3e-04   
gb|KJB09397.1|  hypothetical protein B456_001G139100                  49.7    3e-04   Gossypium raimondii
ref|XP_010420736.1|  PREDICTED: polyadenylate-binding protein RBP...  49.7    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820           49.7    3e-04   
ref|XP_006400492.1|  hypothetical protein EUTSA_v10013617mg           49.7    3e-04   Eutrema salsugineum [saltwater cress]
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1       49.7    3e-04   Triticum urartu
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'               49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                 49.3    3e-04   Citrus sinensis [apfelsine]
gb|KDO49118.1|  hypothetical protein CISIN_1g013061mg                 49.3    3e-04   
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'            49.3    3e-04   
gb|KJB09396.1|  hypothetical protein B456_001G139100                  49.3    3e-04   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein           49.3    3e-04   
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    3e-04   
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_007015034.1|  RNA-binding family protein isoform 2             49.3    4e-04   
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
gb|KDO49120.1|  hypothetical protein CISIN_1g013061mg                 49.3    4e-04   
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_007015033.1|  RNA-binding family protein isoform 1             49.3    4e-04   
dbj|BAD05744.1|  putative RNA Binding Protein 45                      49.3    4e-04   
ref|XP_007015035.1|  RNA-binding family protein isoform 3             49.3    4e-04   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg           49.3    4e-04   
emb|CDX88893.1|  BnaA03g07560D                                        49.3    4e-04   
gb|KJB21879.1|  hypothetical protein B456_004G019500                  49.3    4e-04   
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
gb|KJB09398.1|  hypothetical protein B456_001G139100                  49.3    4e-04   
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein           49.3    4e-04   
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
gb|KJB21880.1|  hypothetical protein B456_004G019500                  49.3    4e-04   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47   49.3    4e-04   
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                 49.3    4e-04   
gb|KJB79291.1|  hypothetical protein B456_013G042300                  49.3    4e-04   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg           49.3    4e-04   
ref|XP_009120895.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    4e-04   
ref|XP_004158014.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    5e-04   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...  49.3    5e-04   
emb|CDY13992.1|  BnaC09g38340D                                        48.9    5e-04   
dbj|BAD17764.1|  putative nucleic acid binding protein                48.9    5e-04   
gb|KJB79289.1|  hypothetical protein B456_013G042300                  48.9    5e-04   
emb|CDX92537.1|  BnaA10g15760D                                        48.9    5e-04   
ref|XP_009120896.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    5e-04   
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    5e-04   
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  48.9    5e-04   
gb|KGN50253.1|  hypothetical protein Csa_5G162020                     48.9    5e-04   
gb|KJB13665.1|  hypothetical protein B456_002G088100                  48.9    5e-04   
gb|KJB13666.1|  hypothetical protein B456_002G088100                  48.9    5e-04   
emb|CDY29263.1|  BnaC01g19150D                                        48.9    5e-04   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    5e-04   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein            48.9    5e-04   
gb|KJB13664.1|  hypothetical protein B456_002G088100                  48.9    5e-04   
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920        48.9    6e-04   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    6e-04   
emb|CDX92304.1|  BnaA05g21030D                                        48.9    6e-04   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    6e-04   
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    6e-04   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...  48.9    6e-04   
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    6e-04   
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    6e-04   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
gb|KGN64531.1|  hypothetical protein Csa_1G063550                     48.5    7e-04   
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg           48.5    7e-04   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
emb|CDX99265.1|  BnaC05g33800D                                        48.5    7e-04   
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    7e-04   
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    8e-04   
ref|NP_001168324.1|  hypothetical protein                             48.5    8e-04   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...  48.5    8e-04   
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...  48.1    8e-04   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170        48.1    8e-04   
gb|KDP23018.1|  hypothetical protein JCGZ_01681                       48.1    9e-04   
dbj|BAB02953.1|  DNA/RNA binding protein-like                         48.1    9e-04   
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg              48.1    9e-04   



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 72/139 (52%), Gaps = 30/139 (22%)
 Frame = +1

Query  52   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  231
            M+T+ GPE+ ENKQP  P  P+  A    +A     VT                 Q PWV
Sbjct  1    METNNGPETPENKQPSPP--PQQAAVSEAEANVVPVVT-----------------QQPWV  41

Query  232  pMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
             MQYPAAA VMQH      ++P H+         +             GGSN ENRTIW+
Sbjct  42   AMQYPAAAMVMQHPPHYIPYHPHHHHHPPQQQQQNRG-----------GGSNNENRTIWV  90

Query  412  GDLHNWMDEDYLRSCFAST  468
            GDLHNWMDEDYLR+CFAST
Sbjct  91   GDLHNWMDEDYLRTCFAST  109



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 74/140 (53%), Gaps = 33/140 (24%)
 Frame = +1

Query  52   MQTDKGPESQENKQP-PSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppw  228
            M+T+ GPE+ ENKQP P P++   EAE    A     VT                 Q PW
Sbjct  1    METNNGPETPENKQPSPPPQQAVSEAE----ANVVPVVT-----------------QQPW  39

Query  229  vpMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIW  408
            V MQYPAAA VMQH      ++P H+         +             GGSN ENRTIW
Sbjct  40   VAMQYPAAAMVMQHPPHYIPYHPHHHHHPPQQQQQNKG-----------GGSNNENRTIW  88

Query  409  IGDLHNWMDEDYLRSCFAST  468
            +GDLHNWMDEDYLR+CFAST
Sbjct  89   VGDLHNWMDEDYLRTCFAST  108



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQH MM A      Y P++PH   + PP  Q  ++   GGSNGENRTIW+G
Sbjct  42   MQYPAAAMVMQHGMM-AAPQYVPYHPHNPHQYRYHPPPPQQSKKSNVGGSNGENRTIWVG  100

Query  415  DLHNWMDEDYLRSCFASTG  471
            DL NWMDEDYLRSCFASTG
Sbjct  101  DLRNWMDEDYLRSCFASTG  119



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG--------SNG  390
            MQYPAAA VM H MMPA HYPPHYMPYH H LHHPPP       QQ           SNG
Sbjct  1    MQYPAAAMVMPHHMMPAPHYPPHYMPYHHHHLHHPPPPQPQGPPQQQQQQQGGGGGGSNG  60

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            ENRTIW+GDLHNWMDEDYLRSCFASTG
Sbjct  61   ENRTIWVGDLHNWMDEDYLRSCFASTG  87



