BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027C08

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623182.1|  PREDICTED: 14-3-3-like protein 16R                 246   1e-78   Nicotiana tomentosiformis
emb|CAC84142.3|  14-3-3 protein                                         246   1e-78   Nicotiana tabacum [American tobacco]
ref|NP_001234097.1|  14-3-3 protein 6                                   246   2e-78   Solanum lycopersicum
ref|NP_001275062.1|  14-3-3-like protein 16R                            246   2e-78   Solanum tuberosum [potatoes]
gb|AGJ98234.1|  PIB67 14-3-3 protein                                    242   5e-77   Petunia x hybrida [garden petunia]
gb|AAF68842.1|  14-3-3-like protein                                     235   1e-75   Capsicum annuum
ref|XP_009589383.1|  PREDICTED: 14-3-3-like protein F                   236   1e-74   Nicotiana tomentosiformis
ref|XP_009609727.1|  PREDICTED: 14-3-3-like protein A                   234   5e-74   Nicotiana tomentosiformis
ref|XP_009786458.1|  PREDICTED: 14-3-3-like protein A                   234   7e-74   Nicotiana sylvestris
sp|P93342.1|1433A_TOBAC  RecName: Full=14-3-3-like protein A            234   9e-74   Nicotiana tabacum [American tobacco]
dbj|BAD12178.1|  14-3-3 f-1 protein                                     233   2e-73   Nicotiana tabacum [American tobacco]
gb|KDO81027.1|  hypothetical protein CISIN_1g024620mg                   231   3e-73   Citrus sinensis [apfelsine]
ref|NP_001274876.1|  14-3-3-like protein RA215                          232   3e-73   Solanum tuberosum [potatoes]
emb|CDP01506.1|  unnamed protein product                                232   3e-73   Coffea canephora [robusta coffee]
ref|XP_006472571.1|  PREDICTED: 14-3-3-like protein-like                233   3e-73   Citrus sinensis [apfelsine]
gb|ABA81882.1|  14-3-3 protein-like                                     232   4e-73   Solanum tuberosum [potatoes]
gb|AAS78777.1|  14-3-3 protein                                          232   4e-73   Solanum chacoense
gb|AAR98782.1|  14-3-3 protein isoform 20R                              232   4e-73   Solanum tuberosum [potatoes]
gb|KDO81026.1|  hypothetical protein CISIN_1g024620mg                   232   6e-73   Citrus sinensis [apfelsine]
ref|XP_009799312.1|  PREDICTED: 14-3-3-like protein F                   231   1e-72   Nicotiana sylvestris
gb|KJB58994.1|  hypothetical protein B456_009G234600                    231   2e-72   Gossypium raimondii
gb|ABY65001.1|  14-3-3b protein                                         231   2e-72   Gossypium hirsutum [American cotton]
gb|KHG20751.1|  Uncharacterized protein F383_04220                      231   2e-72   Gossypium arboreum [tree cotton]
gb|ACD69679.1|  14-3-3                                                  230   3e-72   Mangifera indica
ref|XP_010098629.1|  14-3-3-like protein                                229   4e-72   Morus notabilis
ref|XP_011097537.1|  PREDICTED: 14-3-3-like protein 16R                 229   7e-72   Sesamum indicum [beniseed]
gb|ABK42078.1|  14-3-3 protein                                          226   7e-72   Capsicum annuum
ref|XP_006433941.1|  hypothetical protein CICLE_v10003615mg             233   1e-71   
gb|KCW66571.1|  hypothetical protein EUGRSUZ_F00370                     231   1e-71   Eucalyptus grandis [rose gum]
gb|AIU34467.1|  putative 14-3-3 protein                                 228   1e-71   Taraxacum brevicorniculatum
gb|AIJ04691.1|  14-3-3b                                                 228   2e-71   Morus alba var. atropurpurea
ref|XP_010060042.1|  PREDICTED: 14-3-3-like protein                     228   2e-71   Eucalyptus grandis [rose gum]
ref|XP_002262802.1|  PREDICTED: 14-3-3-like protein                     228   2e-71   Vitis vinifera
gb|EPS60562.1|  14-3-3 h-1 protein                                      228   3e-71   Genlisea aurea
gb|ABE01401.1|  14-3-3 protein                                          228   3e-71   Camellia sinensis [black tea]
ref|XP_007136271.1|  hypothetical protein PHAVU_009G032500g             228   3e-71   Phaseolus vulgaris [French bean]
gb|EYU30984.1|  hypothetical protein MIMGU_mgv1a012292mg                227   4e-71   Erythranthe guttata [common monkey flower]
ref|XP_003526571.1|  PREDICTED: 14-3-3-like protein-like                227   5e-71   
ref|NP_001238389.1|  14-3-3 protein SGF14h                              227   5e-71   Glycine max [soybeans]
sp|P93210.1|14335_SOLLC  RecName: Full=14-3-3 protein 5                 226   6e-71   Solanum lycopersicum
ref|NP_001267852.1|  14-3-3 protein                                     226   7e-71   Vitis vinifera
gb|EYU34581.1|  hypothetical protein MIMGU_mgv1a012286mg                226   7e-71   Erythranthe guttata [common monkey flower]
ref|NP_001275270.1|  14-3-3-like protein C-like                         226   8e-71   Solanum tuberosum [potatoes]
ref|XP_007018723.1|  General regulatory factor 2, OMEGA                 226   1e-70   Theobroma cacao [chocolate]
ref|XP_003602824.1|  14-3-3-like protein                                224   1e-70   
sp|Q43643.1|14332_SOLTU  RecName: Full=14-3-3-like protein RA215        226   1e-70   Solanum tuberosum [potatoes]
ref|XP_009632004.1|  PREDICTED: 14-3-3-like protein B                   225   2e-70   Nicotiana tomentosiformis
ref|XP_009777542.1|  PREDICTED: 14-3-3-like protein B                   225   2e-70   Nicotiana sylvestris
dbj|BAB47119.1|  14-3-3 protein                                         225   2e-70   Vigna angularis [azuki bean]
ref|XP_008386122.1|  PREDICTED: 14-3-3-like protein                     226   2e-70   Malus domestica [apple tree]
sp|P46266.1|1433_PEA  RecName: Full=14-3-3-like protein                 225   2e-70   Pisum sativum [garden pea]
gb|ACQ45021.1|  14-3-3                                                  225   2e-70   Cicer arietinum [garbanzo]
gb|AES73074.2|  general regulatory factor 2                             225   3e-70   Medicago truncatula
ref|XP_004501696.1|  PREDICTED: 14-3-3-like protein-like                225   3e-70   
gb|AFK34151.1|  unknown                                                 225   3e-70   Medicago truncatula
ref|XP_011074203.1|  PREDICTED: 14-3-3-like protein B                   225   3e-70   Sesamum indicum [beniseed]
ref|XP_002307363.1|  14-3-3 protein 32kDa endonuclease                  225   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011009578.1|  PREDICTED: 14-3-3-like protein isoform X2          225   4e-70   Populus euphratica
ref|XP_011016779.1|  PREDICTED: 14-3-3-like protein                     225   4e-70   Populus euphratica
sp|O65352.1|1433_HELAN  RecName: Full=14-3-3-like protein               224   4e-70   Helianthus annuus
ref|XP_008444853.1|  PREDICTED: 14-3-3-like protein                     224   5e-70   Cucumis melo [Oriental melon]
gb|KDP41413.1|  hypothetical protein JCGZ_15820                         224   5e-70   Jatropha curcas
ref|XP_004152627.1|  PREDICTED: 14-3-3-like protein-like                224   5e-70   Cucumis sativus [cucumbers]
ref|XP_011098686.1|  PREDICTED: 14-3-3-like protein C                   224   6e-70   Sesamum indicum [beniseed]
ref|XP_009373053.1|  PREDICTED: 14-3-3-like protein                     226   6e-70   Pyrus x bretschneideri [bai li]
ref|XP_010272995.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...    225   7e-70   
gb|KJB64237.1|  hypothetical protein B456_010G038600                    224   7e-70   Gossypium raimondii
dbj|BAD12554.1|  14-3-3 f-2 protein                                     223   7e-70   Nicotiana tabacum [American tobacco]
ref|XP_010676024.1|  PREDICTED: 14-3-3-like protein                     224   9e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_565176.1|  14-3-3-like protein GF14 omega                        224   9e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301071.1|  14-3-3 protein 32kDa endonuclease                  224   1e-69   Populus trichocarpa [western balsam poplar]
gb|AAA96253.1|  GF14omega isoform                                       223   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAT35546.1|  14-3-3 protein                                          223   1e-69   Tropaeolum majus
pdb|2O98|A  Chain A, Structure Of The 14-3-3  H+-Atpase Plant Com...    223   1e-69   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CAB42546.2|  14-3-3-like protein                                    223   1e-69   Pisum sativum [garden pea]
ref|XP_009619695.1|  PREDICTED: 14-3-3-like protein C                   223   1e-69   Nicotiana tomentosiformis
ref|XP_009757667.1|  PREDICTED: 14-3-3-like protein C                   223   1e-69   Nicotiana sylvestris
pdb|3M50|A  Chain A, Structure Of The 14-3-3/pma2 Complex Stabili...    223   2e-69   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KHG05238.1|  Uncharacterized protein F383_30797                      223   2e-69   Gossypium arboreum [tree cotton]
ref|XP_011009577.1|  PREDICTED: 14-3-3-like protein isoform X1          223   2e-69   Populus euphratica
sp|P29307.2|1433_OENEH  RecName: Full=14-3-3-like protein               223   2e-69   Oenothera elata subsp. hookeri [Hooker's evening primrose]
dbj|BAD93604.1|  hypothetical protein                                   221   2e-69   Cucumis melo [Oriental melon]
ref|XP_010917299.1|  PREDICTED: 14-3-3-like protein                     223   2e-69   Elaeis guineensis
ref|XP_002513956.1|  14-3-3 protein, putative                           223   2e-69   Ricinus communis
ref|XP_008346360.1|  PREDICTED: 14-3-3-like protein                     223   2e-69   
ref|XP_009128290.1|  PREDICTED: 14-3-3-like protein GF14 omega          223   3e-69   Brassica rapa
gb|AAD27823.2|  14-3-3 protein                                          222   3e-69   Populus tremula x Populus alba [gray poplar]
gb|EYU36484.1|  hypothetical protein MIMGU_mgv1a011964mg                222   4e-69   Erythranthe guttata [common monkey flower]
gb|AGJ98227.1|  PIB01 14-3-3 protein                                    218   4e-69   Petunia x hybrida [garden petunia]
gb|AGC13184.1|  14-3-3 protein                                          222   4e-69   Spinacia oleracea
ref|XP_003602823.1|  14-3-3-like protein                                223   5e-69   
ref|NP_001275217.1|  14-3-3 protein 2-like                              221   6e-69   Solanum tuberosum [potatoes]
ref|XP_010543865.1|  PREDICTED: 14-3-3-like protein GF14 omega          221   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_004252529.1|  PREDICTED: 14-3-3 protein 2                        221   7e-69   
ref|XP_010916166.1|  PREDICTED: 14-3-3-like protein                     221   9e-69   Elaeis guineensis
ref|XP_010521176.1|  PREDICTED: 14-3-3-like protein GF14 omega          221   9e-69   Tarenaya hassleriana [spider flower]
gb|KDP40925.1|  hypothetical protein JCGZ_24924                         221   1e-68   Jatropha curcas
ref|XP_004299669.1|  PREDICTED: 14-3-3-like protein                     221   1e-68   Fragaria vesca subsp. vesca
ref|XP_006302543.1|  hypothetical protein CARUB_v10020644mg             223   1e-68   
ref|XP_007223394.1|  hypothetical protein PRUPE_ppa010148mg             221   1e-68   Prunus persica
ref|XP_002887733.1|  GF14 omega                                         221   1e-68   
gb|KFK42215.1|  hypothetical protein AALP_AA2G226400                    221   1e-68   Arabis alpina [alpine rockcress]
ref|XP_003544808.1|  PREDICTED: 14-3-3-like protein-like                221   2e-68   
ref|XP_010428953.1|  PREDICTED: 14-3-3-like protein GF14 omega          220   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007141044.1|  hypothetical protein PHAVU_008G162500g             220   2e-68   Phaseolus vulgaris [French bean]
ref|NP_001239690.1|  uncharacterized protein LOC100798989               220   2e-68   Glycine max [soybeans]
ref|XP_006423811.1|  hypothetical protein CICLE_v10029087mg             220   2e-68   Citrus clementina [clementine]
ref|XP_010535331.1|  PREDICTED: 14-3-3-like protein GF14 omega          220   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_009104576.1|  PREDICTED: 14-3-3-like protein GF14 omega          220   2e-68   Brassica rapa
emb|CDX79255.1|  BnaC06g20480D                                          220   2e-68   
ref|XP_008219335.1|  PREDICTED: 14-3-3-like protein                     220   2e-68   Prunus mume [ume]
gb|AFK35595.1|  unknown                                                 220   2e-68   Lotus japonicus
gb|AGV54291.1|  14-3-3 protein                                          220   2e-68   Phaseolus vulgaris [French bean]
gb|AAK26634.1|AF342780_1  GF14 omega                                    220   3e-68   Brassica napus [oilseed rape]
ref|XP_008775117.1|  PREDICTED: 14-3-3-like protein                     220   3e-68   
ref|XP_007200586.1|  hypothetical protein PRUPE_ppa010141mg             220   3e-68   Prunus persica
ref|XP_006389998.1|  hypothetical protein EUTSA_v10019018mg             219   4e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006853053.1|  hypothetical protein AMTR_s00038p00055100          219   4e-68   Amborella trichopoda
ref|XP_009404035.1|  PREDICTED: 14-3-3 protein 6                        219   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388642.1|  PREDICTED: 14-3-3-like protein                     219   6e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADK93080.1|  14-3-3g protein                                         219   6e-68   Gossypium hirsutum [American cotton]
gb|EPS72907.1|  14-3-3 a-1 protein                                      219   6e-68   Genlisea aurea
gb|EPS73301.1|  14-3-3 h-1 protein                                      219   6e-68   Genlisea aurea
ref|XP_004234565.1|  PREDICTED: 14-3-3-like protein                     219   6e-68   Solanum lycopersicum
ref|XP_004136278.1|  PREDICTED: 14-3-3-like protein-like                219   7e-68   Cucumis sativus [cucumbers]
gb|ABQ95992.1|  14-3-3-like protein                                     219   8e-68   Cicer arietinum [garbanzo]
ref|XP_008466219.1|  PREDICTED: 14-3-3-like protein                     219   8e-68   Cucumis melo [Oriental melon]
ref|XP_010472047.1|  PREDICTED: 14-3-3-like protein GF14 omega          219   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010680999.1|  PREDICTED: 14-3-3 protein 2-like isoform X2        219   8e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680998.1|  PREDICTED: 14-3-3 protein 2-like isoform X1        219   9e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010025879.1|  PREDICTED: 14-3-3-like protein                     219   9e-68   Eucalyptus grandis [rose gum]
ref|XP_009419276.1|  PREDICTED: 14-3-3-like protein GF14-C              218   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782168.1|  PREDICTED: 14-3-3 protein 6-like                   218   1e-67   Phoenix dactylifera
ref|XP_009387444.1|  PREDICTED: 14-3-3-like protein                     218   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416813.1|  PREDICTED: 14-3-3-like protein GF14 omega          218   1e-67   Camelina sativa [gold-of-pleasure]
gb|AEA03664.1|  14-3-3 protein 3                                        218   1e-67   Hevea brasiliensis [jebe]
dbj|BAB68528.1|  14-3-3 protein                                         216   1e-67   Nicotiana tabacum [American tobacco]
ref|XP_010939692.1|  PREDICTED: 14-3-3 protein 6-like                   218   1e-67   Elaeis guineensis
gb|KDO58965.1|  hypothetical protein CISIN_1g024714mg                   217   1e-67   Citrus sinensis [apfelsine]
ref|NP_001234107.1|  14-3-3 family protein                              218   2e-67   
ref|XP_010534083.1|  PREDICTED: 14-3-3-like protein GF14 omega          218   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_010530165.1|  PREDICTED: 14-3-3-like protein GF14 chi            218   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_009350360.1|  PREDICTED: 14-3-3-like protein 16R                 218   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_006430798.1|  hypothetical protein CICLE_v10012495mg             218   3e-67   Citrus clementina [clementine]
ref|XP_009114721.1|  PREDICTED: 14-3-3-like protein GF14 phi            218   3e-67   Brassica rapa
ref|XP_006397430.1|  hypothetical protein EUTSA_v10001833mg             218   3e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009357045.1|  PREDICTED: 14-3-3-like protein A                   217   3e-67   Pyrus x bretschneideri [bai li]
ref|NP_001280837.1|  14-3-3-like protein A                              217   3e-67   Malus domestica [apple tree]
sp|P93209.1|14333_SOLLC  RecName: Full=14-3-3 protein 3; AltName:...    217   4e-67   Solanum lycopersicum
ref|XP_002891161.1|  At1g35160/T32G9_30                                 217   4e-67   Arabidopsis lyrata subsp. lyrata
emb|CDX91996.1|  BnaC03g32980D                                          217   4e-67   
pdb|4DX0|A  Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZ...    216   4e-67   Nicotiana tabacum [American tobacco]
emb|CDY28698.1|  BnaCnng05840D                                          217   4e-67   Brassica napus [oilseed rape]
ref|XP_009147332.1|  PREDICTED: 14-3-3-like protein GF14 nu             217   4e-67   Brassica rapa
ref|XP_008804781.1|  PREDICTED: 14-3-3 protein 6                        217   4e-67   Phoenix dactylifera
gb|KJB10444.1|  hypothetical protein B456_001G201400                    217   4e-67   Gossypium raimondii
ref|NP_564453.1|  14-3-3-like protein GF14 phi                          217   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362235.1|  PREDICTED: 14-3-3-like protein A                   217   4e-67   
gb|AAK63949.1|  At1g35160/T32G9_30                                      217   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011011192.1|  PREDICTED: 14-3-3-like protein A                   217   5e-67   Populus euphratica
ref|XP_010265205.1|  PREDICTED: 14-3-3-like protein                     217   5e-67   Nelumbo nucifera [Indian lotus]
sp|O49997.1|1433E_TOBAC  RecName: Full=14-3-3-like protein E            217   6e-67   Nicotiana tabacum [American tobacco]
ref|NP_001275262.1|  14-3-3-like protein                                216   6e-67   Solanum tuberosum [potatoes]
ref|XP_009403466.1|  PREDICTED: 14-3-3-like protein                     216   6e-67   Musa acuminata subsp. malaccensis [pisang utan]
sp|P93259.1|1433_MESCR  RecName: Full=14-3-3-like protein; AltNam...    216   6e-67   Mesembryanthemum crystallinum
gb|KJB12045.1|  hypothetical protein B456_002G141000                    217   7e-67   Gossypium raimondii
ref|XP_010421819.1|  PREDICTED: 14-3-3-like protein GF14 chi            216   7e-67   Camelina sativa [gold-of-pleasure]
gb|ADP00759.1|  14-3-3 protein                                          216   7e-67   Litchi chinensis [litchi]
gb|ADO95306.1|  14-3-3-like protein GF14 Omega                          216   7e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009388227.1|  PREDICTED: 14-3-3-like protein                     216   7e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002965976.1|  hypothetical protein SELMODRAFT_439395             216   7e-67   Selaginella moellendorffii
ref|XP_010455312.1|  PREDICTED: 14-3-3-like protein GF14 chi            216   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_003615160.1|  14-3-3 protein                                     216   8e-67   Medicago truncatula
ref|XP_008230392.1|  PREDICTED: 14-3-3-like protein A                   216   8e-67   Prunus mume [ume]
ref|XP_009106540.1|  PREDICTED: 14-3-3-like protein GF14 omega          216   9e-67   Brassica rapa
gb|ACK76233.1|  14-3-3 protein                                          216   9e-67   Dimocarpus longan [longan]
ref|XP_009615235.1|  PREDICTED: 14-3-3 protein 4-like                   216   9e-67   Nicotiana tomentosiformis
gb|KHG19539.1|  Uncharacterized protein F383_05852                      216   9e-67   Gossypium arboreum [tree cotton]
ref|XP_009800018.1|  PREDICTED: 14-3-3 protein 4-like                   216   9e-67   Nicotiana sylvestris
ref|NP_001185138.1|  14-3-3-like protein GF14 phi                       217   9e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263205.1|  PREDICTED: 14-3-3-like protein                     216   1e-66   Nelumbo nucifera [Indian lotus]
gb|KJB77545.1|  hypothetical protein B456_012G142900                    214   1e-66   Gossypium raimondii
ref|XP_008790917.1|  PREDICTED: 14-3-3 protein 6                        216   1e-66   Phoenix dactylifera
gb|KFK24544.1|  hypothetical protein AALP_AAs41798U000400               216   1e-66   Arabis alpina [alpine rockcress]
ref|XP_008387340.1|  PREDICTED: 14-3-3-like protein 16R                 216   1e-66   
ref|XP_010496601.1|  PREDICTED: 14-3-3-like protein GF14 phi            216   1e-66   
emb|CDX88436.1|  BnaC06g38800D                                          216   1e-66   
ref|XP_004304139.1|  PREDICTED: 14-3-3-like protein A                   216   1e-66   Fragaria vesca subsp. vesca
ref|XP_010436066.1|  PREDICTED: 14-3-3-like protein GF14 chi            216   1e-66   Camelina sativa [gold-of-pleasure]
gb|AHB33318.1|  14-3-3a protein                                         216   1e-66   Pyrus pyrifolia [sha li]
ref|XP_008805904.1|  PREDICTED: 14-3-3 protein 6-like                   215   1e-66   Phoenix dactylifera
ref|XP_009134679.1|  PREDICTED: 14-3-3-like protein GF14 nu             215   2e-66   Brassica rapa
ref|NP_001265880.1|  14-3-3-like protein A-like                         215   2e-66   Cicer arietinum [garbanzo]
gb|ADP24188.1|  14-3-3-like protein                                     215   2e-66   Galega orientalis
ref|XP_002874496.1|  hypothetical protein ARALYDRAFT_911048             216   2e-66   Arabidopsis lyrata subsp. lyrata
gb|AGZ13503.1|  14-3-3 protein                                          215   2e-66   Lilium regale
ref|XP_009345790.1|  PREDICTED: 14-3-3-like protein 16R                 215   2e-66   Pyrus x bretschneideri [bai li]
gb|ADD79961.1|  14-3-3 family protein                                   215   2e-66   Dimocarpus longan [longan]
ref|XP_006288456.1|  hypothetical protein CARUB_v10001717mg             216   2e-66   Capsella rubella
gb|KDP32938.1|  hypothetical protein JCGZ_12969                         215   2e-66   Jatropha curcas
gb|ABY65004.1|  14-3-3e protein                                         215   2e-66   Gossypium hirsutum [American cotton]
sp|P42653.1|1433A_VICFA  RecName: Full=14-3-3-like protein A; Alt...    215   2e-66   Vicia faba [broad bean]
gb|ABO15466.1|  14-3-3 protein Lil 1433-1                               215   2e-66   Lilium longiflorum [Easter lily]
ref|XP_009375314.1|  PREDICTED: 14-3-3-like protein 16R                 215   2e-66   Pyrus x bretschneideri [bai li]
gb|KJB12046.1|  hypothetical protein B456_002G141000                    216   2e-66   Gossypium raimondii
ref|XP_007014931.1|  General regulatory factor 7, NU                    216   2e-66   
emb|CAB42547.1|  14-3-3-like protein                                    215   2e-66   Pisum sativum [garden pea]
ref|XP_011099565.1|  PREDICTED: 14-3-3-like protein                     215   2e-66   Sesamum indicum [beniseed]
ref|XP_004489124.1|  PREDICTED: 14-3-3-like protein A-like              215   2e-66   Cicer arietinum [garbanzo]
gb|KHG29578.1|  Uncharacterized protein F383_10830                      215   2e-66   Gossypium arboreum [tree cotton]
gb|KJB79630.1|  hypothetical protein B456_013G059800                    215   2e-66   Gossypium raimondii
gb|AAC04811.1|  GF14 protein                                            215   2e-66   Fritillaria agrestis
emb|CDX73313.1|  BnaC05g27930D                                          215   2e-66   
gb|ACN39847.1|  unknown                                                 215   3e-66   Picea sitchensis
ref|NP_001235653.1|  14-3-3-like protein A                              215   3e-66   Glycine max [soybeans]
gb|ABY65003.1|  14-3-3d protein                                         215   3e-66   Gossypium hirsutum [American cotton]
gb|ABY65002.1|  14-3-3c protein                                         215   3e-66   Gossypium hirsutum [American cotton]
ref|XP_008801147.1|  PREDICTED: 14-3-3-like protein                     215   3e-66   Phoenix dactylifera
gb|KHN24947.1|  14-3-3-like protein A                                   215   3e-66   Glycine soja [wild soybean]
gb|KJB79631.1|  hypothetical protein B456_013G059800                    214   3e-66   Gossypium raimondii
emb|CDX87455.1|  BnaA07g34180D                                          216   3e-66   
gb|KJB32075.1|  hypothetical protein B456_005G222600                    214   3e-66   Gossypium raimondii
gb|AGJ98232.1|  PIB41 14-3-3 protein                                    214   3e-66   Petunia x hybrida [garden petunia]
ref|XP_010558549.1|  PREDICTED: 14-3-3-like protein                     215   4e-66   Tarenaya hassleriana [spider flower]
ref|NP_001051051.1|  Os03g0710800                                       214   4e-66   
ref|XP_006303273.1|  hypothetical protein CARUB_v10010011mg             215   4e-66   Capsella rubella