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 2/79 (3%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQHQMMP  HYP H++ YH     +   H Q  QQQQ  GSN +NRTIW+G
Sbjct  32   MQYPAAAMVMQHQMMPPQHYPQHFVAYHHQPHQYQHQHQQQHQQQQ--GSNADNRTIWVG  89

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLHNWMDE+YL SCFA+TG
Sbjct  90   DLHNWMDENYLHSCFAATG  108



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  41   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  100

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIW+GDLH+WMDE+YL +CFASTG
Sbjct  101  TIWVGDLHHWMDENYLHTCFASTG  124



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 85/144 (59%), Gaps = 11/144 (8%)
 Frame = +1

Query  52   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  231
            MQ++ G ESQ+NKQPP    P  +A     A+Q     + A    V  AA A  QQ PWV
Sbjct  1    MQSNNGNESQDNKQPP---PPSSQAATSPAAQQG---VSAAAVVPVAAAAPAGAQQQPWV  54

Query  232  pMQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGEN  396
             MQYPAAA VMQH MMPA      + P H   +H    H P   +  QQ    G +N EN
Sbjct  55   AMQYPAAAMVMQHPMMPAPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNEN  114

Query  397  RTIWIGDLHNWMDEDYLRSCFAST  468
            RTIW+GDLHNWMDEDYLRSCFA+T
Sbjct  115  RTIWVGDLHNWMDEDYLRSCFATT  138



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIW+GDLH+WMDE+YL +CFASTG
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTG  125



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIW+GDLH+WMDE+YL +CFASTG
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTG  125



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphy---mpyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            MQYPAAA VMQHQMMP  HY         Y  +  +    H Q  QQQQ G S GEN+TI
Sbjct  11   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGGENKTI  70

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL +CFASTG
Sbjct  71   WVGDLHHWMDENYLHTCFASTG  92



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  408
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  409  IGDLHNWMDEDYLRSCFASTG  471
            +GDLH+WMDE+YL +CFASTG
Sbjct  106  VGDLHHWMDENYLHTCFASTG  126



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  408
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  409  IGDLHNWMDEDYLRSCFASTG  471
            +GDLH+WMDE+YL +CFASTG
Sbjct  106  VGDLHHWMDENYLHTCFASTG  126



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP----AThypphympyhphflhhppphaqpqqqqqhGGSNGENRT  402
            MQYP  A VMQHQMMP    AT  PP       H           QQQQQ G  +GEN+T
Sbjct  45   MQYPTTAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHIQHLQQQQQLGSGSGENKT  104

Query  403  IWIGDLHNWMDEDYLRSCFASTG  471
            IW+GDLH+WMDE+YL +CFASTG
Sbjct  105  IWVGDLHHWMDENYLHTCFASTG  127



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypp---hympyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            MQYP AA VMQHQMMP  HY         Y  +  +    H Q  QQQQ G  +GEN+TI
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGSGENKTI  101

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE YL +CFASTG
Sbjct  102  WVGDLHHWMDESYLHTCFASTG  123



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypp---hympyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            MQYP AA VMQHQMMP  HY         Y  +  +    H Q  QQQQ G  +GEN+TI
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGSGENKTI  101

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE YL +CFASTG
Sbjct  102  WVGDLHHWMDESYLHTCFASTG  123



>gb|KEH40057.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=309

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            T+WIGDLH+WMDE YL  CFASTG
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTG  121



>gb|EYU36286.1| hypothetical protein MIMGU_mgv1a005576mg [Erythranthe guttata]
Length=478

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 76/153 (50%), Gaps = 26/153 (17%)
 Frame = +1

Query  46   LKMQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqpp  225
            LKMQTD G ESQ        R    E   + D       + G G   V  AAAA      
Sbjct  111  LKMQTDNGSESQ--------RTSSKENNSNND-------SGGGGNSKVAAAAAAAVPGQQ  155

Query  226  wvpMQYPAAATVMQHQMMPA-----------Thypphympyhphflhhppphaqpqqqqq  372
            WV MQYPAAA VM H M+PA            H+P H+ P  P                 
Sbjct  156  WVAMQYPAAAMVMPHGMIPAPHYASPHYMPYHHHPLHHHPPLPPSPLPQHQSGGGNGNGN  215

Query  373  hGGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
             GGSNGENRTIW+GDLHNWMDEDYL +CFASTG
Sbjct  216  GGGSNGENRTIWVGDLHNWMDEDYLGNCFASTG  248



>gb|KDO84283.1| hypothetical protein CISIN_1g037458mg, partial [Citrus sinensis]
Length=196

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  405
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL SCFASTG
Sbjct  96   WVGDLHHWMDENYLHSCFASTG  117



>ref|XP_006434825.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434828.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48065.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48068.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=289

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  405
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL SCFASTG
Sbjct  95   WVGDLHHWMDENYLHSCFASTG  116



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQH MMP  HY P       H      P A         GS+ EN+T+W+G
Sbjct  32   MQYPAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQVPQAHHL------GSSAENKTVWVG  85

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL  CFASTG
Sbjct  86   DLHHWMDENYLHRCFASTG  104



>ref|XP_006434824.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434826.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48064.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48066.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=352

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  405
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL SCFASTG
Sbjct  95   WVGDLHHWMDENYLHSCFASTG  116



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            M+YP AA VM HQMM    +       +  +  + P H Q +  +   GSNGEN+TIWIG
Sbjct  53   MRYPPAAAVMPHQMM----FAAAAAAPYSPYHQYQPHHYQSRGNKHFNGSNGENKTIWIG  108

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL SCFAS G
Sbjct  109  DLHHWMDENYLNSCFASAG  127



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            T+WIGDLH+WMDE YL  CFASTG
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTG  121



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            T+WIGDLH+WMDE YL  CFASTG
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTG  121



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  405
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL SCFASTG
Sbjct  96   WVGDLHHWMDENYLHSCFASTG  117



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  405
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH+WMDE+YL SCFASTG
Sbjct  95   WVGDLHHWMDENYLHSCFASTG  116



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQH MMP  HY       +  + H+              GS+ EN+T+W+G
Sbjct  30   MQYPAAAMVMQHHMMPPQHYLHAPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  88

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL  CFAS G
Sbjct  89   DLHHWMDENYLHRCFASNG  107



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP---------AThypphympyhphflhhppphaqpqqqqqhGGSN  387
            MQYPAAA VM H M+P            +  H+   +           Q Q      GS 
Sbjct  34   MQYPAAAMVMPHHMLPPQHYAPPPYVPFHHHHHHHQYAAPHVPNQHQQQQQHHHHQNGSG  93