sp|Q9SP07.1|1433_LILLO  RecName: Full=14-3-3-like protein               214   4e-66   Lilium longiflorum [Easter lily]
emb|CDX74252.1|  BnaA03g27950D                                          214   4e-66   
gb|ACU23290.1|  unknown                                                 214   4e-66   Glycine max [soybeans]
ref|NP_567344.1|  14-3-3-like protein GF14 chi                          214   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19485.1|  unknown                                                 214   4e-66   Glycine max [soybeans]
gb|AAA96254.1|  GF14chi isoform                                         214   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650484.1|  PREDICTED: 14-3-3-like protein GF14-F-like         214   4e-66   Oryza brachyantha
ref|XP_009381498.1|  PREDICTED: 14-3-3 protein 6-like                   214   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32076.1|  hypothetical protein B456_005G222600                    213   5e-66   Gossypium raimondii
gb|ABD96912.1|  hypothetical protein                                    214   5e-66   Tarenaya spinosa
ref|XP_008800764.1|  PREDICTED: 14-3-3-like protein                     214   5e-66   Phoenix dactylifera
ref|XP_008778192.1|  PREDICTED: 14-3-3 protein 6-like                   214   5e-66   Phoenix dactylifera
ref|XP_008781204.1|  PREDICTED: 14-3-3-like protein                     214   5e-66   Phoenix dactylifera
gb|AAD27827.2|  14-3-3 protein                                          214   6e-66   Picea glauca
ref|XP_010932603.1|  PREDICTED: 14-3-3-like protein isoform X2          212   6e-66   Elaeis guineensis
ref|XP_010937379.1|  PREDICTED: 14-3-3-like protein B                   214   6e-66   Elaeis guineensis
gb|KHG29579.1|  Uncharacterized protein F383_10830                      214   6e-66   Gossypium arboreum [tree cotton]
ref|XP_010908756.1|  PREDICTED: 14-3-3-like protein                     214   6e-66   Elaeis guineensis
ref|XP_006384209.1|  hypothetical protein POPTR_0004s10120g             212   6e-66   
ref|XP_006397240.1|  hypothetical protein EUTSA_v10028882mg             214   7e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010461289.1|  PREDICTED: 14-3-3-like protein GF14 phi            214   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006346922.1|  PREDICTED: 14-3-3 protein 4-like                   214   7e-66   Solanum tuberosum [potatoes]
ref|XP_004137196.1|  PREDICTED: 14-3-3-like protein-like                214   7e-66   Cucumis sativus [cucumbers]
gb|AIJ04690.1|  14-3-3a                                                 214   8e-66   Morus alba var. atropurpurea
ref|XP_008379530.1|  PREDICTED: 14-3-3-like protein A                   214   8e-66   
ref|XP_007139133.1|  hypothetical protein PHAVU_008G004300g             213   8e-66   Phaseolus vulgaris [French bean]
gb|ACH63229.1|  14-3-3 protein                                          214   8e-66   Rheum australe [Himalayan rhubarb]
ref|XP_010932600.1|  PREDICTED: 14-3-3-like protein isoform X1          212   8e-66   Elaeis guineensis
ref|NP_001234007.1|  14-3-3 protein 4                                   214   8e-66   Solanum lycopersicum
ref|XP_010501783.1|  PREDICTED: 14-3-3-like protein GF14 phi            214   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010692757.1|  PREDICTED: 14-3-3-like protein                     214   9e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK21293.1|  unknown                                                 213   9e-66   Picea sitchensis
gb|AGV54353.1|  14-3-3-like protein A                                   213   9e-66   Phaseolus vulgaris [French bean]
ref|XP_001765124.1|  predicted protein                                  213   1e-65   
ref|NP_566174.1|  14-3-3-like protein GF14 nu                           213   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553922.1|  PREDICTED: 14-3-3-like protein GF14 psi            213   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_009381101.1|  PREDICTED: 14-3-3-like protein                     213   1e-65   
ref|XP_002884324.1|  hypothetical protein ARALYDRAFT_477486             213   1e-65   
ref|XP_009397483.1|  PREDICTED: 14-3-3-like protein                     213   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA44259.1|  14-3-3 protein homologue                               213   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA03711.1|  brain specific protein                                 213   2e-65   Oryza sativa [red rice]
ref|XP_003560774.1|  PREDICTED: 14-3-3-like protein A                   213   2e-65   Brachypodium distachyon [annual false brome]
gb|AAY67798.1|  14-3-3 protein                                          213   2e-65   Manihot esculenta [manioc]
ref|XP_009617450.1|  PREDICTED: 14-3-3 protein 4                        213   2e-65   Nicotiana tomentosiformis
ref|XP_010525152.1|  PREDICTED: 14-3-3-like protein                     213   2e-65   Tarenaya hassleriana [spider flower]
gb|AFK37964.1|  unknown                                                 213   2e-65   Medicago truncatula
sp|P29305.1|1433A_HORVU  RecName: Full=14-3-3-like protein A; Sho...    213   2e-65   Hordeum vulgare [barley]
gb|KHG14081.1|  Uncharacterized protein F383_17151                      213   2e-65   Gossypium arboreum [tree cotton]
dbj|BAD12182.1|  14-3-3 i-1 protein                                     212   2e-65   Nicotiana tabacum [American tobacco]
gb|KCW52038.1|  hypothetical protein EUGRSUZ_J01477                     211   3e-65   Eucalyptus grandis [rose gum]
gb|KJB10359.1|  hypothetical protein B456_001G197200                    211   3e-65   Gossypium raimondii
ref|XP_009770957.1|  PREDICTED: 14-3-3 protein 4                        212   3e-65   Nicotiana sylvestris
gb|AAR89812.1|  14-3-3 protein                                          212   3e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010926139.1|  PREDICTED: 14-3-3-like protein                     212   3e-65   
ref|NP_001154216.1|  14-3-3-like protein GF14 chi                       214   3e-65   
sp|Q96450.1|1433A_SOYBN  RecName: Full=14-3-3-like protein A; Alt...    212   3e-65   
gb|AEA03663.1|  14-3-3 protein 2                                        212   4e-65   
gb|AGV54551.1|  14-3-3 family protein                                   212   4e-65   
gb|KJB10360.1|  hypothetical protein B456_001G197200                    210   4e-65   
ref|XP_009408999.1|  PREDICTED: 14-3-3-like protein GF14-C              212   5e-65   
gb|KJB10358.1|  hypothetical protein B456_001G197200                    211   5e-65   
gb|AAF76226.1|AF272572_1  14-3-3 protein                                211   5e-65   
ref|XP_010032624.1|  PREDICTED: 14-3-3-like protein A                   212   5e-65   
gb|EMT28052.1|  14-3-3-like protein A                                   213   5e-65   
ref|XP_001771385.1|  predicted protein                                  211   6e-65   
ref|XP_002445779.1|  hypothetical protein SORBIDRAFT_07g025680          211   7e-65   
ref|XP_001765070.1|  predicted protein                                  211   7e-65   
ref|XP_010498313.1|  PREDICTED: 14-3-3-like protein GF14 nu             211   7e-65   
emb|CAB65693.1|  tft3 14-3-3 protein                                    210   7e-65   
ref|XP_009380873.1|  PREDICTED: 14-3-3 protein 6-like                   211   8e-65   
gb|ADO95304.1|  14-3-3-like protein GF14 Chi                            211   9e-65   
ref|XP_009401429.1|  PREDICTED: 14-3-3-like protein                     211   1e-64   
ref|XP_007042905.1|  General regulatory factor 2, OMEGA                 211   1e-64   
ref|XP_004974054.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    210   1e-64   
gb|KJB10357.1|  hypothetical protein B456_001G197200                    211   1e-64   
ref|XP_011021224.1|  PREDICTED: 14-3-3-like protein                     211   1e-64   
sp|P42652.1|14334_SOLLC  RecName: Full=14-3-3 protein 4; AltName:...    210   1e-64   
gb|AEG67284.1|  14-3-3 protein                                          210   2e-64   
ref|XP_006408411.1|  hypothetical protein EUTSA_v10021346mg             210   2e-64   
gb|AFK46913.1|  unknown                                                 210   2e-64   
gb|AEX00343.1|  14-3-3 protein b                                        210   2e-64   
gb|KJB12307.1|  hypothetical protein B456_002G012500                    208   2e-64   
ref|XP_010492477.1|  PREDICTED: 14-3-3-like protein GF14 upsilon        210   2e-64   
ref|XP_004974053.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    210   2e-64   
ref|XP_009145139.1|  PREDICTED: 14-3-3-like protein GF14 phi            210   2e-64   
ref|XP_006659421.1|  PREDICTED: 14-3-3-like protein GF14-C-like         210   2e-64   
gb|AEX00342.1|  14-3-3 protein a                                        210   2e-64   
gb|EYU34391.1|  hypothetical protein MIMGU_mgv1a012246mg                210   2e-64   
pdb|3AXY|C  Chain C, Structure Of Florigen Activation Complex Con...    209   2e-64   
gb|AEX00344.1|  14-3-3 protein c                                        210   2e-64   
ref|XP_010528468.1|  PREDICTED: 14-3-3-like protein GF14 psi            210   2e-64   
ref|XP_009410139.1|  PREDICTED: 14-3-3-like protein 16R                 210   2e-64   
ref|XP_001771436.1|  predicted protein                                  209   3e-64   
ref|XP_006400137.1|  hypothetical protein EUTSA_v10014395mg             210   3e-64   
ref|XP_010453757.1|  PREDICTED: 14-3-3-like protein GF14 upsilon ...    210   3e-64   
gb|EAZ07074.1|  hypothetical protein OsI_29320                          209   3e-64   
ref|NP_001061856.1|  Os08g0430500                                       209   4e-64   
dbj|BAM20996.1|  14-3-3 protein                                         209   4e-64   
gb|KHG12828.1|  Uncharacterized protein F383_00373                      209   4e-64   
ref|XP_010420282.1|  PREDICTED: 14-3-3-like protein GF14 upsilon        209   4e-64   
ref|XP_010485561.1|  PREDICTED: 14-3-3-like protein GF14 nu             209   5e-64   
ref|XP_006647421.1|  PREDICTED: 14-3-3-like protein GF14-E-like         209   5e-64   
ref|XP_010440961.1|  PREDICTED: 14-3-3-like protein GF14 psi            209   5e-64   
gb|KJB12306.1|  hypothetical protein B456_002G012500                    209   6e-64   
ref|NP_001053003.1|  Os04g0462500                                       209   6e-64   
emb|CDY71290.1|  BnaCnng72220D                                          209   6e-64   
ref|NP_001031982.1|  14-3-3-like protein GF14 psi                       209   6e-64   
ref|XP_006284363.1|  hypothetical protein CARUB_v10005536mg             209   7e-64   
gb|AEH50082.1|  14-3-3-like protein 2                                   209   7e-64   
ref|NP_568557.1|  14-3-3-like protein GF14 psi                          208   7e-64   
ref|XP_006373446.1|  14-3-3 family protein                              209   8e-64   
ref|NP_001047234.1|  Os02g0580300                                       209   8e-64   
ref|XP_010463663.1|  PREDICTED: 14-3-3-like protein GF14 nu             209   8e-64   
gb|ACG24337.1|  14-3-3-like protein                                     208   9e-64   
ref|XP_006652359.1|  PREDICTED: 14-3-3-like protein GF14-B-like i...    208   1e-63   
ref|XP_008664668.1|  PREDICTED: 14-3-3-like protein GF14-C              208   1e-63   
gb|ACG24283.1|  14-3-3-like protein                                     208   1e-63   
ref|XP_002446626.1|  hypothetical protein SORBIDRAFT_06g019100          208   1e-63   
gb|AET81041.1|  14-3-3 protein                                          208   1e-63   
ref|XP_004975868.1|  PREDICTED: 14-3-3-like protein GF14-12-like        208   1e-63   
ref|XP_001771622.1|  predicted protein                                  208   1e-63   
ref|XP_006298337.1|  hypothetical protein CARUB_v10014407mg             208   1e-63   
dbj|BAH56974.1|  AT5G16050                                              207   1e-63   
ref|XP_008661810.1|  PREDICTED: 14-3-3-like protein GF14-12 isofo...    208   1e-63   
gb|AAP48904.1|  14-3-3-like protein                                     207   1e-63   
ref|XP_010695853.1|  PREDICTED: 14-3-3-like protein                     208   1e-63   
ref|NP_001105677.1|  14-3-3-like protein                                207   1e-63   
gb|ACJ83311.1|  unknown                                                 206   1e-63   
gb|AGT16964.1|  14-3-3 protein                                          208   1e-63   
ref|XP_002870838.1|  hypothetical protein ARALYDRAFT_494127             207   1e-63   
ref|NP_001151592.1|  LOC100285226                                       207   2e-63   
sp|Q01526.2|14332_MAIZE  RecName: Full=14-3-3-like protein GF14-12      207   2e-63   
ref|XP_010450904.1|  PREDICTED: 14-3-3-like protein GF14 psi            207   2e-63   
ref|XP_010435756.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...    207   2e-63   
ref|XP_004952897.1|  PREDICTED: 14-3-3-like protein GF14-E-like         207   2e-63   
ref|NP_568325.1|  14-3-3-like protein GF14 upsilon                      207   2e-63   
ref|XP_004973494.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    207   2e-63   
ref|NP_001105350.2|  14-3-3-like protein GF14-6                         207   3e-63   
ref|XP_002873753.1|  predicted protein                                  207   3e-63   
gb|AIZ68200.1|  14-3-3-like protein                                     208   3e-63   
gb|AAA32799.1|  GF14 psi chain                                          207   3e-63   
dbj|BAF46314.1|  14-3-3 protein                                         207   3e-63   
gb|EPS59645.1|  14-3-3 protein                                          206   3e-63   
gb|ADD92154.1|  14-3-3 protein                                          207   3e-63   
emb|CAA53700.1|  14-3-3 protein 32kDa endonuclease                      207   4e-63   
gb|AGA84102.1|  14-3-3 protein                                          207   4e-63   
ref|XP_004968971.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    207   4e-63   
ref|XP_010435754.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...    207   5e-63   
gb|ACG37368.1|  14-3-3-like protein GF14-6                              207   5e-63   
sp|Q43470.1|1433B_HORVU  RecName: Full=14-3-3-like protein B; Sho...    206   5e-63   
ref|XP_004973493.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    207   5e-63   
gb|ADO95303.1|  14-3-3-like protein GF14 Psi                            206   5e-63   
emb|CDM81045.1|  unnamed protein product                                206   5e-63   
ref|XP_002283492.1|  PREDICTED: 14-3-3-like protein A                   206   5e-63   
ref|XP_004968972.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    206   5e-63   
gb|AGG10561.1|  14-3-3                                                  206   6e-63   
gb|ACN73536.1|  1433-3                                                  206   6e-63   
ref|XP_006405765.1|  hypothetical protein EUTSA_v10027892mg             206   6e-63   
ref|XP_003579911.1|  PREDICTED: 14-3-3-like protein GF14-B              206   7e-63   
tpg|DAA37434.1|  TPA: LOW QUALITY PROTEIN: general regulatory fac...    207   7e-63   
emb|CDX67405.1|  BnaA07g14450D                                          206   9e-63   
ref|XP_006288457.1|  hypothetical protein CARUB_v10001718mg             206   1e-62   
ref|NP_001149514.1|  LOC100283140                                       205   1e-62   
gb|EYU44646.1|  hypothetical protein MIMGU_mgv1a012225mg                205   1e-62   
ref|XP_009139790.1|  PREDICTED: 14-3-3-like protein GF14 psi            205   2e-62   
ref|NP_001105278.1|  uncharacterized protein LOC542194                  205   2e-62   
tpg|DAA48307.1|  TPA: putative 14-3-3 protein                           205   2e-62   
emb|CDX74521.1|  BnaA04g08680D                                          205   2e-62   
ref|XP_009125075.1|  PREDICTED: 14-3-3-like protein GF14 psi            204   3e-62   
gb|AAU82115.1|  14-3-3 protein                                          204   3e-62   
ref|XP_003574509.1|  PREDICTED: 14-3-3-like protein GF14-C              204   3e-62   
gb|KJB59911.1|  hypothetical protein B456_009G280500                    204   4e-62   
gb|EMS56849.1|  14-3-3-like protein GF14-B                              204   4e-62   
gb|AEQ53933.1|  14-3-3 protein                                          204   4e-62   
emb|CAA74592.1|  14-3-3 protein                                         204   4e-62   
gb|KCW68901.1|  hypothetical protein EUGRSUZ_F02482                     203   5e-62   
ref|XP_008677283.1|  PREDICTED: LOC100283140 isoform X2                 204   6e-62   
ref|XP_010061867.1|  PREDICTED: 14-3-3-like protein GF14 psi            204   6e-62   
gb|KHG12867.1|  Uncharacterized protein F383_16851                      203   1e-61   
gb|KHG17540.1|  hypothetical protein F383_23617                         203   1e-61   
ref|XP_008677282.1|  PREDICTED: LOC100283140 isoform X1                 204   2e-61   
ref|XP_008649843.1|  PREDICTED: 14-3-3-like protein GF14-C              202   2e-61   
ref|XP_003575229.1|  PREDICTED: 14-3-3-like protein GF14-E              202   2e-61   
ref|XP_009380212.1|  PREDICTED: 14-3-3-like protein                     202   2e-61   
gb|AFW78606.1|  hypothetical protein ZEAMMB73_074048                    202   2e-61   
ref|XP_010103809.1|  14-3-3 protein 4                                   213   2e-61   
emb|CDY01659.1|  BnaC04g30930D                                          202   3e-61   
tpg|DAA42098.1|  TPA: hypothetical protein ZEAMMB73_671875              200   4e-61   
ref|XP_002866671.1|  hypothetical protein ARALYDRAFT_496774             201   4e-61   
ref|NP_569012.2|  14-3-3-like protein GF14 kappa                        201   5e-61   
tpg|DAA42100.1|  TPA: hypothetical protein ZEAMMB73_671875              200   6e-61   
gb|AGT17033.1|  14-3-3 protein                                          201   6e-61   
ref|NP_851274.1|  14-3-3-like protein GF14 kappa                        201   6e-61   
ref|XP_003577480.1|  PREDICTED: 14-3-3-like protein GF14-D              201   7e-61   
ref|XP_010444528.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    200   8e-61   
ref|XP_006288536.1|  hypothetical protein CARUB_v10001809mg             200   8e-61   
ref|XP_010444527.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    200   8e-61   
ref|XP_008670779.1|  PREDICTED: 14-3-3-like protein                     205   9e-61   
ref|XP_006384210.1|  hypothetical protein POPTR_0004s10120g             200   9e-61   
ref|XP_002449656.1|  hypothetical protein SORBIDRAFT_05g021020          201   1e-60   
ref|XP_004979440.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...    201   1e-60   
ref|NP_001190621.1|  14-3-3-like protein GF14 kappa                     200   1e-60   
ref|XP_002960748.1|  hypothetical protein SELMODRAFT_229825             200   1e-60   
ref|XP_008648827.1|  PREDICTED: 14-3-3-like protein GF14-C              200   1e-60   
gb|ACF84704.1|  unknown                                                 201   1e-60   
ref|XP_006280992.1|  hypothetical protein CARUB_v10026999mg             200   1e-60   
gb|AFW65503.1|  14-3-3-like protein                                     201   1e-60   
ref|XP_006280991.1|  hypothetical protein CARUB_v10026999mg             200   1e-60   
ref|XP_010463095.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    200   1e-60   
ref|NP_001141053.1|  uncharacterized protein LOC100273134               200   2e-60   
emb|CDY54716.1|  BnaA09g52470D                                          200   2e-60   
ref|XP_010463102.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    199   2e-60   
gb|ACG30202.1|  14-3-3-like protein                                     200   2e-60   
ref|XP_010453069.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    199   2e-60   
ref|XP_010422840.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    199   2e-60   
gb|KFK25319.1|  hypothetical protein AALP_AA8G097300                    199   2e-60   
ref|XP_010422841.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    199   2e-60   
gb|KJB12049.1|  hypothetical protein B456_002G141000                    197   2e-60   
ref|XP_010453070.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    199   2e-60   
ref|XP_010463089.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    199   3e-60   
ref|XP_006394034.1|  hypothetical protein EUTSA_v10004688mg             201   3e-60   
ref|XP_009150632.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    199   3e-60   
emb|CDY08794.1|  BnaA06g24300D                                          199   3e-60   
ref|XP_009150631.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    199   3e-60   
ref|XP_006394035.1|  hypothetical protein EUTSA_v10004688mg             200   3e-60   
gb|AFW75562.1|  hypothetical protein ZEAMMB73_734327                    202   3e-60   
ref|XP_006841231.1|  hypothetical protein AMTR_s00135p00062550          199   4e-60   
ref|XP_010484367.1|  PREDICTED: 14-3-3-like protein GF14 kappa          199   4e-60   
emb|CDX81287.1|  BnaC09g06980D                                          198   5e-60   
gb|ABC00201.1|  14-3-3E                                                 199   5e-60   
emb|CDY41483.1|  BnaA08g20850D                                          199   6e-60   
ref|NP_001148842.1|  LOC100282460                                       198   1e-59   
ref|XP_009112185.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    197   1e-59   
ref|XP_009112184.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    197   1e-59   
ref|NP_001031868.1|  14-3-3-like protein GF14 lambda                    197   1e-59   
ref|NP_568229.1|  14-3-3-like protein GF14 lambda                       197   2e-59   
gb|KFK28244.1|  hypothetical protein AALP_AA8G490900                    197   2e-59   
ref|NP_001190275.1|  14-3-3-like protein GF14 lambda                    197   2e-59   
dbj|BAB11739.1|  TaWIN1                                                 197   2e-59   
gb|KDO60619.1|  hypothetical protein CISIN_1g024800mg                   195   2e-59   
gb|KDO60622.1|  hypothetical protein CISIN_1g024800mg                   194   2e-59   
gb|AAK26637.1|AF342783_1  GF14 kappa                                    194   2e-59   
emb|CAA52238.1|  RCI1B                                                  196   3e-59   
gb|KDO60620.1|  hypothetical protein CISIN_1g024800mg                   195   3e-59   
ref|NP_001190276.1|  14-3-3-like protein GF14 lambda                    197   4e-59   
ref|XP_009110140.1|  PREDICTED: 14-3-3-like protein GF14 omega          196   4e-59   
ref|XP_004288507.1|  PREDICTED: 14-3-3-like protein GF14 kappa          196   6e-59   
ref|XP_004136260.1|  PREDICTED: 14-3-3-like protein B-like              196   7e-59   
ref|XP_006426293.1|  hypothetical protein CICLE_v10026350mg             194   7e-59   
gb|KDO60618.1|  hypothetical protein CISIN_1g024800mg                   195   7e-59   
ref|XP_006426292.1|  hypothetical protein CICLE_v10026350mg             195   7e-59   
ref|XP_006426291.1|  hypothetical protein CICLE_v10026350mg             195   8e-59   
gb|KDO60616.1|  hypothetical protein CISIN_1g024800mg                   195   8e-59   
gb|AAA79700.2|  GF14 Kappa isoform                                      195   9e-59   
gb|ADO95308.1|  14-3-3-like protein GF14 Lambda                         195   1e-58   
ref|XP_008466176.1|  PREDICTED: 14-3-3-like protein B                   195   1e-58   
ref|XP_006399540.1|  hypothetical protein EUTSA_v10014501mg             195   1e-58   
ref|XP_006399541.1|  hypothetical protein EUTSA_v10014501mg             195   1e-58   
gb|KDO60617.1|  hypothetical protein CISIN_1g024800mg                   195   1e-58   
ref|XP_002873459.1|  hypothetical protein ARALYDRAFT_909000             195   1e-58   
emb|CDX91676.1|  BnaC08g05950D                                          195   1e-58   
gb|ABA01096.1|  14-3-3-like protein-related protein                     195   2e-58   
ref|XP_010547601.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    194   2e-58   
ref|XP_010547603.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    194   2e-58   
ref|XP_002306545.1|  14-3-3-like family protein                         194   2e-58   
gb|EMT12878.1|  14-3-3-like protein GF14-D                              197   2e-58   
emb|CDY46646.1|  BnaA07g10500D                                          194   2e-58   
ref|NP_001160169.1|  14-3-3-like protein GF14-12                        194   3e-58   
ref|XP_004299712.1|  PREDICTED: 14-3-3-like protein B                   194   3e-58   
ref|XP_009103239.1|  PREDICTED: 14-3-3-like protein GF14 omega          194   3e-58   
ref|XP_010523320.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    193   4e-58   
ref|XP_009125300.1|  PREDICTED: 14-3-3-like protein GF14 lambda         193   4e-58   
ref|XP_001702812.1|  14-3-3 protein                                     194   4e-58   
ref|XP_004148413.1|  PREDICTED: 14-3-3 protein 10-like                  193   4e-58   



>ref|XP_009623182.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana tomentosiformis]
 ref|XP_009773768.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana sylvestris]
 dbj|BAD10939.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12180.1| 14-3-3 h-1 protein [Nicotiana tabacum]
 dbj|BAD12181.1| 14-3-3 h-2 protein [Nicotiana tabacum]
Length=258

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAAA+GAEELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAAADGAEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIKEYRSKIE+ELTSICNGILKLLDSKLIGAA +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVASIKEYRSKIETELTSICNGILKLLDSKLIGAAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>emb|CAC84142.3| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAAA+GAEELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAAADGAEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIKEYRSKIE+ELTSICNGILKLLDSKLIGAA +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVASIKEYRSKIETELTSICNGILKLLDSKLIGAAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>ref|NP_001234097.1| 14-3-3 protein 6 [Solanum lycopersicum]
 sp|P93211.2|14336_SOLLC RecName: Full=14-3-3 protein 6 [Solanum lycopersicum]
 gb|AAL04424.1| 14-3-3 family protein [Solanum lycopersicum]
 emb|CAA65149.2| 14-3-3 protein [Solanum lycopersicum]
Length=258

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAAA+GAEELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAAADGAEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIG+A +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGSAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>ref|NP_001275062.1| 14-3-3-like protein 16R [Solanum tuberosum]
 sp|P93784.1|14335_SOLTU RecName: Full=14-3-3-like protein 16R [Solanum tuberosum]
 emb|CAA72381.1| 14-3-3 protein [Solanum tuberosum]
 gb|AAL50217.1| 14-3-3 protein isoform 16R [Solanum tuberosum]
Length=258

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAAA+GAEELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAAADGAEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIG+A +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGSAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>gb|AGJ98234.1| PIB67 14-3-3 protein [Petunia x hybrida]
Length=256

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVV+AA+G EELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVSAADGGEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV SIKEYRSKIE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVNSIKEYRSKIETELTSICNGILKLLDSKLIGSAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>gb|AAF68842.1| 14-3-3-like protein [Capsicum annuum]
Length=165

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAA +G +ELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASQREENVYMAKLAEQAERYEEMVEFMEKVVAALDGGDELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV SIK YRSKIE ELTSICNGILKLLDSKLIG+A +G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVTSIKNYRSKIEIELTSICNGILKLLDSKLIGSAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYYRYLAEFKTGAE  144



>ref|XP_009589383.1| PREDICTED: 14-3-3-like protein F [Nicotiana tomentosiformis]
Length=258

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S+R+E VYMAKLAEQAERYEEMVEFMEKVV  A+G EELT+EERNLLSVAYKNVIGAR
Sbjct  1    MSSSRDEFVYMAKLAEQAERYEEMVEFMEKVVTTADGGEELTIEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV SIK YRSKIESELTSICNGILKLLDS LIGAA++G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVTSIKTYRSKIESELTSICNGILKLLDSNLIGAASTGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>ref|XP_009609727.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 ref|XP_009622063.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 dbj|BAD12168.1| 14-3-3 a-1 protein [Nicotiana tabacum]
Length=255

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY+AKLAEQAERYEEMVEFMEKVV A +    +    RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYLAKLAEQAERYEEMVEFMEKVVGAGDDELTVEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK YRSKIESELTSICNGILKLLDSKLIG A +G+
Sbjct  59   RASWRIISSIEQKEESRGNEDHVASIKTYRSKIESELTSICNGILKLLDSKLIGTAATGD  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTGAE
Sbjct  119  SKVFYLKMKGDYYRYLAEFKTGAE  142



>ref|XP_009786458.1| PREDICTED: 14-3-3-like protein A [Nicotiana sylvestris]
Length=255

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY+AKLAEQAERYEEMVEFMEKVV A +    +    RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYLAKLAEQAERYEEMVEFMEKVVGAGDDELTVEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK YRSKIESELTSICNGILKLLDSKLIG A +G+
Sbjct  59   RASWRIISSIEQKEESRGNEDHVASIKTYRSKIESELTSICNGILKLLDSKLIGTAATGD  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTGAE
Sbjct  119  SKVFYLKMKGDYYRYLAEFKTGAE  142



>sp|P93342.1|1433A_TOBAC RecName: Full=14-3-3-like protein A [Nicotiana tabacum]
 emb|CAA72095.1| 14-3-3-like protein A [Nicotiana tabacum]
Length=255

 Score =   234 bits (596),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY+AKLAEQAERYEEMVEFMEKVV A +    +    RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYLAKLAEQAERYEEMVEFMEKVVGAGDDELTIEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK YRSKIESELTSICNGILKLLDSKLIG A +G+
Sbjct  59   RASWRIISSIEQKEESRGNEDHVASIKTYRSKIESELTSICNGILKLLDSKLIGTAATGD  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTGAE
Sbjct  119  SKVFYLKMKGDYYRYLAEFKTGAE  142



>dbj|BAD12178.1| 14-3-3 f-1 protein [Nicotiana tabacum]
Length=258

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S+R+E VYMAKLAEQAERY EMVEFMEKVV  A+G EELT+EERNLLSVAYKNVIGAR
Sbjct  1    MSSSRDEFVYMAKLAEQAERYGEMVEFMEKVVTTADGGEELTIEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV SIK YRSKIESELTSICNGILKLLDS LIGAA++G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVTSIKTYRSKIESELTSICNGILKLLDSNLIGAASTGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>gb|KDO81027.1| hypothetical protein CISIN_1g024620mg [Citrus sinensis]
Length=222

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV A+ E +EELTVEERNLLSVAYKNVIGARRA
Sbjct  10   SPREENVYMAKLAEQAERYEEMVEFMEKVSASVESSEELTVEERNLLSVAYKNVIGARRA  69

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV++I++YRSKIE+EL+SIC+GILKLLDS+LI  A+SG+SK
Sbjct  70   SWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSK  129

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  130  VFYLKMKGDYHRYLAEFKTGAE  151



>ref|NP_001274876.1| 14-3-3-like protein RA215 [Solanum tuberosum]
 gb|ABC01910.1| 14-3-3 protein-like protein [Solanum tuberosum]
Length=255

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAALDGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGTE  143



>emb|CDP01506.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY AKLAEQAERYEEMVEFMEKVV+AA+G EELTVEERNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYKAKLAEQAERYEEMVEFMEKVVSAADGGEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNE HVA+IK YRSKIESEL+SIC+GILKLLDSKLIG+A +G+
Sbjct  61   RASWRIISSIEQKEESRGNEGHVAAIKSYRSKIESELSSICDGILKLLDSKLIGSAATGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>ref|XP_006472571.1| PREDICTED: 14-3-3-like protein-like [Citrus sinensis]
Length=265

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV A+ E +EELTVEERNLLSVAYKNVIGARRA
Sbjct  10   SPREENVYMAKLAEQAERYEEMVEFMEKVSASVESSEELTVEERNLLSVAYKNVIGARRA  69

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV++I++YRSKIE+EL+SIC+GILKLLDS+LI +A+SG+SK
Sbjct  70   SWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPSASSGDSK  129

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  130  VFYLKMKGDYHRYLAEFKTGAE  151



>gb|ABA81882.1| 14-3-3 protein-like [Solanum tuberosum]
Length=255

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAALDGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGTE  143



>gb|AAS78777.1| 14-3-3 protein [Solanum chacoense]
Length=255

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAALDGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGTE  143



>gb|AAR98782.1| 14-3-3 protein isoform 20R [Solanum tuberosum]
Length=255

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVVAA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVAALDGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGTE  143



>gb|KDO81026.1| hypothetical protein CISIN_1g024620mg [Citrus sinensis]
Length=265

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV A+ E +EELTVEERNLLSVAYKNVIGARRA
Sbjct  10   SPREENVYMAKLAEQAERYEEMVEFMEKVSASVESSEELTVEERNLLSVAYKNVIGARRA  69

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV++I++YRSKIE+EL+SIC+GILKLLDS+LI  A+SG+SK
Sbjct  70   SWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSK  129

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  130  VFYLKMKGDYHRYLAEFKTGAE  151



>ref|XP_009799312.1| PREDICTED: 14-3-3-like protein F [Nicotiana sylvestris]
 sp|O49998.1|1433F_TOBAC RecName: Full=14-3-3-like protein F [Nicotiana tabacum]
 gb|AAC49895.1| 14-3-3 isoform f [Nicotiana tabacum]
 dbj|BAD10941.1| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S+R+E VYMAKLAEQAERYEEMV+FMEKVV AA+G EELT+EERNLLSVAYKNVIGAR
Sbjct  1    MSSSRDEFVYMAKLAEQAERYEEMVDFMEKVVTAADGGEELTIEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV SIK YRSKIESELTSICNGILKLLDS LI AA++G+
Sbjct  61   RASWRIISSIEQKEESRGNEDHVTSIKTYRSKIESELTSICNGILKLLDSNLIRAASTGD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGAE  144



>gb|KJB58994.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58995.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58996.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
Length=268

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +S REENVYMAKLAEQAERYEEMVEFMEKV A+A+  E    E RNLLSVAYKNVIG
Sbjct  4    AATSSPREENVYMAKLAEQAERYEEMVEFMEKVSASADNEELTVEE-RNLLSVAYKNVIG  62

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA+I++YR+KIESELTSICNGILKLLD++L+ +A+S
Sbjct  63   ARRASWRIISSIEQKEESRGNDDHVATIRDYRAKIESELTSICNGILKLLDTRLVPSASS  122

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  GDSKVFYLKMKGDYHRYLAEFKTGAE  148



>gb|ABY65001.1| 14-3-3b protein [Gossypium hirsutum]
Length=268

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +S REENVYMAKLAEQAERYEEMVEFMEKV A+A+  E    E RNLLSVAYKNVIG
Sbjct  4    AATSSPREENVYMAKLAEQAERYEEMVEFMEKVSASADNEELTVEE-RNLLSVAYKNVIG  62

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA+I++YR+KIESELTSICNGILKLLD++L+ +A+S
Sbjct  63   ARRASWRIISSIEQKEESRGNDDHVATIRDYRAKIESELTSICNGILKLLDTRLVPSASS  122

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  GDSKVFYLKMKGDYHRYLAEFKTGAE  148



>gb|KHG20751.1| Uncharacterized protein F383_04220 [Gossypium arboreum]
Length=269

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +S REENVYMAKLAEQAERYEEMVEFMEKV A+A+  E    E RNLLSVAYKNVIG
Sbjct  4    AATSSPREENVYMAKLAEQAERYEEMVEFMEKVSASADNEELTVEE-RNLLSVAYKNVIG  62

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA+I++YR+KIESELTSICNGILKLLD++L+ +A+S
Sbjct  63   ARRASWRIISSIEQKEESRGNDDHVATIRDYRAKIESELTSICNGILKLLDTRLVPSASS  122

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  GDSKVFYLKMKGDYHRYLAEFKTGAE  148



>gb|ACD69679.1| 14-3-3, partial [Mangifera indica]
Length=261

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  SAREENVYMAKLAEQAERYEEMVEFMEKV A++E +EEL VEERNLLSVAYKNVIG
Sbjct  2    ASTPSAREENVYMAKLAEQAERYEEMVEFMEKVSASSENSEELNVEERNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE HV++I++YRSKIE+EL+SIC+GILKL DS+LI +A+S
Sbjct  62   ARRASWRIISSIEQKEESRGNEGHVSTIRDYRSKIETELSSICDGILKLPDSRLIPSASS  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_010098629.1| 14-3-3-like protein [Morus notabilis]
 gb|EXB75368.1| 14-3-3-like protein [Morus notabilis]
Length=257

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MASAREENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGAR
Sbjct  1    MASAREENVYMAKLAEQAERYEEMVEFMEKVSTTVENEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV  I++YRSKIE+EL++IC+GILKLLD++LI +ATSG+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVTVIRDYRSKIETELSNICDGILKLLDTRLIPSATSGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG+E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGSE  143



>ref|XP_011097537.1| PREDICTED: 14-3-3-like protein 16R [Sesamum indicum]
Length=255

 Score =   229 bits (583),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNE HV++IK YRSKIESEL+SIC+GILKLLD+KLIG+A++G+
Sbjct  60   RASWRIISSIEQKEESRGNESHVSAIKSYRSKIESELSSICDGILKLLDTKLIGSASNGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>gb|ABK42078.1| 14-3-3 protein [Capsicum annuum]
Length=183

 Score =   226 bits (577),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMV+FMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVDFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SIKEYRSKIE+EL+ IC+GILKLLDSKLI +ATS
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIKEYRSKIENELSKICDGILKLLDSKLIPSATS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_006433941.1| hypothetical protein CICLE_v10003615mg, partial [Citrus clementina]
 gb|ESR47181.1| hypothetical protein CICLE_v10003615mg, partial [Citrus clementina]
Length=398

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = +2

Query  44   PERVRALSHRQTQAS---MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeelt  214
            P + +    RQ  A+     S REENVYMAKLAEQAERYEEMVEFMEKV A+ E +EELT
Sbjct  93   PHQPKKKKKRQMAAAATPTPSPREENVYMAKLAEQAERYEEMVEFMEKVSASVESSEELT  152

Query  215  veeRNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICN  394
            VEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHV++I++YRSKIE+EL+SIC+
Sbjct  153  VEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICD  212