Query  388  GENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GEN+TIWIGDLH+WMDE+YL  CFASTG
Sbjct  94   GENKTIWIGDLHHWMDENYLHRCFASTG  121



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqq-qqqhGGSNGENRTIWI  411
            MQYPAAA VMQH MMP  HY     P  P+  +H      P      H GS+ EN+T+W+
Sbjct  37   MQYPAAAMVMQHHMMPPQHYAAPPPPPQPYVAYHQYQQQLPHVPHAHHQGSSAENKTVWV  96

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH+WMDE+YL  CFASTG
Sbjct  97   GDLHHWMDENYLHRCFASTG  116



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQH MMP  HY P     +  + H+              GS+ EN+T+W+G
Sbjct  25   MQYPAAAMVMQHHMMPPQHYAPPPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  83

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL  CFAS G
Sbjct  84   DLHHWMDENYLHRCFASNG  102



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 52/88 (59%), Gaps = 9/88 (10%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSN---------  387
            MQYPAAA VMQHQM+P  HY P    ++    H    H     Q Q    N         
Sbjct  46   MQYPAAAMVMQHQMLPPQHYAPPPPQHYMTAYHQYHHHHPHPHQPQQHHQNQGSSGGGGG  105

Query  388  GENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GENRT+WIGDLH+WMDE+YL +CFASTG
Sbjct  106  GENRTVWIGDLHHWMDENYLHTCFASTG  133



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP---AThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            MQYP A  VM H MMP       P    P+H  +          Q   Q  GSNGEN+T+
Sbjct  42   MQYPTA-MVMPHHMMPPQHYAPPPYVPYPHHHQYQQPLHVPHHHQHHHQQHGSNGENKTL  100

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            WIGDLHNWMDE+YL  CFASTG
Sbjct  101  WIGDLHNWMDENYLHRCFASTG  122



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYPAAA VMQH MMP+      + P H   +H    H P   +  QQ    G +N ENR
Sbjct  43   MQYPAAAMVMQHPMMPSPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNENR  102

Query  400  TIWIGDLHNWMDEDYLRSCFAST  468
            TIW+GDLHNWMDEDYLRSCFA+T
Sbjct  103  TIWVGDLHNWMDEDYLRSCFATT  125



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH WMDE YL SCFA TG
Sbjct  82   DLHYWMDESYLHSCFAHTG  100



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH WMDE YL SCFA TG
Sbjct  82   DLHYWMDESYLHSCFAHTG  100



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  NGENRTIW+GDLHNWMDE YLR+CF STG
Sbjct  108  GNGNGENRTIWVGDLHNWMDEQYLRTCFDSTG  139



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  390
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH+WMDE+YL SCFAS G
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIG  122



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 7/80 (9%)
 Frame = +1

Query  235  MQYPAAAT-VMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
            MQYPAAA  VM H M+P            P ++ +   +A   Q Q   GS GEN+TIWI
Sbjct  36   MQYPAAAAMVMPHHMLPP------QHYAPPPYVPYHHQYAAQPQHQHQNGSGGENKTIWI  89

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH+WMDE+YL  CFASTG
Sbjct  90   GDLHHWMDENYLHRCFASTG  109



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  390
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH+WMDE+YL SCFAS G
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIG  122



>ref|XP_007017334.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
 gb|EOY14559.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
Length=306

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 88/150 (59%), Gaps = 21/150 (14%)
 Frame = +1

Query  52   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  231
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  232  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  378
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFAST  468
             +N ENRTIW+GDL NWMDEDYLR+CFAST
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFAST  140



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 88/150 (59%), Gaps = 21/150 (14%)
 Frame = +1

Query  52   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  231
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  232  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  378
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFAST  468
             +N ENRTIW+GDL NWMDEDYLR+CFAST
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFAST  140



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  408
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  409  IGDLHNWMDEDYLRSCFASTG  471
            +GDL +WMDE+YL SCFASTG
Sbjct  96   VGDLQHWMDENYLHSCFASTG  116



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160013.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  408
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  409  IGDLHNWMDEDYLRSCFASTG  471
            +GDL +WMDE+YL SCFASTG
Sbjct  96   VGDLQHWMDENYLHSCFASTG  116



>gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphy-----mpyhphflhhppphaqpqqqqqhGGSNGENR  399
            MQYPAAA VMQHQM+P  HY P         YH +  HHP     PQQ       + EN+
Sbjct  42   MQYPAAAMVMQHQMIPPQHYAPPPPQHYMAAYHQYHHHHPHLQHTPQQHHHQNQGSSENK  101

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            T+WIGDLH+WMDE+YL +CFASTG
Sbjct  102  TVWIGDLHHWMDENYLHTCFASTG  125



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQH M+P  HY P    ++  + H+        Q+     S+ +N+TIW+G
Sbjct  35   MQYPAAAMVMQHHMLPPQHYAPPSPHHYIPYHHYQHQITHVHQR-----SSADNKTIWVG  89

Query  415  DLHNWMDEDYLRSCFAST  468
            DLH+WMDE+YL  CFAST
Sbjct  90   DLHHWMDENYLHCCFAST  107



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>ref|XP_007017335.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
 gb|EOY14560.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
Length=339

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMP------AThypphympyhphflhhppphaqpqqqqqhGGSNGEN  396
            MQYP AA VMQH MMP         YP H++ +H      PPP  Q       GGS+G+N
Sbjct  8    MQYPTAAVVMQHGMMPHYAPPHYIPYPLHHIHHHLPSSPAPPPQQQVGSSNNGGGSSGDN  67

Query  397  RTIWIGDLHNWMDEDYLRSCFASTGG  474
            RT+W+GDL+NWMDEDYLR+CF ST G
Sbjct  68   RTLWVGDLYNWMDEDYLRNCFDSTRG  93



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +1

Query  244  PAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDLH  423
            PAAA VMQH MMP  HY P       H                  GS+ EN+T+W+GDLH
Sbjct  1    PAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQQVPQAHHL-----GSSAENKTVWVGDLH  55

Query  424  NWMDEDYLRSCFASTG  471
            +WMDE+YL  CFASTG
Sbjct  56   HWMDENYLHRCFASTG  71



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTG  122



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GEN+T+WIGDLH+WMDE+YL  CFASTG
Sbjct  82   GSSGENKTVWIGDLHHWMDENYLHRCFASTG  112



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 48/79 (61%), Gaps = 10/79 (13%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAA  VMQHQMMP           H    + P  H Q Q Q Q  GS+ EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMP----------QHYPQPYMPYHHHQQQPQSQQQGSSDENKTIWVG  75

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH WMDE YL +CFA TG
Sbjct  76   DLHYWMDESYLHNCFAHTG  94



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 48/79 (61%), Gaps = 10/79 (13%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAA  VMQHQMMP           H    + P  H Q Q Q Q  GS+ EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMP----------QHYPQPYMPYHHHQQQPQSQQQGSSDENKTIWVG  75

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH WMDE YL +CFA TG
Sbjct  76   DLHYWMDESYLHNCFAHTG  94



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTG
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTG  118



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTG
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTG  118



>gb|KJB63806.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=343

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 55/87 (63%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYP---AAATVMQHQMM-----PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTG  118



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GEN+T+WIGDLH+WMDE+YL  CFASTG
Sbjct  81   GSSGENKTVWIGDLHHWMDENYLHRCFASTG  111



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphymp-------yhphflhhppphaqpqqqqqhGGSNGE  393
            MQYPA A VMQHQMMP   +  HY             + H      Q QQQQ   G   +
Sbjct  29   MQYPATAMVMQHQMMPPPPHHQHYAAPPPPQHYMAAAYHHPYHHGHQQQQQQTGSGGGAD  88

Query  394  NRTIWIGDLHNWMDEDYLRSCFASTG  471
            N+T+W+GDLH+WMDE+YL SCFA+TG
Sbjct  89   NKTLWVGDLHHWMDENYLHSCFANTG  114



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVASPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  415  DLHNWMDEDYLRSCFASTG  471
            DL++WMDE+YL SCFASTG
Sbjct  91   DLYHWMDENYLHSCFASTG  109



>gb|KHG01821.1| Polyadenylate-binding RBP47C -like protein [Gossypium arboreum]
Length=385

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVAPPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  415  DLHNWMDEDYLRSCFASTG  471
            DL++WMDE+YL SCFASTG
Sbjct  91   DLYHWMDENYLHSCFASTG  109



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 78/151 (52%), Gaps = 23/151 (15%)
 Frame = +1

Query  52   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  231
            MQ + G ESQENKQPP        ++  Q       +     A+  P             
Sbjct  1    MQKNNGTESQENKQPPPQPSQPTASQPQQQGVSGGTIVPVVAAQQQPWVP----------  50

Query  232  pMQYPAAATVMQHQMMPAThypphympyhphflhhppp------------haqpqqqqqh  375
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH                 Q      +
Sbjct  51   -MQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  109

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFAST  468
              +N ENRTIW+GDL NWMDEDYLR+CFAST
Sbjct  110  NNNNNENRTIWVGDLLNWMDEDYLRNCFAST  140



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            NGENRT+W+GDLH+WMDE+YL SCF STG
Sbjct  56   NGENRTVWVGDLHHWMDENYLHSCFVSTG  84



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            NGENRT+W+GDLH+WMDE+YL SCF STG
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTG  137



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            NGENRT+W+GDLH+WMDE+YL SCF STG
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTG  137



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN+TIW+GDLH+WMDE+YL SCFAS G
Sbjct  89   SNGENKTIWVGDLHHWMDENYLNSCFASAG  118



>gb|KHG24367.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=382

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM-------PAThypphympyhphflhhppphaqpqqqqqhGGSNG-  390
            MQYP  A VMQHQMM       P      +   +H H  +          QQQ G ++G 
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHTQQQQGSNDGC  95

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFAS G
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASIG  122



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpq-------qqqqhGGSNGENR  399
            YPAAA VMQHQ++P  HY P    ++    +H                Q+Q    +GEN+
Sbjct  33   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  92

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIWIGDLH+WMDE+YL SCFASTG
Sbjct  93   TIWIGDLHHWMDENYLHSCFASTG  116



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpq-------qqqqhGGSNGENR  399
            YPAAA VMQHQ++P  HY P    ++    +H                Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIWIGDLH+WMDE+YL SCFASTG
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTG  117



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpq-------qqqqhGGSNGENR  399
            YPAAA VMQHQ++P  HY P    ++    +H                Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIWIGDLH+WMDE+YL SCFASTG
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTG  117



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 55/87 (63%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYP---AAATVMQHQMM-----PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTG  118



>gb|KEH35744.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=300

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 5/79 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL  CFASTG
Sbjct  99   DLHHWMDENYLHRCFASTG  117



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN++IW+GDLH+WMDE+YL SCFAS+G
Sbjct  89   SNGENKSIWVGDLHHWMDENYLNSCFASSG  118



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            M+YP A  VM HQMM A   PP     +  F  H   H Q +  +    SNGEN+TIWIG
Sbjct  62   MRYPPA-VVMPHQMMYAPAPPPSPYSPYHQFPSHHHQHHQSRGNKYQNASNGENKTIWIG  120

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE YL S FAS G
Sbjct  121  DLHHWMDESYLNSSFASAG  139



>gb|KHG27259.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=384

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 55/87 (63%), Gaps = 8/87 (9%)
 Frame = +1

Query  235  MQYP---AAATVMQHQMM-----PAThypphympyhphflhhppphaqpqqqqqhGGSNG  390
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  33   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHQGHAPSQQQQQGSGGGG  92

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH+WMDE+YL SCFASTG
Sbjct  93   ENKTVWVGDLHHWMDENYLHSCFASTG  119



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAT---------hypphympyhphflhhppphaqpqqqqqhGGSN  387
            MQYPAAA VMQHQMMP                Y       L               GG +
Sbjct  44   MQYPAAAMVMQHQMMPPQHYAPPPPHYMAYHQYQQQPQQHLQQQQQPQMGSGGGGGGGGS  103

Query  388  GENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GEN+TIW+GDLH+WMDE+YL +CFAS G
Sbjct  104  GENKTIWVGDLHHWMDENYLHNCFASAG  131



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 5/79 (6%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  415  DLHNWMDEDYLRSCFASTG  471
            DLH+WMDE+YL  CFASTG
Sbjct  99   DLHHWMDENYLHRCFASTG  117



>ref|XP_008813039.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Phoenix dactylifera]
Length=350

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  235  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH WM+E+YL SCF  TG
Sbjct  81   GDLHYWMEENYLHSCFGHTG  100



>ref|XP_008813037.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=355

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  235  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH WM+E+YL SCF  TG
Sbjct  81   GDLHYWMEENYLHSCFGHTG  100



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +GEN+TIWIGDLH+WMDE+YL SCF STG
Sbjct  89   SGENKTIWIGDLHHWMDENYLHSCFVSTG  117



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  235  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH WM+E+YL SCF  TG
Sbjct  81   GDLHYWMEENYLHSCFGHTG  100