Query  395  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            GILKLLDS+LI  A+SG+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  213  GILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAE  254



>gb|KCW66571.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
 gb|KCW66572.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
Length=332

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +2

Query  59   ALSHRQTQASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltve--eRNL  232
            A S R   A+  SAREENVYMAKLAEQAERYEEMVEFMEKV AAA  A+   +   ERNL
Sbjct  64   ASSERAAMATAPSAREENVYMAKLAEQAERYEEMVEFMEKVAAAAAAADAEELTIEERNL  123

Query  233  LSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLL  412
            LSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVA+I++YRSKIESEL+ IC GILKLL
Sbjct  124  LSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVAAIRDYRSKIESELSGICAGILKLL  183

Query  413  DSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            DS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  184  DSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGAE  219



>gb|AIU34467.1| putative 14-3-3 protein, partial [Taraxacum brevicorniculatum]
Length=258

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +S RE+NVYMAKLAEQAERYEEMVEFMEKVVAAA+G+EELT+EERNLLSVAYKNVIG
Sbjct  2    AAASSPREDNVYMAKLAEQAERYEEMVEFMEKVVAAADGSEELTIEERNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE HV++I++YRSKIE+EL+SIC+GILKLLDSKLIG+A+S
Sbjct  62   ARRASWRIISSIEQKEESRGNEGHVSTIRDYRSKIETELSSICDGILKLLDSKLIGSASS  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDY+RYLAEFKTG+E
Sbjct  122  GDSKVFYLKMKGDYYRYLAEFKTGSE  147



>gb|AIJ04691.1| 14-3-3b [Morus alba var. atropurpurea]
Length=257

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MASAREENVYMAKLAEQAERYEEMVEFMEKV A  E  E    E RNLLSVAYKNVIGAR
Sbjct  1    MASAREENVYMAKLAEQAERYEEMVEFMEKVSATVESEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV  I++YRSKIE+EL++IC+GILKLLD++LI +A+SG+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVTVIRDYRSKIETELSNICDGILKLLDTRLIPSASSGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG+E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGSE  143



>ref|XP_010060042.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
Length=262

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltve--eRNLLSVAYKNV  256
            A+  SAREENVYMAKLAEQAERYEEMVEFMEKV AAA  A+   +   ERNLLSVAYKNV
Sbjct  2    ATAPSAREENVYMAKLAEQAERYEEMVEFMEKVAAAAAAADAEELTIEERNLLSVAYKNV  61

Query  257  IGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAA  436
            IGARRASWRIISSIEQKEESRGNEDHVA+I++YRSKIESEL+ IC GILKLLDS+LI AA
Sbjct  62   IGARRASWRIISSIEQKEESRGNEDHVAAIRDYRSKIESELSGICAGILKLLDSRLIPAA  121

Query  437  TSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
             SG+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  ASGDSKVFYLKMKGDYHRYLAEFKTGAE  149



>ref|XP_002262802.1| PREDICTED: 14-3-3-like protein [Vitis vinifera]
 emb|CAN64479.1| hypothetical protein VITISV_032972 [Vitis vinifera]
Length=255

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREENVYMAKLAEQAERYEEMV+FMEKV A AE         RNLLSVAYKNVIGARRA
Sbjct  5    SAREENVYMAKLAEQAERYEEMVQFMEKVTAEAEELTVEE---RNLLSVAYKNVIGARRA  61

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA+I+ YRSKIESEL+SIC+GIL+LLDS+LI +ATSG+SK
Sbjct  62   SWRIISSIEQKEESRGNEDHVATIRGYRSKIESELSSICDGILRLLDSRLIPSATSGDSK  121

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  VFYLKMKGDYHRYLAEFKTGAE  143



>gb|EPS60562.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEE+RGNE HV++IK YRSKIESEL+SIC+GILKLLDSKLIG+A+SG+
Sbjct  60   RASWRIISSIEQKEENRGNEGHVSAIKTYRSKIESELSSICDGILKLLDSKLIGSASSGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFK GAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKVGAE  143



>gb|ABE01401.1| 14-3-3 protein [Camellia sinensis]
Length=260

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            + ++ REE+VYMAKLAEQAERYEEMVEFMEKV +    +EELTVEERNLLSVAYKNVIGA
Sbjct  2    ATSTPREESVYMAKLAEQAERYEEMVEFMEKVSSTVVESEELTVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRIISSIEQKEESRGN DHV++IK+YRSKIE+EL+SIC+GILKLLD+KLI +AT+G
Sbjct  62   RRASWRIISSIEQKEESRGNADHVSTIKDYRSKIENELSSICDGILKLLDTKLIPSATAG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDYHRYLAEFKTG+E
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTGSE  146



>ref|XP_007136271.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 ref|XP_007136272.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|AGV54448.1| 14-3-3 protein [Phaseolus vulgaris]
 gb|ESW08265.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|ESW08266.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
Length=259

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REENVYMAKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPTPREENVYMAKLAEQAERYEEMVEFMEKVSAAADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA I++YRSKIESEL++IC+GILKLLDS+LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDSRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|EYU30984.1| hypothetical protein MIMGU_mgv1a012292mg [Erythranthe guttata]
Length=255

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMAKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNE HVA+IK YRSKIE+EL+SIC+GILKLLD+KLIG+A++G+
Sbjct  60   RASWRIISSIEQKEESRGNEGHVAAIKSYRSKIETELSSICDGILKLLDTKLIGSASTGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGAE  143



>ref|XP_003526571.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=259

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSPREENVYMAKLAEQAERYEEMVEFMEKVSAAADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|NP_001238389.1| 14-3-3 protein SGF14h [Glycine max]
 gb|ADU60526.1| SGF14h [Glycine max]
 gb|KHN19782.1| 14-3-3-like protein [Glycine soja]
Length=259

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSPREENVYMAKLAEQAERYEEMVEFMEKVSAAADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>sp|P93210.1|14335_SOLLC RecName: Full=14-3-3 protein 5 [Solanum lycopersicum]
 emb|CAA65148.1| 14-3-3 protein [Solanum lycopersicum]
Length=255

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMA +A++AERYEEMVEFMEKVVAA  G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMANVADEAERYEEMVEFMEKVVAALNGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  60   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYYRYLAEFKTGTE  143



>ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera]
 gb|ACO40495.1| 14-3-3 protein [Vitis vinifera]
Length=260

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREENVYMAKLAEQAERYEEMVEFMEKV AA +  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSAREENVYMAKLAEQAERYEEMVEFMEKVSAAVDSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+ HVA I++YRSKIESEL+SIC+GILKLLDS+LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNDHHVAMIRDYRSKIESELSSICDGILKLLDSRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|EYU34581.1| hypothetical protein MIMGU_mgv1a012286mg [Erythranthe guttata]
Length=255

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA+ REENVYMAKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MATPREENVYMAKLAEQAERYEEMVEFMEKVVGAIDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNE HV+SIK YRSKIE+EL+ IC+GILKLLDSKLIG+A  G+
Sbjct  60   RASWRIISSIEQKEESRGNESHVSSIKTYRSKIETELSGICDGILKLLDSKLIGSAAGGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>ref|NP_001275270.1| 14-3-3-like protein C-like [Solanum tuberosum]
 emb|CAA72383.1| 14-3-3 protein [Solanum tuberosum]
Length=259

 Score =   226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLDSKLI +ATS
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDSKLIPSATS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_007018723.1| General regulatory factor 2, OMEGA [Theobroma cacao]
 gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao]
Length=267

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   S REENVYMAKLAEQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AGTPSPREENVYMAKLAEQAERYEEMVEFMEKVSASVENEELSVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA I++YR+KIESEL+SIC+GILKLLDS+LI +A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIRDYRAKIESELSSICDGILKLLDSRLIPSASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_003602824.1| 14-3-3-like protein [Medicago truncatula]
 gb|AES73075.1| general regulatory factor 2 [Medicago truncatula]
Length=206

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHSPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>sp|Q43643.1|14332_SOLTU RecName: Full=14-3-3-like protein RA215 [Solanum tuberosum]
 emb|CAA60800.1| 14-3-3 protein [Solanum tuberosum]
Length=254

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVYMA +A +AERYEEMVEFMEKVVAA +    +    RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYMANVAARAERYEEMVEFMEKVVAALDTELTVEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G+
Sbjct  59   RASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATGD  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  119  SKVFYLKMKGDYYRYLAEFKTGTE  142



>ref|XP_009632004.1| PREDICTED: 14-3-3-like protein B [Nicotiana tomentosiformis]
 dbj|BAB68526.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12170.1| 14-3-3 b-2 protein [Nicotiana tabacum]
Length=255

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            AREENVYMAKLAEQAERYEEMV FMEKV  +   +EELTVEERNLLSVAYKNVIGARRAS
Sbjct  2    AREENVYMAKLAEQAERYEEMVSFMEKVSTSLGTSEELTVEERNLLSVAYKNVIGARRAS  61

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHV  I+EYRSKIESEL++IC+GILKLLDS LI +A++G+SKV
Sbjct  62   WRIISSIEQKEESRGNEDHVKCIQEYRSKIESELSNICDGILKLLDSCLIPSASAGDSKV  121

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFKTGAE
Sbjct  122  FYLKMKGDYHRYLAEFKTGAE  142



>ref|XP_009777542.1| PREDICTED: 14-3-3-like protein B [Nicotiana sylvestris]
 sp|O49995.1|1433B_TOBAC RecName: Full=14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49891.1| 14-3-3 isoform b [Nicotiana tabacum]
 dbj|BAD12169.1| 14-3-3 b-1 protein [Nicotiana tabacum]
Length=255

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            AREENVYMAKLAEQAERYEEMV FMEKV  +   +EELTVEERNLLSVAYKNVIGARRAS
Sbjct  2    AREENVYMAKLAEQAERYEEMVSFMEKVSTSLGTSEELTVEERNLLSVAYKNVIGARRAS  61

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHV  I+EYRSKIESEL++IC+GILKLLDS LI +A++G+SKV
Sbjct  62   WRIISSIEQKEESRGNEDHVKCIQEYRSKIESELSNICDGILKLLDSCLIPSASAGDSKV  121

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFKTGAE
Sbjct  122  FYLKMKGDYHRYLAEFKTGAE  142



>dbj|BAB47119.1| 14-3-3 protein [Vigna angularis]
Length=259

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REENVYMAKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPTPREENVYMAKLAEQAERYEEMVEFMEKVSAAADNEELNVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV  I++YRSKIESEL++IC+GILKLLDS+LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVTVIRDYRSKIESELSNICDGILKLLDSRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_008386122.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=264

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEF+EKV A+A+  E    E RNLLSVAYKNVIG
Sbjct  3    ATTPSPREENVYMAKLAEQAERYEEMVEFVEKVSASADKEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA+I++YRSKIE+EL++IC+GILKLLDS+LI +A +
Sbjct  62   ARRASWRIISSIEQKEESRGNDDHVATIRDYRSKIETELSNICDGILKLLDSRLIPSAVA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGAE  147



>sp|P46266.1|1433_PEA RecName: Full=14-3-3-like protein [Pisum sativum]
 gb|AAA85817.1| 14-3-3-like protein [Pisum sativum]
Length=260

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHTPREENVYMAKLAEQAERYEEMVEFMEKVSANADSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA I++YRSKIESEL++IC+GILKLLD++LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDTRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|ACQ45021.1| 14-3-3 [Cicer arietinum]
Length=261

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRII SIEQKEESRGNEDHVA I++YRSKIESEL++IC+GILKLLDS+LI +A+SG+SK
Sbjct  65   SWRIIPSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDSRLIPSASSGDSK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|AES73074.2| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHSPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_004501696.1| PREDICTED: 14-3-3-like protein-like [Cicer arietinum]
Length=266

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA I++YRSKIESEL++IC+GILKLLDS+LI +A+SG+SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDSRLIPSASSGDSK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|AFK34151.1| unknown [Medicago truncatula]
Length=260

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHSPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_011074203.1| PREDICTED: 14-3-3-like protein B [Sesamum indicum]
Length=264

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ A+ REENVYMAKLAEQAERYEEMVEFMEKV ++    EELTVEERNLLSVAYKNVIG
Sbjct  2    AAAAAGREENVYMAKLAEQAERYEEMVEFMEKVSSSLPEKEELTVEERNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEES+GNEDHV++IKEYRSKIE+EL+ IC+GIL+LLD +LI +A++
Sbjct  62   ARRASWRIISSIEQKEESKGNEDHVSAIKEYRSKIETELSGICDGILQLLDKRLIPSASA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
             +SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  SDSKVFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_002307363.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93650.1| unknown [Populus trichocarpa]
 gb|EEE94359.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=260

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREENVYMAKLAEQAERYEEMVE+MEKV A+ +  E    E RNLLSVAYKNVIG
Sbjct  2    AATPSAREENVYMAKLAEQAERYEEMVEYMEKVSASIDNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLD++LI  A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDTRLIPTASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_011009578.1| PREDICTED: 14-3-3-like protein isoform X2 [Populus euphratica]
Length=260

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREENVYMAKLAEQAERYEEMVE+MEKV A  +  E    E RNLLSVAYKNVIG
Sbjct  2    AATPSAREENVYMAKLAEQAERYEEMVEYMEKVSATIDNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLDS+LI  A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDSRLIPTASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_011016779.1| PREDICTED: 14-3-3-like protein [Populus euphratica]
Length=261

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREENVYMAKLAEQAERYEEMVE+MEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AATPSAREENVYMAKLAEQAERYEEMVEYMEKVSASLENEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLDS+LI  A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDSRLIPTASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>sp|O65352.1|1433_HELAN RecName: Full=14-3-3-like protein [Helianthus annuus]
 gb|AAC17447.1| 14-3-3-like protein [Helianthus annuus]
Length=259

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +S REENVY+AKLAEQAERYEEMVEFMEKVVAAA+G EELT+EERNLLSVAYKNVIG
Sbjct  2    AAASSPREENVYLAKLAEQAERYEEMVEFMEKVVAAADGGEELTIEERNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE HV++I++YRSKIESEL+SIC+GILK+LDSKLIG+A+ 
Sbjct  62   ARRASWRIISSIEQKEESRGNEGHVSTIRDYRSKIESELSSICDGILKVLDSKLIGSASG  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  122  GDSKVFYLKMKGDYYRYLAEFKTGDE  147



>ref|XP_008444853.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=261

 Score =   224 bits (572),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A+ +  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSVREENVYMAKLAEQAERYEEMVEFMEKVSASLDKEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSVIRDYRSKIETELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|KDP41413.1| hypothetical protein JCGZ_15820 [Jatropha curcas]
Length=260

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   ++REENVYMAKLAEQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTSREENVYMAKLAEQAERYEEMVEFMEKVSASVENEELSVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIESEL+SIC+GILKLLD++LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIESELSSICDGILKLLDTRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_004152627.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004162227.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN62706.1| hypothetical protein Csa_2G369070 [Cucumis sativus]
Length=261

 Score =   224 bits (572),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A+ +  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSVREENVYMAKLAEQAERYEEMVEFMEKVSASLDKEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSVIRDYRSKIETELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_011098686.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098695.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098703.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
Length=257

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            + REENVYMAKLAEQAERYEEMVE+MEKV A+    EE+TVEERNLLSVAYKNVIGARRA
Sbjct  2    APREENVYMAKLAEQAERYEEMVEYMEKVSASLPEKEEMTVEERNLLSVAYKNVIGARRA  61

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV +IKEYRSKIE+EL+ IC+GILKLLD +LI +A  G+SK
Sbjct  62   SWRIISSIEQKEESRGNEDHVNTIKEYRSKIETELSKICDGILKLLDDRLIPSAAGGDSK  121

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  VFYLKMKGDYHRYLAEFKTGAE  143



>ref|XP_009373053.1| PREDICTED: 14-3-3-like protein [Pyrus x bretschneideri]
Length=319

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   S REENVYMAKLAEQAERYEEMVEF+EKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  59   APTPSPREENVYMAKLAEQAERYEEMVEFVEKVSASAEKEELTVEE-RNLLSVAYKNVIG  117

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA I++YRSKIE+EL++IC+GILKLLDS+LI +A +
Sbjct  118  ARRASWRIISSIEQKEESRGNDDHVALIRDYRSKIETELSNICDGILKLLDSRLIPSACA  177

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  178  GDSKVFYLKMKGDYHRYLAEFKTGAE  203



>ref|XP_010272995.1| PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like protein [Nelumbo 
nucifera]
Length=300

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = +2

Query  83   ASMA-SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVI  259
            AS+A S REENVYMAKLAEQAERYEEMVEFMEKV AA E  E    E RNLLSVAYKNVI
Sbjct  4    ASVAPSPREENVYMAKLAEQAERYEEMVEFMEKVTAAVEAEELTVEE-RNLLSVAYKNVI  62

Query  260  GARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAAT  439
            GARRASWRIISSIEQKEESRGNEDHVA I++YRSKIESEL+SIC+GIL+LLD +LI +A+
Sbjct  63   GARRASWRIISSIEQKEESRGNEDHVAMIRDYRSKIESELSSICDGILRLLDQRLIPSAS  122

Query  440  SGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            SG+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  SGDSKVFYLKMKGDYHRYLAEFKTGAE  149



>gb|KJB64237.1| hypothetical protein B456_010G038600 [Gossypium raimondii]
Length=258

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            A+ REENVYMAKLAEQAERYEEMV+FMEKV A+A   E LT+EERNLLSVAYKNVIGARR
Sbjct  3    AATREENVYMAKLAEQAERYEEMVDFMEKVSASAADNEGLTIEERNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGNEDHVA I++YR+KIESEL+SIC GILKLLD+ LI + + G+S
Sbjct  63   ASWRIISSIEQKEESRGNEDHVAVIRDYRAKIESELSSICGGILKLLDTTLIPSPSGGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  KVFYLKMKGDYHRYLAEFKTGAE  145



>dbj|BAD12554.1| 14-3-3 f-2 protein [Nicotiana tabacum]
Length=243

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  113  VYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASWRIIS  292
            VYMAKLAEQAERYEEMV+FMEKVV AA+G EELT+EERNLLSVAYKNVIGARRASWRIIS
Sbjct  1    VYMAKLAEQAERYEEMVDFMEKVVTAADGGEELTIEERNLLSVAYKNVIGARRASWRIIS  60

Query  293  SIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVFYLKM  472
            SIEQKEESRGNEDHV SIK YRSKIESELTSICNGILKLLDS LI AA++G+SKVFYLKM
Sbjct  61   SIEQKEESRGNEDHVTSIKTYRSKIESELTSICNGILKLLDSNLIRAASTGDSKVFYLKM  120

Query  473  KGDYHRYLAEFKTGAE  520
            KGDYHRYLAEFKTGAE
Sbjct  121  KGDYHRYLAEFKTGAE  136



>ref|XP_010676024.1| PREDICTED: 14-3-3-like protein [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE+VYMAKLAEQAERYEEMVEFMEKVV+AA   EELTVEERNLLSVAYKNVIGARR
Sbjct  3    SSAREESVYMAKLAEQAERYEEMVEFMEKVVSAASEGEELTVEERNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGNEDHV+ I++YRS+IE EL  IC+GILKLLD+KLI AA++G+S
Sbjct  63   ASWRIISSIEQKEESRGNEDHVSVIRDYRSRIEKELCDICDGILKLLDTKLIPAASAGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  123  KVFYLKMKGDYHRYLAEFKTGTE  145



>ref|NP_565176.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
 sp|Q01525.2|14332_ARATH RecName: Full=14-3-3-like protein GF14 omega; AltName: Full=General 
regulatory factor 2 [Arabidopsis thaliana]
 gb|AAF71808.1|AC013430_17 F3F9.16 [Arabidopsis thaliana]
 gb|AAL58901.1|AF462807_1 At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAA32798.1| GF14 [Arabidopsis thaliana]
 gb|AAL76145.1| At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAM67316.1| 14-3-3 protein GF14omega (grf2) [Arabidopsis thaliana]
 gb|AEE36093.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
Length=259

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGN+DHV +I+EYRSKIE+EL+ IC+GILKLLDS+LI AA SG+
Sbjct  60   RASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGQE  143



>ref|XP_002301071.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93142.1| unknown [Populus trichocarpa]
 gb|EEE80344.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=261

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   SAREENVYMAKLAEQAERYEEMVE+MEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AVTPSAREENVYMAKLAEQAERYEEMVEYMEKVSASLENEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLDS+LI  A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDSRLIPTASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|AAA96253.1| GF14omega isoform [Arabidopsis thaliana]
Length=259

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASGREELVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGN+DHV +I+EYRSKIE+EL+ IC+GILKLLDS+LI AA SG+
Sbjct  60   RASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGQE  143



>gb|AAT35546.1| 14-3-3 protein [Tropaeolum majus]
Length=259

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MASAREE+VYMAKLAEQAERYEEMVEFMEKV A+AEG E    E RNLLSVAYKNVIGAR
Sbjct  1    MASAREESVYMAKLAEQAERYEEMVEFMEKVSASAEGEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWR ISSIEQKEE RGNEDHV  I++YRSKIESEL++IC+GILKLLD++LI +A+SG+
Sbjct  60   RASWRTISSIEQKEEGRGNEDHVTVIRDYRSKIESELSNICDGILKLLDTRLIPSASSGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>pdb|2O98|A Chain A, Structure Of The 14-3-3  H+-Atpase Plant Complex
 pdb|2O98|B Chain B, Structure Of The 14-3-3  H+-Atpase Plant Complex
Length=242