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  235  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  411
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  25   MQYPPAAAMVMPHQMVAAVPPPPPPQYAQHFLPYHQPPPPQHHQHQAGAAGGEENKTIWV  84

Query  412  GDLHNWMDEDYLRSCFASTG  471
            GDLH WM+E+YL SCF  TG
Sbjct  85   GDLHYWMEENYLHSCFGHTG  104



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GEN+TIW+GDLH+WMDE YL SCF S G
Sbjct  136  GSSGENKTIWVGDLHHWMDEIYLSSCFGSAG  166



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  420
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  421  HNWMDEDYLRSCFASTG  471
            H WMD++YLR+CF  TG
Sbjct  89   HQWMDDNYLRTCFGHTG  105



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  420
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  421  HNWMDEDYLRSCFASTG  471
            H WMD++YLR+CF  TG
Sbjct  89   HQWMDDNYLRTCFGHTG  105



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = +1

Query  241  YPAAATVMQHQ-----MMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            YPAAA VMQH       +P   +      YH +  HH  PH Q QQQQQ  GS+G+N+TI
Sbjct  39   YPAAAMVMQHMPPQHYGLPPPQHYMAATAYHQYQHHHHLPHVQQQQQQQREGSSGDNKTI  98

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
             IGDLH+WMDE+YL +CFASTG
Sbjct  99   CIGDLHHWMDENYLHTCFASTG  120



>emb|CAN74486.1| hypothetical protein VITISV_029928 [Vitis vinifera]
Length=434

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = +1

Query  241  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  420
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  32   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  85

Query  421  HNWMDEDYLRSCFASTG  471
            H WMD++YLR+CF  TG
Sbjct  86   HQWMDDNYLRTCFGHTG  102



>gb|KGN55171.1| hypothetical protein Csa_4G639100 [Cucumis sativus]
Length=366

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS  EN+TIW+GDLH+WMDE YL SCF+S G
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVG  108



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS  EN+TIW+GDLH+WMDE YL SCF+S G
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVG  108



>ref|XP_006282412.1| hypothetical protein CARUB_v100264671mg, partial [Capsella rubella]
 gb|EOA15310.1| hypothetical protein CARUB_v100264671mg, partial [Capsella rubella]
Length=116

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
              SN EN+TIW+GDL +WMDE+YL SCF+S+G
Sbjct  84   NASNTENKTIWVGDLLHWMDENYLNSCFSSSG  115



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160607.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
Length=426

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS  EN+TIW+GDLH+WMDE YL SCF+S G
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVG  108



>emb|CDO97156.1| unnamed protein product [Coffea canephora]
Length=438

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSNGEN  396
            MQYPAAA VMQ QMM      PA  Y  H +    H L+ P P  + Q Q Q+  S+ EN
Sbjct  42   MQYPAAAMVMQQQMMYDRQYVPAAAYYHHQLYQQQHQLYQPQPQHKQQSQIQN--SSEEN  99

Query  397  RTIWIGDLHNWMDEDYLRSCFA  462
            RTIWIGDL  WMDE YL SCF+
Sbjct  100  RTIWIGDLQQWMDEAYLLSCFS  121



>ref|XP_002891364.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67623.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTGG  474
            SNGEN+TIW+GDLH+WMDE YL S FAS  G
Sbjct  103  SNGENKTIWVGDLHHWMDETYLNSSFASADG  133



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMM---PAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  405
            ++YPA A VMQH MM   P  H    Y          PP  +    Q     +  E RTI
Sbjct  21   VRYPAPAMVMQHPMMAPPPYGHPFVAYHQTPTPPPPPPPLKSIRLHQAVDAAAEDEKRTI  80

Query  406  WIGDLHNWMDEDYLRSCFASTG  471
            W+GDLH WMDE+YL SCF  +G
Sbjct  81   WVGDLHYWMDENYLHSCFGHSG  102



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG   EN+TIW+GDLH WMDE+YL SCF  TG
Sbjct  10   GGGQEENKTIWVGDLHYWMDENYLHSCFGYTG  41



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG   EN+TIW+GDLH WMDE+YL SCF  TG
Sbjct  108  GGGQEENKTIWVGDLHYWMDENYLHSCFGYTG  139



>ref|XP_006307520.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
 gb|EOA40418.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
Length=443

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN+TIW+GDLH+WMDE YL S F S G
Sbjct  104  SNGENKTIWVGDLHHWMDEAYLNSSFGSAG  133



>gb|KFK36144.1| hypothetical protein AALP_AA4G083000 [Arabis alpina]
Length=426

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  414
            M+YP A  VM HQMM A   PP Y PY  H  +         + Q    +NGEN+TIW+G
Sbjct  44   MRYPPAV-VMPHQMMFAPPPPPPYSPYPHHHQYQNHHRGGNNKYQN--ANNGENKTIWVG  100

Query  415  DLHNWMDEDYLRSCFAS  465
            DLH+WMDE+YL S FAS
Sbjct  101  DLHHWMDENYLNSSFAS  117



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN+TIW+GDLH+WMDE YL S F S G
Sbjct  109  SNGENKTIWVGDLHHWMDEPYLNSSFGSAG  138



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN+TIW+GDL+ WMDE YL S F STG
Sbjct  107  SNGENKTIWVGDLYQWMDEPYLNSSFGSTG  136



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G N E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  50   GPNDEVRTIWVGDLHHWMDETYLHGCFAHTG  80



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G N E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  103  GPNDEVRTIWVGDLHHWMDETYLHGCFAHTG  133



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   EN+TIW+GDLH WMDE+YL SCF  TG
Sbjct  98   GGQEENKTIWVGDLHYWMDENYLHSCFGYTG  128



>ref|XP_008678713.1| PREDICTED: polyadenylate-binding protein RBP47-like [Zea mays]
 gb|AFW62691.1| hypothetical protein ZEAMMB73_026342 [Zea mays]
Length=430

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +1

Query  376  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG+ GE NRTIW+GDL  WMDE+YL SCF S+G
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGSSG  128



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  399
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIW+GDLH WMDE Y+ SCF  TG
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTG  107



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIWIGDL +WMDE+YL SCFA  G
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAG  113



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIWIGDL +WMDE+YL SCFA  G
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAG  113



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIWIGDL +WMDE+YL SCFA  G
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAG  113



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ E RTIW+GDLH+WMDE+YL +CFA TG
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTG  58



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ E RTIW+GDLH+WMDE+YL +CFA TG
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTG  58