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLD+KLI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>emb|CAB42546.2| 14-3-3-like protein [Pisum sativum]
Length=260

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHTPREENVYMAKLAEQAERYEEMVEFMEKVSANADSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV  I++YRSKIESEL++IC+GILKLLD++LI +A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVDVIRDYRSKIESELSNICDGILKLLDTRLIPSASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009619695.1| PREDICTED: 14-3-3-like protein C [Nicotiana tomentosiformis]
 sp|P93343.1|1433C_TOBAC RecName: Full=14-3-3-like protein C; AltName: Full=14-3-3-like 
protein B [Nicotiana tabacum]
 pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9D|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9E|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9F|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|3E6Y|A Chain A, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 pdb|3E6Y|B Chain B, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 emb|CAA72094.1| 14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49892.1| 14-3-3 isoform c [Nicotiana tabacum]
 dbj|BAD10940.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12171.1| 14-3-3 c-1 protein [Nicotiana tabacum]
Length=260

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLD+KLI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009757667.1| PREDICTED: 14-3-3-like protein C [Nicotiana sylvestris]
 dbj|BAD12172.1| 14-3-3 c-2 protein [Nicotiana tabacum]
Length=260

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLD+KLI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>pdb|3M50|A Chain A, Structure Of The 14-3-3/pma2 Complex Stabilized By Epibestatin
 pdb|3M51|A Chain A, Structure Of The 14-3-3/pma2 Complex Stabilized By Pyrrolidone1
Length=240

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAEQAERYEEMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLD+KLI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|KHG05238.1| Uncharacterized protein F383_30797 [Gossypium arboreum]
Length=258

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            A+ REENVYMAKLAEQAERYEEMV+FMEKV A+A   E LT+EERNLLSVAYKNVIGARR
Sbjct  3    AATREENVYMAKLAEQAERYEEMVDFMEKVSASAADNEGLTIEERNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGNEDHVA I++YR+KIESEL+SIC GILKLLD+ LI +A+ G+S
Sbjct  63   ASWRIISSIEQKEESRGNEDHVAVIRDYRAKIESELSSICGGILKLLDTTLIPSASGGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKT AE
Sbjct  123  KVFYLKMKGDYHRYLAEFKTSAE  145



>ref|XP_011009577.1| PREDICTED: 14-3-3-like protein isoform X1 [Populus euphratica]
Length=267

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREENVYMAKLAEQAERYEEMVE+MEKV A  +  E    E RNLLSVAYKNVIG
Sbjct  2    AATPSAREENVYMAKLAEQAERYEEMVEYMEKVSATIDNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLDS+LI  A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDSRLIPTASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>sp|P29307.2|1433_OENEH RecName: Full=14-3-3-like protein [Oenothera elata subsp. hookeri]
 emb|CAA44642.1| protein kinase C inhibitor homologue [Oenothera elata subsp. 
hookeri]
Length=260

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVY+AKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPSPREENVYLAKLAEQAERYEEMVEFMEKVCAAADSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV++I++YRSKIE+EL++IC GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSTIRDYRSKIETELSNICGGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>dbj|BAD93604.1| hypothetical protein [Cucumis melo]
Length=223

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVY+AKLAEQAERYEEMVEFMEKV A+ +  E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSVREENVYVAKLAEQAERYEEMVEFMEKVSASLDKEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSVIRDYRSKIETELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010917299.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=258

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA AREENVYMAKLAEQAERYEEMVEFMEKV +AA   EELTVEERNLLSVAYKNVIGAR
Sbjct  1    MAGAREENVYMAKLAEQAERYEEMVEFMEKVTSAAVEGEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRI+SSIEQKEESRGNEDHVA+I++YR+KIE+ELT+IC GILKLLD+ LI +A+S  
Sbjct  61   RASWRIVSSIEQKEESRGNEDHVAAIRDYRAKIEAELTNICAGILKLLDASLIPSASSAE  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFY KMKGDYHRYLAEFKTG+E
Sbjct  121  SKVFYHKMKGDYHRYLAEFKTGSE  144



>ref|XP_002513956.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF48539.1| 14-3-3 protein, putative [Ricinus communis]
Length=257

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            +AREENVYMAKLAEQAERYEEMVEFMEKV A+ +  E    E RNLLSVAYKNVIGARRA
Sbjct  2    AAREENVYMAKLAEQAERYEEMVEFMEKVSASIDNEELTVEE-RNLLSVAYKNVIGARRA  60

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ I++YR+KIESEL+SIC+GILKLLD++LI +A +G+SK
Sbjct  61   SWRIISSIEQKEESRGNEDHVSLIRDYRAKIESELSSICDGILKLLDTRLIPSAAAGDSK  120

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  VFYLKMKGDYHRYLAEFKTGAE  142



>ref|XP_008346360.1| PREDICTED: 14-3-3-like protein [Malus domestica]
 ref|XP_008356357.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=263

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEF+EKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ATTPSPREENVYMAKLAEQAERYEEMVEFVEKVSASAEKEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA I++YRSKIE+EL++IC+GILKLLDS+LI +A  
Sbjct  62   ARRASWRIISSIEQKEESRGNDDHVALIRDYRSKIETELSNICDGILKLLDSRLIPSACP  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_009128290.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
 emb|CDY14618.1| BnaC02g24950D [Brassica napus]
Length=260

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M SAREE VYMAKLAEQAERYEEMVEFMEKV A+ +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MVSAREEFVYMAKLAEQAERYEEMVEFMEKVSASVDGDELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGN+DHVA+I++YR KIE+ELT IC GILKLLDS+L+ AA SG+
Sbjct  60   RASWRIISSIEQKEESRGNDDHVAAIRDYRGKIETELTGICEGILKLLDSRLVPAAASGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGQE  143



>gb|AAD27823.2| 14-3-3 protein [Populus tremula x Populus alba]
Length=261

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  SAREE+VYMAKLAEQAERYEEMVE+MEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AATPSAREESVYMAKLAEQAERYEEMVEYMEKVSASLENEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YR+KIE+EL+SIC+GILKLLDS+LI  A++
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRAKIETELSSICDGILKLLDSRLIPTASA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|EYU36484.1| hypothetical protein MIMGU_mgv1a011964mg [Erythranthe guttata]
Length=265

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  110  NVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASWRII  289
            NVYMAKLAEQAERYEEMVEFMEKV A+    +ELTVEERNLLSVAYKNVIGARRASWRII
Sbjct  12   NVYMAKLAEQAERYEEMVEFMEKVSASLPENDELTVEERNLLSVAYKNVIGARRASWRII  71

Query  290  SSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVFYLK  469
            SSIEQKEESRGNEDHVA+IK YRSKIESEL  IC+GILKLLD++LI AA++G+SKVFYLK
Sbjct  72   SSIEQKEESRGNEDHVATIKGYRSKIESELAGICDGILKLLDTRLIPAASAGDSKVFYLK  131

Query  470  MKGDYHRYLAEFKTGAE  520
            MKGDYHRYLAEFKTGAE
Sbjct  132  MKGDYHRYLAEFKTGAE  148



>gb|AGJ98227.1| PIB01 14-3-3 protein, partial [Petunia x hybrida]
Length=142

 Score =   218 bits (555),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREENVYMAKLAEQAERYEEMVEFMEKV  +    EELTVEERNLLSVAYKNVIGARR
Sbjct  3    SSAREENVYMAKLAEQAERYEEMVEFMEKVSNSLAPNEELTVEERNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGNE+HV SIKEYRSKIE+EL+ IC+GILKLL++ L+ +A+SG+S
Sbjct  63   ASWRIISSIEQKEESRGNEEHVNSIKEYRSKIENELSKICDGILKLLETCLVPSASSGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKT  511
            KVFYLKMKGDYHRYLAEFKT
Sbjct  123  KVFYLKMKGDYHRYLAEFKT  142



>gb|AGC13184.1| 14-3-3 protein [Spinacia oleracea]
Length=266

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE+VYMAKLAEQAERYEEMVEFMEKVV+A+   EELTVEERNLLSVAYKNV+GARR
Sbjct  3    SSAREESVYMAKLAEQAERYEEMVEFMEKVVSASSEGEELTVEERNLLSVAYKNVVGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGNEDHV+ I++YRS+IE EL+  C+GILKLLD+KL+ AA+SG+S
Sbjct  63   ASWRIISSIEQKEESRGNEDHVSVIRDYRSRIEKELSDNCDGILKLLDTKLVPAASSGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTGA+
Sbjct  123  KVFYLKMKGDYHRYLAEFKTGAQ  145



>ref|XP_003602823.1| 14-3-3-like protein [Medicago truncatula]
Length=303

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEFMEKV A A+  E    E RNLLSVAYKNVIG
Sbjct  2    AAAHSPREENVYMAKLAEQAERYEEMVEFMEKVSANADNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|NP_001275217.1| 14-3-3 protein 2-like [Solanum tuberosum]
 emb|CAA72382.1| 14-3-3 protein [Solanum tuberosum]
 dbj|BAM28646.1| putative 14-3-3 protein, partial [Solanum tuberosum]
Length=254

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            AREENVYMAKLAEQAERYEEMV+FMEKV  +    E    E RNLLSVAYKNVIGARRAS
Sbjct  2    AREENVYMAKLAEQAERYEEMVQFMEKVSTSLGSEELTVEE-RNLLSVAYKNVIGARRAS  60

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNE+HV  IKEYRSKIESEL++IC+GILKLLDS LI +A++G+SKV
Sbjct  61   WRIISSIEQKEESRGNEEHVKCIKEYRSKIESELSNICDGILKLLDSNLIPSASNGDSKV  120

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFKTGAE
Sbjct  121  FYLKMKGDYHRYLAEFKTGAE  141



>ref|XP_010543865.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=262

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            ++AREENVYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  4    STAREENVYMAKLAEQAERYEEMVEFMEKVAGAVDNEELTVEE-RNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YR KIE+EL++IC+GILKLLDS+LI AA+SG+S
Sbjct  63   ASWRIISSIEQKEESRGNDDHVSVIRDYRGKIETELSNICDGILKLLDSRLIPAASSGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  123  KVFYLKMKGDYHRYLAEFKTGQE  145



>ref|XP_004252529.1| PREDICTED: 14-3-3 protein 2 [Solanum lycopersicum]
 sp|P93208.2|14332_SOLLC RecName: Full=14-3-3 protein 2 [Solanum lycopersicum]
 emb|CAA65146.2| 14-3-3 protein [Solanum lycopersicum]
Length=254

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            AREENVYMAKLAEQAERYEEMV+FMEKV  +    E    E RNLLSVAYKNVIGARRAS
Sbjct  2    AREENVYMAKLAEQAERYEEMVQFMEKVSTSLGSEELTVEE-RNLLSVAYKNVIGARRAS  60

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNE+HV  IKEYRSKIESEL+ IC+GILKLLDS LI +A++G+SKV
Sbjct  61   WRIISSIEQKEESRGNEEHVKCIKEYRSKIESELSDICDGILKLLDSNLIPSASNGDSKV  120

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFKTGAE
Sbjct  121  FYLKMKGDYHRYLAEFKTGAE  141



>ref|XP_010916166.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=261

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GILKLLDS LI +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAMIKEYRGKIEAELSKICDGILKLLDSHLIPSATAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010521176.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=260

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REE VYMAKLAEQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    STREEYVYMAKLAEQAERYEEMVEFMEKVSASVENEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHVA+I+EYRSKIESEL+ IC+GILKLLDS+LI +A SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVAAIREYRSKIESELSGICDGILKLLDSRLIPSAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>gb|KDP40925.1| hypothetical protein JCGZ_24924 [Jatropha curcas]
Length=261

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
             S RE+NVYMAKLAEQAERYEEMV+FMEKVV +   ++ELTVEERNLLSVAYKNVIGARR
Sbjct  4    GSPREDNVYMAKLAEQAERYEEMVQFMEKVVFSTPESDELTVEERNLLSVAYKNVIGARR  63

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN DHVA+IKEYR+KIE EL+ IC GILKLLD KL+ AA +G+S
Sbjct  64   ASWRIISSIEQKEESRGNADHVAAIKEYRAKIEGELSEICGGILKLLDEKLVPAAATGDS  123

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  124  KVFYLKMKGDYHRYLAEFKTGNE  146



>ref|XP_004299669.1| PREDICTED: 14-3-3-like protein [Fragaria vesca subsp. vesca]
Length=260

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            + REENVYMAKLAEQAERYEEMVEF+EKV A+A+  E    E RNLLSVAYKNVIGARRA
Sbjct  5    TPREENVYMAKLAEQAERYEEMVEFVEKVSASADKEELTVEE-RNLLSVAYKNVIGARRA  63

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV+ I+EYRSKIE+EL+ IC+GILKLLDS+LI +A SG+SK
Sbjct  64   SWRIISSIEQKEESRGNDDHVSMIREYRSKIETELSGICDGILKLLDSRLIPSACSGDSK  123

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  124  VFYLKMKGDYHRYLAEFKTGAE  145



>ref|XP_006302543.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
 gb|EOA35441.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
Length=327

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  77   TQASMA-SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKN  253
            T  +MA SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKN
Sbjct  61   TVTTMAVSAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKN  119

Query  254  VIGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGA  433
            VIGARRASWRIISSIEQKEESRGNEDHV +I++YRSKIE+EL+ IC+GILKLLDS+LI A
Sbjct  120  VIGARRASWRIISSIEQKEESRGNEDHVTAIRDYRSKIETELSGICDGILKLLDSRLIPA  179

Query  434  ATSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            A SG+SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  180  AASGDSKVFYLKMKGDYHRYLAEFKTGQE  208



>ref|XP_007223394.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
 gb|EMJ24593.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
Length=262

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEF+EKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ATTPSPREENVYMAKLAEQAERYEEMVEFVEKVSASAEKEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA I++YRSKIE+EL++IC+GILKLLDS+LI +A +
Sbjct  62   ARRASWRIISSIEQKEESRGNDDHVAMIRDYRSKIETELSNICDGILKLLDSRLIPSAFA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGTE  147



>ref|XP_002887733.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63992.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLDS+LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVTAIRDYRSKIETELSGICDGILKLLDSRLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>gb|KFK42215.1| hypothetical protein AALP_AA2G226400 [Arabis alpina]
Length=262

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHVA+I++YRSKIE+EL+ IC+GILKLLDS+L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVATIRDYRSKIETELSGICDGILKLLDSRLVPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_003544808.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=261

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  + REE VYMAKLAEQAERYEEMVEFMEKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  2    ASAPTPREEFVYMAKLAEQAERYEEMVEFMEKVSASAESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA I++YRSKIE+EL++IC+GILKLLD++L+ +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIEAELSNICDGILKLLDTRLVPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGA+
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAD  146



>ref|XP_010428953.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=260

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV++I++YRSKIE+ELT IC+GILKLLDS+LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVSAIRDYRSKIETELTGICDGILKLLDSRLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKT  E
Sbjct  123  VFYLKMKGDYHRYLAEFKTSEE  144



>ref|XP_007141044.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
 gb|ESW13038.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
Length=261

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  S REE VYMAKLAEQAERYEEMVEFMEKV AAAE  E    E RNLLSVAYKNVIG
Sbjct  2    ASAPSPREEFVYMAKLAEQAERYEEMVEFMEKVSAAAENEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+L+ +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLVPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTG +
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGGD  146



>ref|NP_001239690.1| uncharacterized protein LOC100798989 [Glycine max]
 gb|ACU21064.1| unknown [Glycine max]
Length=262

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  + REE VYMAKLAEQAERYEEMVEFMEKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ASAPTPREEFVYMAKLAEQAERYEEMVEFMEKVSASAESEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA I++YRSKIE+EL++IC+GILKLLD++L+ +A S
Sbjct  62   ARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIEAELSNICDGILKLLDTRLVPSAAS  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGA+
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGAD  147



>ref|XP_006423811.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 ref|XP_006492624.1| PREDICTED: 14-3-3 protein 6-like [Citrus sinensis]
 gb|ESR37051.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 gb|KDO45012.1| hypothetical protein CISIN_1g024897mg [Citrus sinensis]
Length=261

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMV++MEKVVA+A   EELTVEERNLLSVAYKNVIGARRA
Sbjct  5    SPREENVYMAKLAEQAERYEEMVQYMEKVVASASTGEELTVEERNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRI+SSIEQKEESRGN+DHV+ IKEYRSKIE+ELT IC GILKLLD KL+ AA + +SK
Sbjct  65   SWRIVSSIEQKEESRGNQDHVSVIKEYRSKIEAELTEICGGILKLLDQKLVPAAAAADSK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGDE  146



>ref|XP_010535331.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEYVYMAKLAEQAERYEEMVEFMEKVSASVENEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHVA+I++YR+KIESEL+ IC+GILKLLDS+LI +A SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVAAIRDYRAKIESELSGICDGILKLLDSRLIPSAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_009104576.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLDS+L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVTAIRDYRSKIETELSGICDGILKLLDSRLVPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>emb|CDX79255.1| BnaC06g20480D [Brassica napus]
 emb|CDX68022.1| BnaA07g20620D [Brassica napus]
Length=260

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLDS+L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVTAIRDYRSKIETELSGICDGILKLLDSRLVPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_008219335.1| PREDICTED: 14-3-3-like protein [Prunus mume]
Length=262

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REENVYMAKLAEQAERYEEMVEF+EKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ATTPSPREENVYMAKLAEQAERYEEMVEFVEKVSASAEKEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHVA I++YRSKIE+EL++IC+GILKLLDS+LI +A +
Sbjct  62   ARRASWRIISSIEQKEESRGNDDHVAMIRDYRSKIETELSNICDGILKLLDSRLIPSAFA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTGNE  147



>gb|AFK35595.1| unknown [Lotus japonicus]
Length=259

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S REE VY+AKLAEQAERYEEMVEFMEK+ AA +G E    E RNLLSVAYKNVIG
Sbjct  2    AAAPSPREEFVYLAKLAEQAERYEEMVEFMEKLSAAVDGEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+LI AA S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSIIRDYRSKIESELSNICDGILKLLDSRLIPAAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGTE  146



>gb|AGV54291.1| 14-3-3 protein [Phaseolus vulgaris]
Length=261

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  S REE VYMAKLAEQAERYEEMVEFMEKV AAAE  E    E RNLLSVAYKNVIG
Sbjct  2    ASAPSPREEFVYMAKLAEQAERYEEMVEFMEKVSAAAENEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV+ I++YRSKIESEL++IC+GILKLLDS+L+ +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSVIRDYRSKIESELSNICDGILKLLDSRLVPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTG +
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGGD  146



>gb|AAK26634.1|AF342780_1 GF14 omega [Brassica napus]
Length=260

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLDS+L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVTAIRDYRSKIETELSGICDGILKLLDSRLVPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_008775117.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008775124.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=262

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMV+FMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVDFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GILKLLDS LI +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAMIKEYRGKIEAELSKICDGILKLLDSHLIPSATAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_007200586.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
 ref|XP_008237283.1| PREDICTED: 14-3-3-like protein 16R [Prunus mume]
 gb|EMJ01785.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
Length=262

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  S REENVY+AKLAEQAERYEEMVEFMEKVV++    EE TVEERNLLSVAYKNVIGA
Sbjct  2    ATPSPREENVYVAKLAEQAERYEEMVEFMEKVVSSVPEGEEPTVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEESRGN DHVA+IK+YR++IE+EL++IC GILKLLDSKL+ +A  G
Sbjct  62   RRASWRIVSSIEQKEESRGNSDHVATIKDYRARIENELSNICGGILKLLDSKLVPSANVG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTGNE  146



>ref|XP_006389998.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
 gb|ABY86894.1| 14-3-3 protein GF14 omega [Eutrema halophilum]
 gb|ESQ27284.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
Length=260

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLDS LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVKAIRDYRSKIETELSGICDGILKLLDSTLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_006853053.1| hypothetical protein AMTR_s00038p00055100 [Amborella trichopoda]
 gb|ERN14520.1| hypothetical protein AMTR_s00038p00055100 [Amborella trichopoda]
Length=264

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFME V    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMENVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIESEL+ IC+GIL+LLDS LI ++T+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIESELSKICDGILRLLDSHLIPSSTAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009404035.1| PREDICTED: 14-3-3 protein 6 [Musa acuminata subsp. malaccensis]
Length=256

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA  REENVYMAKLAEQAERYEEMVEFMEKV  AA   EELTVEERNLLSVAYKNV+GAR
Sbjct  1    MAGTREENVYMAKLAEQAERYEEMVEFMEKVTGAAMEGEELTVEERNLLSVAYKNVVGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRI+SSIEQKEESRGNE HVA+I++YR+KIE+ELTSIC GIL+LLD +L+ +A++ +
Sbjct  61   RASWRIVSSIEQKEESRGNEGHVAAIRDYRAKIETELTSICGGILRLLDERLVPSASAAD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTG++
Sbjct  121  SKVFYLKMKGDYHRYLAEFKTGSD  144