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +1

Query  235  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  399
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  400  TIWIGDLHNWMDEDYLRSCFASTG  471
            TIW+GDLH WMDE Y+ SCF  TG
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTG  107



>ref|NP_973984.1| RNA-binding protein 47C [Arabidopsis thaliana]
 gb|AEE32173.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=310

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFAS  465
            NGEN+TIW+GDLH+WMDE YL S FAS
Sbjct  97   NGENKTIWVGDLHHWMDEAYLNSSFAS  123



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+T+W+GDLH WMDE+YL SCF  TG
Sbjct  107  ENKTVWVGDLHYWMDENYLHSCFGYTG  133



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH WMDE+YL +CF  TG
Sbjct  151  ENKTIWVGDLHYWMDENYLHTCFGYTG  177



>ref|XP_010479152.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SNGEN+T+W+GDL++WMDE YL S F S G
Sbjct  109  SNGENKTVWVGDLYHWMDESYLNSSFGSAG  138



>ref|NP_175180.1| RNA-binding protein 47C [Arabidopsis thaliana]
 sp|Q9SX79.1|RB47C_ARATH RecName: Full=Polyadenylate-binding protein RBP47C; Short=Poly(A)-binding 
protein RBP47C; AltName: Full=RNA-binding protein 
47C; Short=AtRBP47C [Arabidopsis thaliana]
 gb|AAD46038.1|AC007519_23 Contains 3 PF|00076 RNA recognition motif domains. ESTs gb|R30092, 
gb|R30093, gb|AA394338, gb|N65719 and gb|AA597577 come 
from this gene [Arabidopsis thaliana]
 gb|AAK06876.1|AF344325_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK59684.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL33806.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE32174.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=432

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFAS  465
            NGEN+TIW+GDLH+WMDE YL S FAS
Sbjct  97   NGENKTIWVGDLHHWMDEAYLNSSFAS  123



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH WMDE+YL +CF  TG
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTG  116



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH WMDE+YL +CF  TG
Sbjct  75   ENKTIWVGDLHYWMDENYLHNCFGHTG  101



>ref|NP_001132004.1| uncharacterized protein LOC100193409 [Zea mays]
 gb|ACF80669.1| unknown [Zea mays]
Length=422

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH WMDE+YL +CF  TG
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTG  116



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ E RT+W+GDLH+WMDE+YL +CFA TG
Sbjct  95   SSDEIRTVWLGDLHHWMDENYLHNCFAHTG  124



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS  E +T+W+GDLH WMD++YLR+CF  TG
Sbjct  3    GSTDEIKTLWVGDLHQWMDDNYLRTCFGHTG  33



>emb|CAL25353.1| ACBF-like dna binding protein [Platanus x acerifolia]
Length=216

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDLH WMD +YL +CFA TG
Sbjct  27   ENKTIWVGDLHYWMDGNYLNNCFAHTG  53



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  106  GPTDEVRTIWVGDLHHWMDETYLHGCFAHTG  136



>ref|XP_010052834.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Eucalyptus 
grandis]
 gb|KCW76950.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=300

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG   E RT+WIGDL  WMDE YL +CFA+TG
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATG  116



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+++W+GDLH WMDE+YL SCF  TG
Sbjct  104  ENKSVWVGDLHYWMDENYLHSCFGYTG  130



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  394  NRTIWIGDLHNWMDEDYLRSCFASTG  471
            N+TIW+GDLH WMDE+YL SCF  TG
Sbjct  18   NKTIWVGDLHYWMDENYLHSCFGYTG  43



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+W+GDLH+WMDE+YL +CFA TG
Sbjct  99   EIRTVWLGDLHHWMDENYLHNCFAHTG  125



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 1/33 (3%)
 Frame = +1

Query  376  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG+ GE NRTIW+GDL  WMDE+YL SCF  +G
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGPSG  128



>ref|XP_010052833.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Eucalyptus 
grandis]
Length=336

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG   E RT+WIGDL  WMDE YL +CFA+TG
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATG  116



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+++W+GDLH WMDE+YL SCF  TG
Sbjct  101  ENKSVWVGDLHYWMDENYLHSCFGYTG  127



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  109  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTG  139



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTG  140



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIW+GDLH WMDE+YL +CF  TG
Sbjct  78   DNKTIWVGDLHYWMDENYLHNCFGRTG  104



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   E RTIW+GDLH+WMDE YL  CFA TG
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTG  140



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL SCF ++G
Sbjct  79   GGNGCEENKTIWVGDLQYWMDENYLHSCFGTSG  111



>gb|EMT21241.1| hypothetical protein F775_43935 [Aegilops tauschii]
Length=110

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA+TG
Sbjct  42   EVRTLWIGDLQYWMDENYIYSCFANTG  68



>ref|XP_010052832.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76949.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=427

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GG   E RT+WIGDL  WMDE YL +CFA+TG
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATG  116



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            ++ EN+TIW+GDLH WMDE YL SCF  TG
Sbjct  417  ASDENKTIWVGDLHYWMDESYLHSCFGHTG  446



>ref|XP_009628458.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=418

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+ +N+TIWIGDL +WMDE YL SCF+ +G
Sbjct  61   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSG  91



>gb|EPS57677.1| hypothetical protein M569_17140 [Genlisea aurea]
Length=414

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE+YL SCF+ TG
Sbjct  90   DNKTIWIGDLQQWMDENYLHSCFSQTG  116



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFASTG
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTG  89



>ref|XP_009783555.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nicotiana sylvestris]
Length=437

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+ +N+TIWIGDL +WMDE YL SCF+ +G
Sbjct  75   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSG  105



>ref|XP_009783557.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nicotiana sylvestris]
Length=397

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+ +N+TIWIGDL +WMDE YL SCF+ +G
Sbjct  75   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSG  105



>gb|KDO75474.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=303

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFASTG
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTG  89



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFASTG
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTG  89



>gb|KDO75475.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
 gb|KDO75476.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=305

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>ref|XP_006449040.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62280.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=305

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>gb|AIN39817.1| hypothetical protein [Zoysia matrella]
Length=298

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA+TG
Sbjct  87   EMRTLWIGDLQYWMDENYIYSCFAATG  113



>ref|NP_175181.1| RNA-binding protein 47C' [Arabidopsis thaliana]
 sp|Q9SX80.1|R47CP_ARATH RecName: Full=Polyadenylate-binding protein RBP47C'; Short=Poly(A)-binding 
protein RBP47C'; AltName: Full=RNA-binding protein 
47C'; Short=AtRBP47C prime; Short=AtRBP47C' [Arabidopsis 
thaliana]
 gb|AAD46037.1|AC007519_22 Contains 3 PF|00076 RNA recognition motif domains. EST gb|T20424 
comes from this gene [Arabidopsis thaliana]
 dbj|BAE99410.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04767.1| At1g47500 [Arabidopsis thaliana]
 gb|AEE32178.1| RNA-binding protein 47C' [Arabidopsis thaliana]
Length=434