>ref|XP_009388642.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388643.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388644.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388645.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388647.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            + + S REENVY+AKLAEQAERYEEMVEFMEKVV      E    E RNLLSVAYKNVIG
Sbjct  2    SPVESPREENVYLAKLAEQAERYEEMVEFMEKVVKTINKEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA IKEYR K+E+EL+ IC+GILKLLDS L+ +ATS
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVALIKEYRGKVEAELSKICDGILKLLDSHLVPSATS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  AESKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|ADK93080.1| 14-3-3g protein [Gossypium hirsutum]
 gb|KHG21797.1| Uncharacterized protein F383_27919 [Gossypium arboreum]
Length=262

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFME V    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMENVAKTVDVGELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA+IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVATIKEYRSKIEAELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|EPS72907.1| 14-3-3 a-1 protein [Genlisea aurea]
Length=255

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY+AKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYLAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEE+RGN+  V++IK YRSKIESEL+ IC GILKLLDSKL+G A SG+
Sbjct  60   RASWRIISSIEQKEENRGNDGQVSTIKTYRSKIESELSDICGGILKLLDSKLVGTAASGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFK GAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKIGAE  143



>gb|EPS73301.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MAS REENVY AKLAEQAERYEEMVEFMEKVV A +G E    E RNLLSVAYKNVIGAR
Sbjct  1    MASPREENVYKAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEE+RGNE HV++IK YRSKIESEL+SIC+GILKLLDSKLI +A++G+
Sbjct  60   RASWRIISSIEQKEENRGNEGHVSTIKVYRSKIESELSSICDGILKLLDSKLIVSASNGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFK GAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKIGAE  143



>ref|XP_004234565.1| PREDICTED: 14-3-3-like protein [Solanum lycopersicum]
Length=258

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA +REENVYMAKLAEQAERYEEMVEFMEKV         +    RNLLSVAYKNVIGAR
Sbjct  1    MADSREENVYMAKLAEQAERYEEMVEFMEKVAKVDVEELTVEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV+SIKEYR+KIE+EL+ IC+GIL LL+S L+ +A++  
Sbjct  59   RASWRIISSIEQKEESRGNEDHVSSIKEYRAKIEAELSKICDGILSLLESHLVPSASTAE  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  119  SKVFYLKMKGDYHRYLAEFKTGAE  142



>ref|XP_004136278.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004169036.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN60225.1| hypothetical protein Csa_3G889810 [Cucumis sativus]
Length=258

 Score =   219 bits (557),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A  +S REE VYMAKLAEQAERYEEMVEFMEKV AAA+  E    E RNLLSVAYKNVIG
Sbjct  2    AVTSSPREEYVYMAKLAEQAERYEEMVEFMEKVSAAADDEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV+ I+ YRSKIE+EL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSVIRGYRSKIETELSNICDGILKLLDSRLISSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>gb|ABQ95992.1| 14-3-3-like protein [Cicer arietinum]
 gb|ABQ95994.1| 14-3-3-like protein [Cicer arietinum]
Length=261

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMVEFMEKV AA E  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPTPREEFVYMAKLAEQAERYEEMVEFMEKVTAAVESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HVA I++YRSKIE+EL++ICNGILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDEHVAVIRDYRSKIEAELSNICNGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFK+GAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_008466219.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=258

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A  +S REE VYMAKLAEQAERYEEMVEFMEKV AA +  E    E RNLLSVAYKNVIG
Sbjct  2    AVTSSPREEYVYMAKLAEQAERYEEMVEFMEKVSAATDNEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV+ I+ YRSKIE+EL++IC+GILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSVIRGYRSKIETELSNICDGILKLLDSRLISSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010472047.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=262

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIE+ELT IC+GILKLLDS+LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVLAIRDYRSKIETELTGICDGILKLLDSRLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKT  E
Sbjct  123  VFYLKMKGDYHRYLAEFKTAQE  144



>ref|XP_010680999.1| PREDICTED: 14-3-3 protein 2-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=259

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAR+ENVYMAKLAEQAERYEEMVEFMEKVV+AA   EELTVEERNLLSVAYKNVIGARR
Sbjct  4    SSARDENVYMAKLAEQAERYEEMVEFMEKVVSAACEGEELTVEERNLLSVAYKNVIGARR  63

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRI+SSIEQKEESRGNEDHV++IK YRSKIESEL+ IC+GILKLL+SKLI  A++ +S
Sbjct  64   ASWRIVSSIEQKEESRGNEDHVSTIKSYRSKIESELSKICDGILKLLESKLIPVASNPDS  123

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDY+RYLAEF TG+E
Sbjct  124  KVFYLKMKGDYYRYLAEFTTGSE  146



>ref|XP_010680998.1| PREDICTED: 14-3-3 protein 2-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=260

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAR+ENVYMAKLAEQAERYEEMVEFMEKVV+AA   EELTVEERNLLSVAYKNVIGARR
Sbjct  4    SSARDENVYMAKLAEQAERYEEMVEFMEKVVSAACEGEELTVEERNLLSVAYKNVIGARR  63

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRI+SSIEQKEESRGNEDHV++IK YRSKIESEL+ IC+GILKLL+SKLI  A++ +S
Sbjct  64   ASWRIVSSIEQKEESRGNEDHVSTIKSYRSKIESELSKICDGILKLLESKLIPVASNPDS  123

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDY+RYLAEF TG+E
Sbjct  124  KVFYLKMKGDYYRYLAEFTTGSE  146



>ref|XP_010025879.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
 gb|KCW83076.1| hypothetical protein EUGRSUZ_B00034 [Eucalyptus grandis]
Length=263

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  101  REENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASW  280
            REE VYMAKLAEQAERYEEMVEFMEKV AAA  AEELTVEERNLLSVAYKNVIGARRASW
Sbjct  12   REEYVYMAKLAEQAERYEEMVEFMEKVSAAAADAEELTVEERNLLSVAYKNVIGARRASW  71

Query  281  RIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVF  460
            RIISSIEQKEESRGNEDHVA+I++YR+KIE+EL+ IC+GIL LLD++LI AA+ G+SKVF
Sbjct  72   RIISSIEQKEESRGNEDHVAAIRDYRAKIEAELSKICDGILGLLDTRLIPAASVGDSKVF  131

Query  461  YLKMKGDYHRYLAEFKTGAE  520
            YLKMKGDYHRYLAEFKTG E
Sbjct  132  YLKMKGDYHRYLAEFKTGTE  151



>ref|XP_009419276.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419277.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFME VV    G E    E RNLLSVAYKNVIGARRA
Sbjct  6    SPREENVYMAKLAEQAERYEEMVEFMETVVKTINGEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IKEYRSK+E+EL+ IC+GILKLLD+ L+ +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVTLIKEYRSKVEAELSKICDGILKLLDTHLVPSATTAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_008782168.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA AREENVYMAKLAEQAERYEEMVEFMEKV  AA   EELTVEERNLLSVAYKNVIGAR
Sbjct  1    MAGAREENVYMAKLAEQAERYEEMVEFMEKVAGAAVEGEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRI+SSIEQKEESRGNEDHVA+I++YR+KIE+ELT IC GILKLL+  LI +A++  
Sbjct  61   RASWRIVSSIEQKEESRGNEDHVAAIRDYRAKIETELTDICKGILKLLEVSLIPSASAAE  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKM GDYHRYLAEFKTG++
Sbjct  121  SKVFYLKMTGDYHRYLAEFKTGSD  144



>ref|XP_009387444.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009387445.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009387446.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009387447.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=260

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+RE+NVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREDNVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYR KIE+EL+ IC+GILKLLDS LI ++T+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSLIKEYRGKIEAELSKICDGILKLLDSHLISSSTTAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010416813.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=262

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV++I++YRSKIE+ELT IC+GIL+LLDS+LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVSAIRDYRSKIETELTGICDGILRLLDSRLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKT  E
Sbjct  123  VFYLKMKGDYHRYLAEFKTAQE  144



>gb|AEA03664.1| 14-3-3 protein 3 [Hevea brasiliensis]
Length=264

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   S+REE++YMAKLAEQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIG
Sbjct  2    AVAPSSREESIYMAKLAEQAERYEEMVEFMEKVSASVEKEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV+ I++YR+KIESEL+SIC+GILKLLD++LI  A+ 
Sbjct  61   ARRASWRIISSIEQKEESRGNENHVSMIRDYRAKIESELSSICDGILKLLDTRLIPPASP  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>dbj|BAB68528.1| 14-3-3 protein [Nicotiana tabacum]
Length=204

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A   +AREENVYMAKLAE AE Y+EMVEFMEKV  +    E    E RNLLSVAYKNVIG
Sbjct  2    AVAPTAREENVYMAKLAEPAEMYQEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLD+KLI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010939692.1| PREDICTED: 14-3-3 protein 6-like [Elaeis guineensis]
Length=257

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA+ REENVYMAKLAEQAERYEEMVEFMEKV AA    EELTVEERNLLSVAYKNVIGAR
Sbjct  1    MAATREENVYMAKLAEQAERYEEMVEFMEKVTAATVEGEELTVEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRI+SSIEQKEESRGN+DHVA+I +YR++IE+ELT IC+GILKLLDS+L+ +A   +
Sbjct  61   RASWRIVSSIEQKEESRGNQDHVAAIHDYRARIETELTKICDGILKLLDSRLVPSAAVVD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG++
Sbjct  121  SKVFYLKMKGDYYRYLAEFKTGSD  144



>gb|KDO58965.1| hypothetical protein CISIN_1g024714mg [Citrus sinensis]
Length=219

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSVIKEYRSKIENELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|NP_001234107.1| 14-3-3 family protein [Solanum lycopersicum]
 gb|AAL04426.1| 14-3-3 family protein [Solanum lycopersicum]
Length=256

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAER-YEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            MAS REENVYMAK AEQAER YEEMVEFMEKVV +  G E    E RNLLSV Y  +IGA
Sbjct  1    MASPREENVYMAKFAEQAERSYEEMVEFMEKVVFSLNGEELTVEE-RNLLSVPYGGLIGA  59

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRIISSIEQKEESRGNEDHVASIK+YRS+IE+ELTSICNGILKLLDSKLIG+A +G
Sbjct  60   RRASWRIISSIEQKEESRGNEDHVASIKKYRSQIENELTSICNGILKLLDSKLIGSAATG  119

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDY+RYLAEFKTG E
Sbjct  120  DSKVFYLKMKGDYYRYLAEFKTGTE  144



>ref|XP_010534083.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKL+EQAERYEEMVEFMEKV A+ E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEYVYMAKLSEQAERYEEMVEFMEKVSASVENEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLDS++I +A SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVTAIRDYRSKIESELSGICDGILKLLDSRIIPSAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_010530165.1| PREDICTED: 14-3-3-like protein GF14 chi [Tarenaya hassleriana]
Length=260

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAR+ENVYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  4    SSARDENVYMAKLAEQAERYEEMVEFMEKVANAGDNKELTVEE-RNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YR KIE+EL++IC+GILKLLD++LI  A++G+S
Sbjct  63   ASWRIISSIEQKEESRGNDDHVSIIRDYRGKIETELSNICDGILKLLDTRLIPGASAGDS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  123  KVFYLKMKGDYHRYLAEFKTGQE  145



>ref|XP_009350360.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +S REENVY+AKLAEQAERYEEMVEFMEKVV++    EE TVEERNLLSVAYKNVIGARR
Sbjct  4    SSPREENVYVAKLAEQAERYEEMVEFMEKVVSSLPEGEEPTVEERNLLSVAYKNVIGARR  63

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRI+SSIEQKEESRGN DHVA+IKEYR++IE+EL++IC GILK+L+SKL+ AA  G S
Sbjct  64   ASWRIVSSIEQKEESRGNSDHVATIKEYRARIENELSNICGGILKVLESKLVPAANVGES  123

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  124  KVFYLKMKGDYHRYLAEFKTGDE  146



>ref|XP_006430798.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 ref|XP_006430799.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 ref|XP_006482271.1| PREDICTED: 14-3-3-like protein-like isoform X1 [Citrus sinensis]
 ref|XP_006482272.1| PREDICTED: 14-3-3-like protein-like isoform X2 [Citrus sinensis]
 gb|ESR44038.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 gb|ESR44039.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 gb|KDO58963.1| hypothetical protein CISIN_1g024714mg [Citrus sinensis]
 gb|KDO58964.1| hypothetical protein CISIN_1g024714mg [Citrus sinensis]
Length=263

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSVIKEYRSKIENELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009114721.1| PREDICTED: 14-3-3-like protein GF14 phi [Brassica rapa]
 emb|CDY12024.1| BnaAnng02090D [Brassica napus]
Length=261

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MASAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MASAREEFVYLAKLAEQAERYEEMVEFMEKVTEAVDKDELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGN+DHV +I++YRSKIE+EL+ IC+GILKLLD++LI A+ +G+
Sbjct  60   RASWRIISSIEQKEESRGNDDHVNTIRDYRSKIETELSKICDGILKLLDTRLIPASANGD  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKT  E
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTAQE  143



>ref|XP_006397430.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
 gb|ADO95302.1| 14-3-3-like protein GF14 Phi [Eutrema salsugineum]
 gb|ESQ38883.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
Length=267

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  8    SSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARR  66

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++LI A+ +G+S
Sbjct  67   ASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLIPASANGDS  126

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  127  KVFYLKMKGDYHRYLAEFKTGQE  149



>ref|XP_009357045.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357046.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357047.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
Length=262

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRSKIETELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>ref|NP_001280837.1| 14-3-3-like protein A [Malus domestica]
 gb|AAV50005.1| 14-3-3 family protein [Malus domestica]
Length=262

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRSKIETELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>sp|P93209.1|14333_SOLLC RecName: Full=14-3-3 protein 3; AltName: Full=PBLT3 [Solanum 
lycopersicum]
 emb|CAA65147.1| 14-3-3 protein [Solanum lycopersicum]
Length=260

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            +AREENVYMAKLA++AE  EEMVEFMEKV  +    E    E RNLLSVAYKNVIGARRA
Sbjct  7    TAREENVYMAKLADRAESDEEMVEFMEKVSNSLGSEELTVEE-RNLLSVAYKNVIGARRA  65

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNE+HV SI+EYRSKIE+EL+ IC+GILKLLDSKLI +ATSG+SK
Sbjct  66   SWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDSKLIPSATSGDSK  125

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  126  VFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_002891161.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67420.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  8    SSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARR  66

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+S
Sbjct  67   ASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDS  126

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  127  KVFYLKMKGDYHRYLAEFKTGQE  149



>emb|CDX91996.1| BnaC03g32980D [Brassica napus]
Length=261

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+SAREENVY+AKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MSSAREENVYLAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVA IK+YR KIE+EL  IC+GIL LLD+ LI AA+   
Sbjct  60   RASWRIISSIEQKEESRGNEDHVALIKDYRGKIETELGKICDGILNLLDTHLIPAASLAE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A 
PYRAZOLE Derivative
Length=243

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = +2

Query  83   ASMA-SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVI  259
             SMA S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVI
Sbjct  4    GSMAESTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVI  62

Query  260  GARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAAT  439
            GARRASWRIISSIEQKEESRGNEDHV+SIKEYR KIE+EL+ IC+GIL LL+S LI  A+
Sbjct  63   GARRASWRIISSIEQKEESRGNEDHVSSIKEYRGKIEAELSKICDGILNLLESHLIPVAS  122

Query  440  SGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            +  SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  TAESKVFYLKMKGDYHRYLAEFKTGAE  149



>emb|CDY28698.1| BnaCnng05840D [Brassica napus]
Length=261

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S REENVY+AKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MSSPREENVYLAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVA IK+YR KIE+EL+ IC+GIL LLDS L+ AA+   
Sbjct  60   RASWRIISSIEQKEESRGNEDHVAIIKDYRGKIETELSKICDGILNLLDSHLVPAASLAE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>ref|XP_009147332.1| PREDICTED: 14-3-3-like protein GF14 nu [Brassica rapa]
 emb|CDY51543.1| BnaA05g33430D [Brassica napus]
Length=261

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S REENVY+AKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MSSPREENVYLAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVA IK+YR KIE+EL+ IC+GIL LLDS L+ AA+   
Sbjct  60   RASWRIISSIEQKEESRGNEDHVAIIKDYRGKIETELSKICDGILNLLDSHLVPAASLAE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>ref|XP_008804781.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
 ref|XP_008804782.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=260

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 2/146 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegae--eltveeRNLLSVAYKNVIG  262
            MA  REENVYMAKLAEQAERYEEMVEFMEKV AAA  AE  ELTVEERNLLSVAYKNVIG
Sbjct  1    MAGEREENVYMAKLAEQAERYEEMVEFMEKVTAAAAAAEGEELTVEERNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRI+SSIEQKEESRGNEDHVA+I++YR++IE+ELTSIC+GILKLLD+ LI +A+ 
Sbjct  61   ARRASWRIVSSIEQKEESRGNEDHVAAIRDYRARIEAELTSICSGILKLLDASLIPSASV  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
             +SKVFYLKMKGDYHRYLAEFKTG++
Sbjct  121  SDSKVFYLKMKGDYHRYLAEFKTGSD  146



>gb|KJB10444.1| hypothetical protein B456_001G201400 [Gossypium raimondii]
Length=262

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFME V    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMENVAKTVDVGELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA+IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVATIKEYRSKIEAELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKT AE
Sbjct  125  VFYLKMKGDYHRYLAEFKTAAE  146



>ref|NP_564453.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 sp|P46077.2|14334_ARATH RecName: Full=14-3-3-like protein GF14 phi; AltName: Full=General 
regulatory factor 4 [Arabidopsis thaliana]
 gb|AAG50610.1|AC079605_15 14-3-3 protein, putative [Arabidopsis thaliana]
 gb|AAB06231.1| GF14 protein phi chain [Arabidopsis thaliana]
 gb|AAB62224.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 gb|AAM60925.1| 14-3-3 protein GF14phi (grf4) [Arabidopsis thaliana]
 gb|AEE31760.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
Length=267

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  8    SSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARR  66

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+S
Sbjct  67   ASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDS  126

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  127  KVFYLKMKGDYHRYLAEFKTGQE  149



>ref|XP_008362235.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362236.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362237.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368488.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368489.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368490.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
Length=261

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRSKIEAELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>gb|AAK63949.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
 gb|AAL31165.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
Length=267

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  8    SSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARR  66

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+S
Sbjct  67   ASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDS  126

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  127  KVFYLKMKGDYHRYLAEFKTGQE  149



>ref|XP_011011192.1| PREDICTED: 14-3-3-like protein A [Populus euphratica]
Length=262

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVTIIKEYRSKIEAELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_010265205.1| PREDICTED: 14-3-3-like protein [Nelumbo nucifera]
 ref|XP_010265206.1| PREDICTED: 14-3-3-like protein [Nelumbo nucifera]
 ref|XP_010265207.1| PREDICTED: 14-3-3-like protein [Nelumbo nucifera]
Length=262

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REE+VYMAKLAEQAERYEEMVEFME VV   +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREESVYMAKLAEQAERYEEMVEFMETVVKIVDSEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA+IKEYR KIESEL+ IC+GIL+LL+S LI ++T+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAAIKEYRGKIESELSKICDGILRLLESHLIPSSTAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>sp|O49997.1|1433E_TOBAC RecName: Full=14-3-3-like protein E [Nicotiana tabacum]
 gb|AAC49894.1| 14-3-3 isoform e [Nicotiana tabacum]
Length=272

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  4    STREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+SIKEYR KIE+EL+ IC+GIL LL+S LI  A++  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVSSIKEYRGKIEAELSKICDGILNLLESHLIPVASTAESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>ref|NP_001275262.1| 14-3-3-like protein [Solanum tuberosum]
 sp|Q41418.1|14331_SOLTU RecName: Full=14-3-3-like protein [Solanum tuberosum]
 emb|CAA66309.1| 14-3-3 protein [Solanum tuberosum]
Length=259

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA +REENVYMAKLAEQAERYEEMVEFMEKV         +    RNLLSVAYKNVIGAR
Sbjct  1    MADSREENVYMAKLAEQAERYEEMVEFMEKVAKVDVEELTVEE--RNLLSVAYKNVIGAR  58

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHV+SIKEYR KIE+EL+ IC+GIL LL+S L+ +A++  
Sbjct  59   RASWRIISSIEQKEESRGNEDHVSSIKEYRVKIEAELSKICDGILSLLESHLVPSASTAE  118

Query  449  SKVFYLKMKGDYHRYLAEFKTGA  517
            SKVFYLKMKGDYHRYLAEFKTGA
Sbjct  119  SKVFYLKMKGDYHRYLAEFKTGA  141



>ref|XP_009403466.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009403467.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKVV    G E    E RNLLSVAYKNVIGARRA
Sbjct  6    SPREENVYMAKLAEQAERYEEMVEFMEKVVKTINGQELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEY  K+E+EL+ IC+GILKLLDS L  +ATS  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVALIKEYSGKVEAELSKICDGILKLLDSHLTPSATSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>sp|P93259.1|1433_MESCR RecName: Full=14-3-3-like protein; AltName: Full=G-box-binding 
factor [Mesembryanthemum crystallinum]
 gb|AAB40395.1| 14-3-3-like protein [Mesembryanthemum crystallinum]
Length=264

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            S  S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGA
Sbjct  2    SSESSREENVYMAKLAEQAERYEEMVEFMEKVAKMTDTEELSVEE-RNLLSVAYKNVIGA  60

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRIISSIEQKEESRGNEDHV++IKEYR KIE+EL+ IC+GIL LL+S LI +A++ 
Sbjct  61   RRASWRIISSIEQKEESRGNEDHVSTIKEYRGKIETELSKICDGILNLLESHLIPSASTA  120

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
             SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  ESKVFYLKMKGDYHRYLAEFKTGAE  145



>gb|KJB12045.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12047.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12048.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
Length=269

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  S+REE VYMAKLAEQAERY+EMVEFMEKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ASTPSSREEFVYMAKLAEQAERYDEMVEFMEKVSASAESEELSVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRI+SSIEQKEESRGNEDHV  I++YR+KIESEL+SIC GILKLLDS+LI +A +
Sbjct  62   ARRASWRIVSSIEQKEESRGNEDHVTLIRDYRAKIESELSSICGGILKLLDSRLIPSAAA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
             +SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  KDSKVFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_010421819.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            + +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGA
Sbjct  5    TASSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGA  63

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG
Sbjct  64   RRASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASG  123

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDYHRYLAEFK+G E
Sbjct  124  DSKVFYLKMKGDYHRYLAEFKSGQE  148



>gb|ADP00759.1| 14-3-3 protein [Litchi chinensis]
Length=261

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMV+FMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVDFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIESEL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAVIKEYRGKIESELSKICDGILGLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|ADO95306.1| 14-3-3-like protein GF14 Omega [Eutrema salsugineum]
Length=260

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YRS IE+EL+ IC+GILKLLDS LI AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVKAIRDYRSFIETELSGICDGILKLLDSTLIPAAASGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_009388227.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388229.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+RE+NVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREDNVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYR KIE+EL+ IC+GILKLLDS LI ++ +  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSVIKEYRGKIETELSKICDGILKLLDSHLIPSSAAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_002965976.1| hypothetical protein SELMODRAFT_439395 [Selaginella moellendorffii]
 ref|XP_002989248.1| hypothetical protein SELMODRAFT_184464 [Selaginella moellendorffii]
 gb|EFJ09686.1| hypothetical protein SELMODRAFT_184464 [Selaginella moellendorffii]
 gb|EFJ33396.1| hypothetical protein SELMODRAFT_439395 [Selaginella moellendorffii]
Length=251

 Score =   216 bits (550),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M S REE+VYMAKLAEQAERY+EMVEFM+ VV A +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MTSPREESVYMAKLAEQAERYDEMVEFMKNVVKAVDVEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEES+GNEDHV+ IKEYR+K+E+EL++IC+ ILKLLDS LI ++ SG 
Sbjct  60   RASWRIISSIEQKEESKGNEDHVSMIKEYRAKVEAELSTICDSILKLLDSHLISSSASGE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>ref|XP_010455312.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>ref|XP_003615160.1| 14-3-3 protein [Medicago truncatula]
 gb|ACJ84712.1| unknown [Medicago truncatula]
 gb|AES98118.1| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMV+FMEKV AA E  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPTPREEFVYMAKLAEQAERYEEMVDFMEKVTAAVESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HV  I++YRSKIE+EL++ICNGILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDEHVTVIRDYRSKIEAELSNICNGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFK+GAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_008230392.1| PREDICTED: 14-3-3-like protein A [Prunus mume]
Length=262

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+RE+NVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREDNVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRSKIETELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>ref|XP_009106540.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEYVYMAKLAEQAERYEEMVEFMEKVSAAIDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YR+KIE+EL+ IC+GILKLLD +L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVKAIRDYRAKIETELSGICDGILKLLDDRLVPAAGSGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>gb|ACK76233.1| 14-3-3 protein [Dimocarpus longan]
Length=261

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IK+YR KIESEL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAVIKDYRGKIESELSKICDGILGLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009615235.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana tomentosiformis]
 ref|XP_009615236.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana tomentosiformis]
 dbj|BAD12177.1| 14-3-3 e-2 protein [Nicotiana tabacum]
Length=260

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  4    STREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+SIKEYR KIE+EL+ IC+GIL LL+S LI  A++  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVSSIKEYRGKIEAELSKICDGILNLLESHLIPVASTAESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>gb|KHG19539.1| Uncharacterized protein F383_05852 [Gossypium arboreum]
Length=262

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            +S  S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIG
Sbjct  2    SSTESSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA +KEYR KIE+EL+ IC+GIL LL+S LI  A+S
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAQLKEYRGKIEAELSKICDGILSLLESHLIPLASS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  AESKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_009800018.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana sylvestris]
 ref|XP_009800019.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana sylvestris]
 dbj|BAD12176.1| 14-3-3 e-1 protein [Nicotiana tabacum]
Length=260

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  4    STREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+SIKEYR KIE+EL+ IC+GIL LL+S LI  A++  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVSSIKEYRGKIEAELSKICDGILNLLESHLIPVASTAESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>ref|NP_001185138.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 gb|AEE31761.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
Length=295

 Score =   217 bits (553),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  8    SSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARR  66

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+S
Sbjct  67   ASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDS  126

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  127  KVFYLKMKGDYHRYLAEFKTGQE  149



>ref|XP_010263205.1| PREDICTED: 14-3-3-like protein [Nelumbo nucifera]
 ref|XP_010263212.1| PREDICTED: 14-3-3-like protein [Nelumbo nucifera]
Length=262

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFME V    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMENVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA+IKEYR KIESEL+ IC+GIL LL+S LI ++++  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAAIKEYRGKIESELSKICDGILHLLESHLIPSSSAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|KJB77545.1| hypothetical protein B456_012G142900 [Gossypium raimondii]
 gb|KJB77546.1| hypothetical protein B456_012G142900 [Gossypium raimondii]
Length=213

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  S REENVYMAKLAEQAERYEEMV+FME VV+A    +EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATPSPREENVYMAKLAEQAERYEEMVKFMENVVSAVPAPDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHVA I++YR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVAVIRDYRAKIEAELSEICAGILKLLDEKLVPAAGNG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>ref|XP_008790917.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=264

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  101  REENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASW  280
            REENVYMAKLAEQAERYEEMVEFMEKV AA    EELTVEERNLLSVAYKNVIGARRASW
Sbjct  12   REENVYMAKLAEQAERYEEMVEFMEKVTAATADGEELTVEERNLLSVAYKNVIGARRASW  71

Query  281  RIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVF  460
            RI+SSIEQKEESRGN+DHVA+I +YR++IE+ELT IC+GILKLLDS+L+ +A   +SKVF
Sbjct  72   RIVSSIEQKEESRGNQDHVAAIHDYRARIEAELTKICDGILKLLDSRLVPSAAVADSKVF  131

Query  461  YLKMKGDYHRYLAEFKTGAE  520
            YLKMKGDY+RYLAEFKTG+E
Sbjct  132  YLKMKGDYYRYLAEFKTGSE  151



>gb|KFK24544.1| hypothetical protein AALP_AAs41798U000400 [Arabis alpina]
Length=264

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +SAR+E VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIG
Sbjct  2    ATPSSARDEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV++I+EYRSKIE+EL+ IC+GILKLLD++LI A+ +
Sbjct  61   ARRASWRIISSIEQKEESRGNDDHVSTIREYRSKIETELSKICDGILKLLDTRLIPASAA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKT  E
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKTSQE  146



>ref|XP_008387340.1| PREDICTED: 14-3-3-like protein 16R [Malus domestica]
Length=261

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +S REENVY+AKLAEQAERYEEMVEFMEKVV++    EE TVEERNLLSVAYKNVIGARR
Sbjct  4    SSPREENVYVAKLAEQAERYEEMVEFMEKVVSSLPEGEEPTVEERNLLSVAYKNVIGARR  63

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRI+SSIEQKEESRGN DHVA+IKEYR++IE+EL++IC GILK+L+SKL+ +A  G S
Sbjct  64   ASWRIVSSIEQKEESRGNTDHVATIKEYRARIENELSNICGGILKVLESKLVPSAKVGES  123

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFKTG E
Sbjct  124  KVFYLKMKGDYHRYLAEFKTGDE  146



>ref|XP_010496601.1| PREDICTED: 14-3-3-like protein GF14 phi [Camelina sativa]
Length=273

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  71   RQTQASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYK  250
            R + AS +S+REE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYK
Sbjct  5    RVSDASSSSSREEFVYLAKLAEQAERYEEMVEFMEKVTEAVDKDELTVEE-RNLLSVAYK  63

Query  251  NVIGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIG  430
            NVIGARRASWRIISSIEQKEESRGN+DHVA+I++YRSKIESEL+ IC+GILKLLD++L+ 
Sbjct  64   NVIGARRASWRIISSIEQKEESRGNDDHVATIRDYRSKIESELSKICDGILKLLDTRLVP  123

Query  431  AATSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            A+ +G+SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  124  ASANGDSKVFYLKMKGDYHRYLAEFKTGQE  153



>emb|CDX88436.1| BnaC06g38800D [Brassica napus]
Length=260

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  4    SAREEYVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YR KIE+EL+ IC+GILKLLD +L+ AA SG+SK
Sbjct  63   SWRIISSIEQKEESRGNDDHVKAIRDYRGKIETELSGICDGILKLLDDRLVPAAGSGDSK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGQE  144



>ref|XP_004304139.1| PREDICTED: 14-3-3-like protein A [Fragaria vesca subsp. vesca]
Length=263

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    STREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSIIKEYRSKIETELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>ref|XP_010436066.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=268

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>gb|AHB33318.1| 14-3-3a protein [Pyrus pyrifolia]
Length=261

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IKEYRSKIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVVIIKEYRSKIETELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGGE  146



>ref|XP_008805904.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            A+ REE VYMAKLAEQAERYEEMVEFME+V A      ELTVEERNLLSVAYKNVIGARR
Sbjct  3    AATREEYVYMAKLAEQAERYEEMVEFMERVTATLPEGVELTVEERNLLSVAYKNVIGARR  62

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRI+SSIEQKEESRGN+DHVA+I +YR +IE+ELT+ICNGILKLLDS+L+ +A + +S
Sbjct  63   ASWRIVSSIEQKEESRGNQDHVAAIHDYRGRIEAELTNICNGILKLLDSRLVPSAATADS  122

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK G++
Sbjct  123  KVFYLKMKGDYHRYLAEFKIGSD  145



>ref|XP_009134679.1| PREDICTED: 14-3-3-like protein GF14 nu [Brassica rapa]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S REENVY+AKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MSSTREENVYLAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGNEDHVA IK+YR KIE+EL  IC+GIL LLDS L+ AA+   
Sbjct  60   RASWRIISSIEQKEESRGNEDHVALIKDYRVKIETELGKICDGILNLLDSHLVPAASLAE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>ref|NP_001265880.1| 14-3-3-like protein A-like [Cicer arietinum]
 gb|AEE60912.1| 14.3.3-like protein [Cicer arietinum]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMVEFMEKV AA E  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPTPREEFVYMAKLAEQAERYEEMVEFMEKVTAAVESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HVA I++YRSKIE+EL++ICNGILKLLDS+LI +A S
Sbjct  61   ARRASWRIISSIEQKEESRGNDEHVAVIRDYRSKIEAELSNICNGILKLLDSRLIPSAAS  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLA FK+GAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAGFKSGAE  146



>gb|ADP24188.1| 14-3-3-like protein [Galega orientalis]
Length=260

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMVEFMEKV  A E  E    E RNLLSVAYKNVIG
Sbjct  3    AAAPTPREEFVYMAKLAEQAERYEEMVEFMEKVTVAVETEELTVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HV  I++YRSKIE+EL++ICNGILKLLDS+LI +A S
Sbjct  62   ARRASWRIISSIEQKEESRGNDEHVTVIRDYRSKIETELSNICNGILKLLDSRLIPSAAS  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFK+G+E
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKSGSE  147



>ref|XP_002874496.1| hypothetical protein ARALYDRAFT_911048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50755.1| hypothetical protein ARALYDRAFT_911048 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>gb|AGZ13503.1| 14-3-3 protein [Lilium regale]
Length=259

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            +REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRAS
Sbjct  7    SREENVYMAKLAEQAERYEEMVEFMEKVARTVDTEELTVEE-RNLLSVAYKNVIGARRAS  65

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GILKLLDS L+ ++T+  SKV
Sbjct  66   WRIISSIEQKEESRGNEDHVALIKEYRGKIEAELSKICDGILKLLDSHLVPSSTAPESKV  125

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFK+GAE
Sbjct  126  FYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_009345790.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVY+AKLAEQAERYEEMVEFMEKVV++    EE TVEERNLLSVAYKNVIGARRA
Sbjct  5    SPREENVYVAKLAEQAERYEEMVEFMEKVVSSLPEGEEPTVEERNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRI+SSIEQKEESRGN DHVA+IKEYR++IE+EL++IC GILK+L+SKL+ +A  G SK
Sbjct  65   SWRIVSSIEQKEESRGNTDHVATIKEYRARIENELSNICGGILKVLESKLVPSAKVGESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGDE  146



>gb|ADD79961.1| 14-3-3 family protein [Dimocarpus longan]
 gb|ADD79962.1| 14-3-3 family protein [Dimocarpus longan]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMV+FMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVDFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IK+YR KIESEL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAVIKDYRGKIESELSKICDGILGLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_006288456.1| hypothetical protein CARUB_v10001717mg [Capsella rubella]
 gb|EOA21354.1| hypothetical protein CARUB_v10001717mg [Capsella rubella]
Length=268

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKEELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>gb|KDP32938.1| hypothetical protein JCGZ_12969 [Jatropha curcas]
Length=264

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            ++REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    TSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IKEYR KIESEL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVTIIKEYRGKIESELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|ABY65004.1| 14-3-3e protein [Gossypium hirsutum]
 gb|KJB08405.1| hypothetical protein B456_001G079900 [Gossypium raimondii]
 gb|KJB08406.1| hypothetical protein B456_001G079900 [Gossypium raimondii]
Length=262

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA +KEYR KIE+EL+ IC+GIL LL+S LI  A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAQLKEYRGKIEAELSKICDGILSLLESHLIPLASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>sp|P42653.1|1433A_VICFA RecName: Full=14-3-3-like protein A; AltName: Full=VFA-1433A 
[Vicia faba]
 emb|CAA88415.1| 14-3-3 brain protein homolog [Vicia faba]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMVEFMEKV AA E  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPTPREEFVYMAKLAEQAERYEEMVEFMEKVTAAVESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HV+ I++YRSKIE+EL++ICNGILKLLDS+LI +A  
Sbjct  61   ARRASWRIISSIEQKEESRGNDEHVSVIRDYRSKIETELSNICNGILKLLDSRLIPSAAL  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFK+GAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKSGAE  146



>gb|ABO15466.1| 14-3-3 protein Lil 1433-1 [Lilium longiflorum]
Length=263

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+R+E+VYMAKLAEQAERYEEMVEFMEKV    +  EELTVEERNLLSVAYKNVIGARRA
Sbjct  6    SSRDESVYMAKLAEQAERYEEMVEFMEKVAKTVDAGEELTVEERNLLSVAYKNVIGARRA  65

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IK+YR KIE+EL+ IC+GILKLLDS L+ +A +  SK
Sbjct  66   SWRIISSIEQKEESRGNEDHVVLIKDYRGKIEAELSKICDGILKLLDSHLVPSAATAESK  125

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  126  VFYLKMKGDYHRYLAEFKTGVE  147



>ref|XP_009375314.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVY+AKLAEQAERYEEMVEFMEKVV++    EE TVEERNLLSVAYKNVIGARRA
Sbjct  5    SPREENVYVAKLAEQAERYEEMVEFMEKVVSSLPEGEEPTVEERNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRI+SSIEQKEESRGN DHVA+IKEYR++IE+EL++IC GILK+L+SKL+ +A  G SK
Sbjct  65   SWRIVSSIEQKEESRGNADHVATIKEYRARIENELSNICGGILKVLESKLVPSAKVGESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGDE  146



>gb|KJB12046.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
Length=276

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            AS  S+REE VYMAKLAEQAERY+EMVEFMEKV A+AE  E    E RNLLSVAYKNVIG
Sbjct  3    ASTPSSREEFVYMAKLAEQAERYDEMVEFMEKVSASAESEELSVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRI+SSIEQKEESRGNEDHV  I++YR+KIESEL+SIC GILKLLDS+LI +A +
Sbjct  62   ARRASWRIVSSIEQKEESRGNEDHVTLIRDYRAKIESELSSICGGILKLLDSRLIPSAAA  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
             +SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  122  KDSKVFYLKMKGDYHRYLAEFKTGAE  147



>ref|XP_007014931.1| General regulatory factor 7, NU [Theobroma cacao]
 gb|EOY32550.1| General regulatory factor 7, NU [Theobroma cacao]
Length=274

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIEAELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>emb|CAB42547.1| 14-3-3-like protein [Pisum sativum]
Length=261

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  + REE VYMAKLAEQAERYEEMVEFMEKV AA E  E    E RNLLSVAYKNVIG
Sbjct  2    ATAPTPREEFVYMAKLAEQAERYEEMVEFMEKVTAAVESEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HV  I++YRSKIE+EL++ICNGILKLLDS+LI +A  
Sbjct  61   ARRASWRIISSIEQKEESRGNDEHVTVIRDYRSKIETELSNICNGILKLLDSRLIPSAAL  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFK+GAE
Sbjct  121  GDSKVFYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_011099565.1| PREDICTED: 14-3-3-like protein [Sesamum indicum]
Length=260

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+ EENVYMAKLAEQAERYEEMVEFMEKVV A +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSCEENVYMAKLAEQAERYEEMVEFMEKVVKAVDTDELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV +IKEYRSKIE+EL+ IC+GILKLL++ LI +A S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVNTIKEYRSKIEAELSKICDGILKLLETHLIPSAASAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_004489124.1| PREDICTED: 14-3-3-like protein A-like [Cicer arietinum]
Length=261

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+  S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIG
Sbjct  2    AASDSSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVDELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA IKEYRSKIE+EL+ IC+GIL LL+S L+ +A +
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIKEYRSKIETELSKICDGILSLLESNLVPSAGT  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTG E
Sbjct  121  PESKVFYLKMKGDYHRYLAEFKTGVE  146



>gb|KHG29578.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=261

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  S REENVYMAKLAEQAERYEEMV+FME VV+A    +EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATPSPREENVYMAKLAEQAERYEEMVKFMENVVSAVPAPDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHVA I++YR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVAVIRDYRAKIEAELSEICAGILKLLDEKLVPAAGNG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>gb|KJB79630.1| hypothetical protein B456_013G059800 [Gossypium raimondii]
Length=261

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            + +S RE+NVYMAKLAEQAERYEEMV+FME VV+A   ++EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATSSPREDNVYMAKLAEQAERYEEMVKFMETVVSAVPSSDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHV+ I+EYR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVSVIREYRAKIEAELSEICAGILKLLDEKLVPAAKTG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>gb|AAC04811.1| GF14 protein [Fritillaria agrestis]
Length=259

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            +REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRAS
Sbjct  7    SREENVYMAKLAEQAERYEEMVEFMEKVARTVDTEELTVEE-RNLLSVAYKNVIGARRAS  65

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHVA IK+YR KIE+EL+ IC+GILKLLDS L+ ++T+  SKV
Sbjct  66   WRIISSIEQKEESRGNEDHVALIKDYRGKIEAELSKICDGILKLLDSHLVPSSTAAESKV  125

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFK+GAE
Sbjct  126  FYLKMKGDYHRYLAEFKSGAE  146



>emb|CDX73313.1| BnaC05g27930D [Brassica napus]
Length=265

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A+ +SAREE VY+AKLAEQAERYEEMVEFMEKVV   E  E    E RNLLSVAYKNVIG
Sbjct  3    AASSSAREEFVYLAKLAEQAERYEEMVEFMEKVVEGVEKDELSVEE-RNLLSVAYKNVIG  61

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN+DHV +I++YRSKIESEL+ IC+GILKLLD++LI A+ +
Sbjct  62   ARRASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLIPASAN  121

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
            G+SKVFYLKMKGDYHRYLAEFKT  E
Sbjct  122  GDSKVFYLKMKGDYHRYLAEFKTAQE  147



>gb|ACN39847.1| unknown [Picea sitchensis]
 gb|ACN39934.1| unknown [Picea sitchensis]
 gb|ACN40751.1| unknown [Picea sitchensis]
Length=264

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            A + S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIG
Sbjct  5    AMVESSREENVYMAKLAEQAERYEEMVEFMEKVTKGVEVEELTVEE-RNLLSVAYKNVIG  63

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGN++HV +I+EYRSK+ESEL+ IC GIL+LLDS LI ++T+
Sbjct  64   ARRASWRIISSIEQKEESRGNDEHVVTIREYRSKVESELSKICEGILRLLDSHLIPSSTA  123

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  124  AESKVFYLKMKGDYHRYLAEFKTGAE  149



>ref|NP_001235653.1| 14-3-3-like protein A [Glycine max]
 ref|XP_006601862.1| PREDICTED: 14-3-3 protein SGF14a isoform X1 [Glycine max]
 gb|ADU60528.1| SGF14a [Glycine max]
 gb|KHN17328.1| 14-3-3-like protein A [Glycine soja]
Length=257