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  385  NGENRTIWIGDLHNWMDEDYLRSCFAS  465
            NGEN+TIW+GDL NWMDE YL S F S
Sbjct  99   NGENKTIWVGDLQNWMDEAYLNSAFTS  125



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +1

Query  382  SNGE-NRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+GE N+TIWIGDL  WMDE YL+SCF+ TG
Sbjct  86   SSGEDNKTIWIGDLQQWMDEGYLQSCFSQTG  116



>ref|XP_010481964.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=434

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIW+GDL +WMDE+YL S F+S+G
Sbjct  96   SNTENKTIWVGDLLHWMDENYLNSAFSSSG  125



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS GE R++WIGDL +WMDE+YL S FA TG
Sbjct  71   GSAGEIRSLWIGDLQSWMDENYLMSIFAHTG  101



>ref|XP_010494212.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=428

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIW+GDL +WMDE+YL S F+S+G
Sbjct  90   SNTENKTIWVGDLLHWMDENYLNSAFSSSG  119



>ref|XP_002973844.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
 ref|XP_002983548.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ15449.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ24799.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
Length=350

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  376  GGSNGENRTIWIGDLHNWMDEDYLRSCFAST  468
            G +NGE +T+W+GDL  WMDE YL SCFA T
Sbjct  14   GHANGELKTLWVGDLQYWMDEGYLYSCFAHT  44



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>ref|XP_003608019.1| RNA Binding Protein [Medicago truncatula]
 gb|AES90216.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=454

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RTIW+GDLH+WMDE +L +CFA TG
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTG  140



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>dbj|BAJ87828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ +CFASTG
Sbjct  81   EARTLWIGDLQYWMDENYVYNCFASTG  107



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G  GE RT+WIGDL  WMDE YL +CFA TG
Sbjct  76   GQPGEIRTLWIGDLQYWMDETYLNTCFAHTG  106



>gb|AFK40720.1| unknown [Medicago truncatula]
Length=454

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RTIW+GDLH+WMDE +L +CFA TG
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTG  140



>dbj|BAJ85753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ +CFASTG
Sbjct  81   EARTLWIGDLQYWMDENYVYNCFASTG  107



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSG  128



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSG  128



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  57   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSG  89



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GSN E +TIW+GDL +WMDE YL +CF+ TG
Sbjct  98   GSNEEAKTIWVGDLLHWMDETYLHNCFSHTG  128



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            ENRTIW+GDL  WMDE+YL +CF S G
Sbjct  53   ENRTIWVGDLQYWMDENYLHNCFGSGG  79



>dbj|BAK03410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA+TG
Sbjct  89   EVRTLWIGDLQYWMDENYIYSCFANTG  115



>gb|KFK27100.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=407

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GE R++WIGDL  WMDE+YL S FA +G
Sbjct  68   GSDGEIRSLWIGDLQPWMDENYLNSIFAQSG  98



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  93   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSG  125



>gb|KFK27101.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=405

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GE R++WIGDL  WMDE+YL S FA +G
Sbjct  68   GSDGEIRSLWIGDLQPWMDENYLNSIFAQSG  98



>ref|XP_006401513.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42966.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=401

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GE R++WIGDL  WMDE+Y+ S FA TG
Sbjct  67   GSDGEIRSLWIGDLQPWMDENYIMSIFAQTG  97



>ref|XP_006401514.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42967.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=403

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS+GE R++WIGDL  WMDE+Y+ S FA TG
Sbjct  67   GSDGEIRSLWIGDLQPWMDENYIMSIFAQTG  97



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIWIGDL  WMDE YL +CFA  G
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAG  103



>ref|XP_002863750.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40009.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
Length=400

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIW+GDL +WMDE+YL S F+S G
Sbjct  86   SNTENKTIWVGDLLHWMDENYLNSSFSSAG  115



>ref|XP_006413118.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
 gb|ESQ54571.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
Length=408

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS GE R++WIGDL  WMDE+YL S FA TG
Sbjct  64   GSAGEIRSLWIGDLQPWMDENYLMSIFALTG  94



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GSN E +TIW+GDL +WMDE YL +CF+ TG
Sbjct  96   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTG  126



>ref|XP_010442131.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=432

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            SN EN+TIW+GDL  WMDE+YL S F+S+G
Sbjct  94   SNTENKTIWVGDLLYWMDENYLNSAFSSSG  123



>ref|XP_004153285.1| PREDICTED: polyadenylate-binding protein RBP47B-like, partial 
[Cucumis sativus]
Length=218

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS  E +T+WIGDL  WMDE YL +CFA TG
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTG  124



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RTIW+GDL  WMDE+YL SCF  TG
Sbjct  78   ERRTIWVGDLQYWMDENYLHSCFGHTG  104



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RTIW+GDL  WMDE+YL SCF  TG
Sbjct  78   EKRTIWVGDLQYWMDENYLLSCFVHTG  104



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GSN E +TIW+GDL +WMDE YL +CF+ TG
Sbjct  97   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTG  127



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE YL SCFA TG
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTG  100



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+R+CFA +G
Sbjct  80   EIRTLWIGDLQYWMDENYIRTCFAQSG  106



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GSN E +T+W+GDL +WMDE YL +CF+ TG
Sbjct  97   GSNEEAKTVWVGDLLHWMDETYLHNCFSHTG  127



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  397  RTIWIGDLHNWMDEDYLRSCFASTG  471
            +TIWIGDLH+WMDE YL +CF+ TG
Sbjct  99   KTIWIGDLHHWMDETYLHNCFSHTG  123



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  397  RTIWIGDLHNWMDEDYLRSCFASTG  471
            +TIWIGDLH+WMDE YL +CF+ TG
Sbjct  112  KTIWIGDLHHWMDETYLHNCFSHTG  136



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ +N+TIWIGDL  WMDE+YL SCF+  G
Sbjct  28   SSEDNKTIWIGDLQQWMDENYLHSCFSHAG  57



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE YL SCFA TG
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTG  100



>gb|EYU37704.1| hypothetical protein MIMGU_mgv1a006826mg [Erythranthe guttata]
Length=430