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GIL LL+S LI +A S  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIEAELSKICDGILNLLESNLIPSAASPESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>gb|ABY65003.1| 14-3-3d protein [Gossypium hirsutum]
 gb|KJB77547.1| hypothetical protein B456_012G142900 [Gossypium raimondii]
Length=261

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  S REENVYMAKLAEQAERYEEMV+FME VV+A    +EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATPSPREENVYMAKLAEQAERYEEMVKFMENVVSAVPAPDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHVA I++YR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVAVIRDYRAKIEAELSEICAGILKLLDEKLVPAAGNG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>gb|ABY65002.1| 14-3-3c protein [Gossypium hirsutum]
Length=261

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            + +S RE+NVYMAKLAEQAERYEEMV+FME VV+A   ++EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATSSPREDNVYMAKLAEQAERYEEMVKFMETVVSAVPSSDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHV+ I+EYR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEERGNADHVSVIREYRAKIEAELSEICAGILKLLDEKLVPAAKTG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>ref|XP_008801147.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008801148.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008801149.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=261

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            +S  S R ENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIG
Sbjct  2    SSAESTRVENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELNVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHV++IKEYR KIE+EL+ IC+GILKLLDS LI +A +
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVSTIKEYRGKIEAELSKICDGILKLLDSHLIPSAAA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTG+E
Sbjct  121  AESKVFYLKMKGDYHRYLAEFKTGSE  146



>gb|KHN24947.1| 14-3-3-like protein A [Glycine soja]
Length=257

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GIL LL+S LI +A S  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIEAELSKICDGILNLLESNLIPSAASPESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>gb|KJB79631.1| hypothetical protein B456_013G059800 [Gossypium raimondii]
Length=245

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            + +S RE+NVYMAKLAEQAERYEEMV+FME VV+A   ++EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATSSPREDNVYMAKLAEQAERYEEMVKFMETVVSAVPSSDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHV+ I+EYR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVSVIREYRAKIEAELSEICAGILKLLDEKLVPAAKTG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>emb|CDX87455.1| BnaA07g34180D [Brassica napus]
Length=299

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            SAREE VYMAKLAEQAERYEEMVEFMEKV AA +G E    E RNLLSVAYKNVIGARRA
Sbjct  43   SAREEYVYMAKLAEQAERYEEMVEFMEKVSAAIDGDELTVEE-RNLLSVAYKNVIGARRA  101

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN+DHV +I++YR+KIE+EL+ IC+GILKLLD +L+ AA SG+SK
Sbjct  102  SWRIISSIEQKEESRGNDDHVKAIRDYRAKIETELSGICDGILKLLDDRLVPAAGSGDSK  161

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  162  VFYLKMKGDYHRYLAEFKTGQE  183



>gb|KJB32075.1| hypothetical protein B456_005G222600 [Gossypium raimondii]
Length=261

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  SAR+ENVY+AKLAEQAERYEEMV+FME VV+A    +ELTVEERNLLSVAYKNVIGA
Sbjct  2    ATPSARDENVYLAKLAEQAERYEEMVKFMENVVSAVPAPDELTVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHV+ I+EYR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVSVIREYRAKIEAELSEICAGILKLLDEKLVPAAGTG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>gb|AGJ98232.1| PIB41 14-3-3 protein [Petunia x hybrida]
Length=260

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            +REENVYMAKLAEQAERYEEM+EFMEKV    +  E    E RNLLSVAYKNVIGARRAS
Sbjct  5    SREENVYMAKLAEQAERYEEMIEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRAS  63

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHV +IKEYRSKIE+EL+ IC+GIL LL+S LI +A++  SKV
Sbjct  64   WRIISSIEQKEESRGNEDHVKTIKEYRSKIEAELSKICDGILSLLESHLIPSASTAESKV  123

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFKTGAE
Sbjct  124  FYLKMKGDYHRYLAEFKTGAE  144



>ref|XP_010558549.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
 ref|XP_010558550.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
 ref|XP_010558551.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
Length=272

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    STREENVYMAKLAEQAERYEEMVEFMEKVANTGDTEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYR KIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSMIKEYRGKIEAELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|NP_001051051.1| Os03g0710800 [Oryza sativa Japonica Group]
 sp|Q06967.2|14336_ORYSJ RecName: Full=14-3-3-like protein GF14-F; AltName: Full=14-3-3-like 
protein S94; AltName: Full=G-box factor 14-3-3 homolog 
F; AltName: Full=OsGF14a; AltName: Full=Stress-regulated 14-3-3 
protein; Short=SR14-3-3 [Oryza sativa Japonica Group]
 gb|AAX95656.1| 14-3-3 protein [Oryza sativa Japonica Group]
 gb|ABF98505.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98506.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98507.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12965.1| Os03g0710800 [Oryza sativa Japonica Group]
 gb|EAY91605.1| hypothetical protein OsI_13240 [Oryza sativa Indica Group]
 gb|EAZ28334.1| hypothetical protein OsJ_12311 [Oryza sativa Japonica Group]
 gb|ACA50522.1| 14-3-3 protein [Oryza sativa Japonica Group]
 dbj|BAG88210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95867.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT42305.1| 14-3-3 protein [Oryza sativa Japonica Group]
Length=260

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            ++REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    ASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNE +VASIKEYRS+IE+EL+ IC+GILKLLDS L+ +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFK+GAE
Sbjct  125  VFYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_006303273.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
 gb|EOA36171.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
Length=270

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  REENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASW  280
            REE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARRASW
Sbjct  14   REEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARRASW  72

Query  281  RIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVF  460
            RIISSIEQKEESRGN+DHVA+I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+SKVF
Sbjct  73   RIISSIEQKEESRGNDDHVATIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVF  132

Query  461  YLKMKGDYHRYLAEFKTGAE  520
            YLKMKGDYHRYLAEFKTG E
Sbjct  133  YLKMKGDYHRYLAEFKTGQE  152



>sp|Q9SP07.1|1433_LILLO RecName: Full=14-3-3-like protein [Lilium longiflorum]
 gb|AAF05737.1|AF191746_1 14-3-3-like protein [Lilium longiflorum]
Length=259

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  98   AREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRAS  277
            +REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRAS
Sbjct  7    SREENVYMAKLAEQAERYEEMVEFMEKVARTVDTEELTVEE-RNLLSVAYKNVIGARRAS  65

Query  278  WRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKV  457
            WRIISSIEQKEESRGNEDHVA IK+YR KIE+EL+ IC+GILKLLDS L+ ++T+  SKV
Sbjct  66   WRIISSIEQKEESRGNEDHVALIKDYRGKIEAELSKICDGILKLLDSHLVPSSTAPESKV  125

Query  458  FYLKMKGDYHRYLAEFKTGAE  520
            FYLKMKGDYHRYLAEFK+GAE
Sbjct  126  FYLKMKGDYHRYLAEFKSGAE  146



>emb|CDX74252.1| BnaA03g27950D [Brassica napus]
Length=261

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            M+S REENVY+AKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGAR
Sbjct  1    MSSTREENVYLAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGAR  59

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRIISSIEQKEESRGN+DHVA IK+YR KIE+EL  IC+GIL LLDS L+ AA+   
Sbjct  60   RASWRIISSIEQKEESRGNDDHVALIKDYRVKIETELGKICDGILNLLDSHLVPAASLAE  119

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  120  SKVFYLKMKGDYHRYLAEFKTGAE  143



>gb|ACU23290.1| unknown [Glycine max]
Length=257

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GIL LL+S LI +A S  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIEAELSKICDGILNLLESNLIPSAASPESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>ref|NP_567344.1| 14-3-3-like protein GF14 chi [Arabidopsis thaliana]
 sp|P42643.3|14331_ARATH RecName: Full=14-3-3-like protein GF14 chi; AltName: Full=General 
regulatory factor 1 [Arabidopsis thaliana]
 gb|AAL06520.1|AF412067_1 AT4g09000/F23J3_30 [Arabidopsis thaliana]
 emb|CAB78024.1| 14-3-3-like protein [Arabidopsis thaliana]
 gb|AAL57697.1| AT4g09000/F23J3_30 [Arabidopsis thaliana]
 gb|AAM63348.1| 14-3-3 protein GF14chi (grf1) [Arabidopsis thaliana]
 gb|ABD19670.1| At4g09000 [Arabidopsis thaliana]
 gb|AEE82709.1| 14-3-3-like protein GF14 chi [Arabidopsis thaliana]
Length=267

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAR+E VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSARDEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>gb|ACU19485.1| unknown [Glycine max]
Length=257

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GIL LL+S LI +A S  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVAIIKEYRGKIEAELSKICDGILNLLESNLIPSAASPESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>gb|AAA96254.1| GF14chi isoform [Arabidopsis thaliana]
 gb|AAA96323.1| GF14 chi chain [Arabidopsis thaliana]
Length=267

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  92   ASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARR  271
            +SAR+E VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARR
Sbjct  7    SSARDEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEE-RNLLSVAYKNVIGARR  65

Query  272  ASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNS  451
            ASWRIISSIEQKEESRGN+DHV+ I++YRSKIE+EL+ IC+GILKLLD+ L+ AA SG+S
Sbjct  66   ASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDS  125

Query  452  KVFYLKMKGDYHRYLAEFKTGAE  520
            KVFYLKMKGDYHRYLAEFK+G E
Sbjct  126  KVFYLKMKGDYHRYLAEFKSGQE  148



>ref|XP_006650484.1| PREDICTED: 14-3-3-like protein GF14-F-like [Oryza brachyantha]
Length=260

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            ++REENVYMAKLAEQAERYEEMVEFMEKV   A+  E    E RNLLSVAYKNVIGARRA
Sbjct  6    ASREENVYMAKLAEQAERYEEMVEFMEKVAKTADVGELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNE +VASIKEYRS+IE+EL+ IC+GILKLLDS L+ +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFK+GAE
Sbjct  125  VFYLKMKGDYHRYLAEFKSGAE  146



>ref|XP_009381498.1| PREDICTED: 14-3-3 protein 6-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGAR  268
            MA+ REE+VYMAKLAEQAERYEEMVE+MEKV   A   EEL+ EERNLLSVAYKNVIGAR
Sbjct  1    MAATREESVYMAKLAEQAERYEEMVEYMEKVAGLATEGEELSAEERNLLSVAYKNVIGAR  60

Query  269  RASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGN  448
            RASWRI+SSIEQKEE RGN DHVA+I+ YRS+IESEL SIC GIL+LLDS+LI AA + +
Sbjct  61   RASWRIVSSIEQKEEGRGNHDHVAAIRGYRSRIESELASICGGILRLLDSRLIPAAAAAD  120

Query  449  SKVFYLKMKGDYHRYLAEFKTGAE  520
            SKVFYLKMKGDY+RYLAEFKTG+E
Sbjct  121  SKVFYLKMKGDYYRYLAEFKTGSE  144



>gb|KJB32076.1| hypothetical protein B456_005G222600 [Gossypium raimondii]
Length=233

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  SAR+ENVY+AKLAEQAERYEEMV+FME VV+A    +ELTVEERNLLSVAYKNVIGA
Sbjct  2    ATPSARDENVYLAKLAEQAERYEEMVKFMENVVSAVPAPDELTVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHV+ I+EYR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVSVIREYRAKIEAELSEICAGILKLLDEKLVPAAGTG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTG  514
            +SKVFYLKMKGDYHRYLAEFKTG
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTG  144



>gb|ABD96912.1| hypothetical protein [Cleome spinosa]
Length=272

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    STREENVYMAKLAEQAERYEEMVEFMEKVANTGDTEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IKEYR KIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSMIKEYRGKIEAELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_008800764.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008800765.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=262

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            +S  S REENVY+AKLAEQAERYEEMVEFMEKVV  A+  E    E RNLLSVAYKNVIG
Sbjct  2    SSAESTREENVYLAKLAEQAERYEEMVEFMEKVVKTADVQELSVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNED VA IKEYR KIE+EL++IC+GILKLLDS LI ++T+
Sbjct  61   ARRASWRIISSIEQKEESRGNEDRVAVIKEYRGKIEAELSNICDGILKLLDSHLIPSSTA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKM GDYHRYLAEFKTGAE
Sbjct  121  AESKVFYLKMNGDYHRYLAEFKTGAE  146



>ref|XP_008778192.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=262

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 4/148 (3%)
 Frame = +2

Query  89   MASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeel----tveeRNLLSVAYKNV  256
            MA  REENVY+AKLAEQAERYEEMVEFMEKV AAA  A       TVEERNLLSVAYKNV
Sbjct  1    MAGEREENVYLAKLAEQAERYEEMVEFMEKVTAAAAAAAAEGEELTVEERNLLSVAYKNV  60

Query  257  IGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAA  436
            IGARRASWRI+SSIEQKEESRGNEDHVA+I++YR+KIE+ELTSIC+G LKLLD+ LI +A
Sbjct  61   IGARRASWRIVSSIEQKEESRGNEDHVAAIRDYRAKIEAELTSICSGFLKLLDASLIPSA  120

Query  437  TSGNSKVFYLKMKGDYHRYLAEFKTGAE  520
            +  +SKVFYLKMKGDYHRYLAEFKTG++
Sbjct  121  SVSDSKVFYLKMKGDYHRYLAEFKTGSD  148



>ref|XP_008781204.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=261

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKVV  A+  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVVKTADVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNED V  IKEYR KIE+EL+ IC+GILKLLDS LI +AT+  SK
Sbjct  65   SWRIISSIEQKEESRGNEDRVGLIKEYRGKIEAELSKICDGILKLLDSHLIPSATAVESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|AAD27827.2| 14-3-3 protein [Picea glauca]
Length=259

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    E  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYMAKLAEQAERYEEMVEFMEKVTKGVEVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGN++HV +I+EYRSK+ESEL+ IC GIL+LLDS LI ++T+  SK
Sbjct  63   SWRIISSIEQKEESRGNDEHVVTIREYRSKVESELSKICEGILRLLDSHLIPSSTAAESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  123  VFYLKMKGDYHRYLAEFKTGAE  144



>ref|XP_010932603.1| PREDICTED: 14-3-3-like protein isoform X2 [Elaeis guineensis]
Length=207

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            +S  S REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIG
Sbjct  2    SSAESTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNED V+ IKEYR KIE+EL++IC+GILKLLDS LI ++T 
Sbjct  61   ARRASWRIISSIEQKEESRGNEDRVSLIKEYRGKIEAELSNICDGILKLLDSHLIPSSTV  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFK GAE
Sbjct  121  AESKVFYLKMKGDYHRYLAEFKAGAE  146



>ref|XP_010937379.1| PREDICTED: 14-3-3-like protein B [Elaeis guineensis]
Length=261

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            + REE VYMAKLAEQAERYEEMVEFMEKV A      ELTVEERNLLSVAYKNVIGARRA
Sbjct  5    TTREEYVYMAKLAEQAERYEEMVEFMEKVTATLPEGTELTVEERNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRI+SSIEQKEESRGN+DHVA+I++YR +IE+ELT+ICNGILKLLDS L+ +A + +SK
Sbjct  65   SWRIVSSIEQKEESRGNQDHVAAIRDYRGRIEAELTNICNGILKLLDSCLVPSAAAADSK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFK G++
Sbjct  125  VFYLKMKGDYHRYLAEFKIGSD  146



>gb|KHG29579.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=280

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            +  S REENVYMAKLAEQAERYEEMV+FME VV+A    +EL+VEERNLLSVAYKNVIGA
Sbjct  2    ATPSPREENVYMAKLAEQAERYEEMVKFMENVVSAVPAPDELSVEERNLLSVAYKNVIGA  61

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRI+SSIEQKEE RGN DHVA I++YR+KIE+EL+ IC GILKLLD KL+ AA +G
Sbjct  62   RRASWRIVSSIEQKEEGRGNADHVAVIRDYRAKIEAELSEICAGILKLLDEKLVPAAGNG  121

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDYHRYLAEFKTG +
Sbjct  122  DSKVFYLKMKGDYHRYLAEFKTGDD  146



>ref|XP_010908756.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
 ref|XP_010908757.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=261

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +2

Query  83   ASMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIG  262
            +S  S REENVYMAKLAEQAERYEEM+E MEKVV   +  E    E RNLLSVAYKNVIG
Sbjct  2    SSAESTREENVYMAKLAEQAERYEEMIESMEKVVKTVDTEELTVEE-RNLLSVAYKNVIG  60

Query  263  ARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATS  442
            ARRASWRIISSIEQKEESRGNEDHVA IKEYR KIE+EL+ IC+GILKLLDS +I +A +
Sbjct  61   ARRASWRIISSIEQKEESRGNEDHVAVIKEYRGKIEAELSKICDGILKLLDSHVIPSAAA  120

Query  443  GNSKVFYLKMKGDYHRYLAEFKTGAE  520
              SKVFYLKMKGDYHRYLAEFKTGAE
Sbjct  121  AESKVFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_006384209.1| hypothetical protein POPTR_0004s10120g [Populus trichocarpa]
 gb|ERP62006.1| hypothetical protein POPTR_0004s10120g [Populus trichocarpa]
Length=209

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REE+VYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREEHVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IKEYR KIE+EL+ IC+GIL LL+S L+ +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVTIIKEYRGKIEAELSKICDGILNLLESHLVPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>ref|XP_006397240.1| hypothetical protein EUTSA_v10028882mg [Eutrema salsugineum]
 gb|AAM19701.1|AF499714_1 14-3-3-like protein [Eutrema halophilum]
 gb|ESQ38693.1| hypothetical protein EUTSA_v10028882mg [Eutrema salsugineum]
Length=272

 Score =   214 bits (545),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = +2

Query  86   SMASAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGA  265
            S +SAREE VYMAKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGA
Sbjct  7    SSSSAREEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKEELTVEE-RNLLSVAYKNVIGA  65

Query  266  RRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSG  445
            RRASWRIISSIEQKEESRGN DHV+ I++YR+KIE+EL+ IC+GILKLLD+ LI AA SG
Sbjct  66   RRASWRIISSIEQKEESRGNNDHVSLIRDYRTKIETELSGICDGILKLLDTMLIPAAASG  125

Query  446  NSKVFYLKMKGDYHRYLAEFKTGAE  520
            +SKVFYLKMKGDYHRYLAEFKT  E
Sbjct  126  DSKVFYLKMKGDYHRYLAEFKTSQE  150



>ref|XP_010461289.1| PREDICTED: 14-3-3-like protein GF14 phi [Camelina sativa]
Length=270

 Score =   214 bits (545),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  REENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRASW  280
            REE VY+AKLAEQAERYEEMVEFMEKV  A +  E    E RNLLSVAYKNVIGARRASW
Sbjct  12   REEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEE-RNLLSVAYKNVIGARRASW  70

Query  281  RIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSKVF  460
            RIISSIEQKEESRGN+DHVA+I++YRSKIESEL+ IC+GILKLLD++L+ A+ +G+SKVF
Sbjct  71   RIISSIEQKEESRGNDDHVATIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVF  130

Query  461  YLKMKGDYHRYLAEFKTGAE  520
            YLKMKGDYHRYLAEFKTG E
Sbjct  131  YLKMKGDYHRYLAEFKTGQE  150



>ref|XP_006346922.1| PREDICTED: 14-3-3 protein 4-like [Solanum tuberosum]
Length=260

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVY+AKLAEQAERYEEM+EFMEKV   A+  E    E RNLLSVAYKNVIGARRA
Sbjct  4    SSREENVYLAKLAEQAERYEEMIEFMEKVAKTADVEELTVEE-RNLLSVAYKNVIGARRA  62

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV +IKEYRSKIE+EL+ IC+GIL LL+S LI +A++  SK
Sbjct  63   SWRIISSIEQKEESRGNEDHVNTIKEYRSKIEAELSKICDGILSLLESNLIPSASTAESK  122

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG E
Sbjct  123  VFYLKMKGDYHRYLAEFKTGTE  144



>ref|XP_004137196.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004156536.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_008455580.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 ref|XP_008455581.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 ref|XP_008455582.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 gb|KGN53640.1| hypothetical protein Csa_4G094520 [Cucumis sativus]
Length=263

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV+ IK+YR KIE+EL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVSIIKDYRGKIETELSKICDGILSLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTGAE
Sbjct  125  VFYLKMKGDYHRYLAEFKTGAE  146



>gb|AIJ04690.1| 14-3-3a [Morus alba var. atropurpurea]
Length=262

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  95   SAREENVYMAKLAEQAERYEEMVEFMekvvaaaegaeeltveeRNLLSVAYKNVIGARRA  274
            S+REENVYMAKLAEQAERYEEMVEFMEKV    +  E    E RNLLSVAYKNVIGARRA
Sbjct  6    SSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEE-RNLLSVAYKNVIGARRA  64

Query  275  SWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGAATSGNSK  454
            SWRIISSIEQKEESRGNEDHV  IK+YR KIESEL+ IC+GIL LL+S LI +A+S  SK
Sbjct  65   SWRIISSIEQKEESRGNEDHVTIIKDYRGKIESELSKICDGILNLLESHLIPSASSAESK  124

Query  455  VFYLKMKGDYHRYLAEFKTGAE  520
            VFYLKMKGDYHRYLAEFKTG+E
Sbjct  125  VFYLKMKGDYHRYLAEFKTGSE  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800