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMD+ YL+SCFA +G
Sbjct  92   DNKTIWIGDLQQWMDDGYLQSCFAQSG  118



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE YL SCFA TG
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTG  100



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE+YL SCF+  G
Sbjct  81   DNKTIWIGDLQQWMDENYLHSCFSHAG  107



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G   E RTIW GDLH+WMDE YL  CFA TG
Sbjct  113  GPTDEVRTIWAGDLHHWMDEAYLHGCFAYTG  143



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +NRTIW+GDL  WMDE+YL SCF  +G
Sbjct  107  DNRTIWVGDLQYWMDENYLHSCFGPSG  133



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RTIW GDLH+WMDE YL  CFA TG
Sbjct  117  EVRTIWAGDLHHWMDEAYLHGCFAYTG  143



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  56   DNKTIWIGDLQQWMDESYLHSCFSQAG  82



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+W+GDL  WMDE+YL  CFASTG
Sbjct  82   EIRTLWVGDLQYWMDENYLFGCFASTG  108



>ref|XP_011037672.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Populus 
euphratica]
Length=280

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTG  101



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +1

Query  382  SNGE-NRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+GE N+TIWIGDL  WMDE YL +CF+ TG
Sbjct  75   SSGEDNKTIWIGDLQQWMDEGYLHACFSQTG  105



>ref|XP_011092727.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Sesamum indicum]
Length=387

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +1

Query  382  SNGE-NRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+GE N+TIWIGDL  WMDE YL +CF+ TG
Sbjct  75   SSGEDNKTIWIGDLQQWMDEGYLHACFSQTG  105



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  85   DNKTIWIGDLQQWMDESYLHSCFSQAG  111



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  102  ENKTIWVGDLQYWMDENYLHSCFGPSG  128



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  84   DNKTIWIGDLQQWMDESYLHSCFSQAG  110



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  65   EVRTLWIGDLQYWMDENYLYTCFAHTG  91



>ref|XP_006845940.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
 gb|ERN07615.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
Length=291

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ EN+++W+GDL  WMDE+YL SCF  TG
Sbjct  74   SSEENKSLWVGDLQYWMDENYLNSCFGHTG  103



>ref|XP_003580589.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Brachypodium distachyon]
Length=426

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE Y+  CFASTG
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTG  112



>ref|XP_006594429.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Glycine 
max]
Length=314

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTG  90



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            EN+TIW+GDL  WMDE+YL SCF  +G
Sbjct  96   ENKTIWVGDLQYWMDENYLHSCFGPSG  122



>gb|AFW58430.1| nucleic acid binding protein, partial [Zea mays]
Length=241

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL +CF  +G
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSG  123



>ref|XP_002285479.1| PREDICTED: polyadenylate-binding protein RBP47B' [Vitis vinifera]
Length=447

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W+DE+YL SCFA TG
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTG  65



>ref|XP_006417333.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
 gb|ESQ35686.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
Length=397

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE++L SCFA TG
Sbjct  61   EIRTLWIGDLQFWMDENFLYSCFAHTG  87



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAG  108



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  136  DNKTIWIGDLQQWMDESYLHSCFSQAG  162



>ref|XP_010240455.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Brachypodium distachyon]
Length=423

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE Y+  CFASTG
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTG  112



>ref|XP_011037673.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X4 [Populus 
euphratica]
Length=273

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTG  101



>emb|CBI16387.3| unnamed protein product [Vitis vinifera]
Length=445

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W+DE+YL SCFA TG
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTG  65



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAG  108



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S+ +N+TIWIGDL  WMDE YL SCF+  G
Sbjct  71   SSEDNKTIWIGDLQQWMDESYLHSCFSHAG  100



>gb|KEH36838.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=271

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  382  SNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            S  E RT+WIGDL  WMDE+YL +CF +TG
Sbjct  55   SADEVRTLWIGDLQYWMDENYLYTCFGNTG  84



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL +CF  +G
Sbjct  40   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSG  72



>ref|XP_010930147.1| PREDICTED: polyadenylate-binding protein RBP45 [Elaeis guineensis]
Length=418

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL  CF STG
Sbjct  81   EIRTLWIGDLQYWMDENYLFGCFVSTG  107



>gb|KDO61276.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=394

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W DE+YL SCFA TG
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTG  48



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL +CF  +G
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSG  123



>ref|XP_002513488.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF48891.1| nuclear acid binding protein, putative [Ricinus communis]
Length=412

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W+DE+YL SCFA TG
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTG  46



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTG  101



>ref|XP_004972674.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Setaria italica]
Length=446

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+  CFA+TG
Sbjct  107  EVRTLWIGDLQYWMDENYIYGCFAATG  133



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +1

Query  379  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            G NG  EN+TIW+GDL  WMDE+YL +CF  +G
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSG  123



>gb|KDP22083.1| hypothetical protein JCGZ_25914 [Jatropha curcas]
Length=416

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W+DE+YL SCFA TG
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTG  46



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  87   EVRTLWIGDLQYWMDENYINSCFAHTG  113



>ref|XP_011037671.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Populus 
euphratica]
Length=321

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTG  101



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  61   EVRTLWIGDLQYWMDENYLYTCFAHTG  87



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTG  90



>gb|KDO61275.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=423

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W DE+YL SCFA TG
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTG  48



>ref|XP_006283830.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
 gb|EOA16728.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
Length=413

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  379  GSNGENRTIWIGDLHNWMDEDYLRSCFASTG  471
            GS GE R++WIGDL  WMDE+YL + FA TG
Sbjct  71   GSAGEIRSLWIGDLQPWMDENYLMNIFAVTG  101



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E +TIW+GDLH+WMDE +L +CFA TG
Sbjct  102  EIKTIWLGDLHHWMDETFLHNCFAHTG  128



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  10   EVRTLWIGDLQYWMDENYLYTCFAHTG  36



>ref|XP_004972673.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Setaria italica]
Length=456

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+  CFA+TG
Sbjct  107  EVRTLWIGDLQYWMDENYIYGCFAATG  133



>ref|XP_006446110.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
 gb|ESR59350.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
Length=385

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  W DE+YL SCFA TG
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTG  48



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+Y+ SCFA TG
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTG  101



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE+YL +CFA TG
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFAHTG  89



>ref|XP_009118182.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Brassica 
rapa]
Length=388

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  391  ENRTIWIGDLHNWMDEDYLRSCFASTG  471
            E RT+WIGDL  WMDE++L SCFA TG
Sbjct  58   EIRTLWIGDLQFWMDENFLYSCFAHTG  84



Lambda      K        H        a         alpha
   0.315    0.130    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780