BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027B22

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003546537.1|  PREDICTED: tetraketide alpha-pyrone reductas...  94.0    5e-20   Glycine max [soybeans]
ref|XP_002283345.2|  PREDICTED: tetraketide alpha-pyrone reductase 1  94.0    5e-20   Vitis vinifera
emb|CAN78571.1|  hypothetical protein VITISV_020578                   94.0    8e-20   Vitis vinifera
ref|XP_010090741.1|  hypothetical protein L484_013763                 89.0    1e-19   
gb|KJB47124.1|  hypothetical protein B456_008G012400                  91.7    3e-19   Gossypium raimondii
ref|XP_008349025.1|  PREDICTED: tetraketide alpha-pyrone reductas...  90.1    7e-19   
ref|XP_008382527.1|  PREDICTED: tetraketide alpha-pyrone reductas...  90.1    9e-19   
ref|XP_008382526.1|  PREDICTED: tetraketide alpha-pyrone reductas...  90.5    1e-18   
gb|AEZ53298.1|  tetraketide alpha-pyrone reductase 1                  90.5    1e-18   Nicotiana tabacum [American tobacco]
ref|XP_009776908.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  90.5    1e-18   Nicotiana sylvestris
ref|XP_009599462.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  90.1    1e-18   Nicotiana tomentosiformis
ref|XP_011088719.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  89.4    3e-18   Sesamum indicum [beniseed]
ref|XP_006595128.1|  PREDICTED: tetraketide alpha-pyrone reductas...  89.0    3e-18   Glycine max [soybeans]
ref|XP_003543630.1|  PREDICTED: tetraketide alpha-pyrone reductas...  89.0    3e-18   Glycine max [soybeans]
ref|XP_002523596.1|  cinnamoyl-CoA reductase, putative                89.0    3e-18   Ricinus communis
ref|XP_007043128.1|  Dihydroflavonol 4-reductase-like1                89.0    4e-18   
ref|XP_010270636.1|  PREDICTED: tetraketide alpha-pyrone reductas...  88.6    4e-18   Nelumbo nucifera [Indian lotus]
gb|AFC36879.1|  tetraketide alpha-pyrone reductase 1                  88.6    5e-18   Nicotiana tabacum [American tobacco]
ref|XP_010270635.1|  PREDICTED: tetraketide alpha-pyrone reductas...  88.6    5e-18   
emb|CDX75502.1|  BnaA01g02000D                                        87.4    1e-17   
ref|NP_195268.2|  dihydroflavonol 4-reductase-like1                   87.4    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437474.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  87.4    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009358921.1|  PREDICTED: LOW QUALITY PROTEIN: tetraketide ...  87.0    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_008382751.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  87.0    1e-17   
ref|XP_002867074.1|  dihydroflavonol 4-reductase family               87.0    2e-17   
ref|XP_010432286.1|  PREDICTED: tetraketide alpha-pyrone reductas...  86.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009102146.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  85.9    3e-17   Brassica rapa
gb|KDO68446.1|  hypothetical protein CISIN_1g0360952mg                84.3    4e-17   Citrus sinensis [apfelsine]
gb|KJB47141.1|  hypothetical protein B456_008G012500                  85.5    4e-17   Gossypium raimondii
ref|XP_010446925.1|  PREDICTED: tetraketide alpha-pyrone reductas...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
emb|CDY41656.1|  BnaC03g62280D                                        85.5    5e-17   Brassica napus [oilseed rape]
ref|XP_004290099.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  85.5    5e-17   Fragaria vesca subsp. vesca
ref|XP_008235844.1|  PREDICTED: tetraketide alpha-pyrone reductas...  84.7    9e-17   Prunus mume [ume]
ref|XP_006486836.1|  PREDICTED: tetraketide alpha-pyrone reductas...  84.3    1e-16   
ref|XP_006422368.1|  hypothetical protein CICLE_v10028834mg           84.3    1e-16   Citrus clementina [clementine]
gb|EYU23972.1|  hypothetical protein MIMGU_mgv1a009951mg              84.0    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_008235846.1|  PREDICTED: tetraketide alpha-pyrone reductas...  84.0    2e-16   Prunus mume [ume]
gb|EYU23973.1|  hypothetical protein MIMGU_mgv1a009951mg              84.0    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_004236874.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  84.0    2e-16   Solanum lycopersicum
emb|CDX69139.1|  BnaC01g03140D                                        83.6    2e-16   
ref|XP_006360850.1|  PREDICTED: tetraketide alpha-pyrone reductas...  84.0    2e-16   Solanum tuberosum [potatoes]
ref|XP_007200400.1|  hypothetical protein PRUPE_ppa008548mg           83.6    2e-16   Prunus persica
ref|XP_010690599.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  83.6    3e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK30181.1|  hypothetical protein AALP_AA7G228100                  83.6    3e-16   Arabis alpina [alpine rockcress]
emb|CDP14491.1|  unnamed protein product                              81.6    5e-16   Coffea canephora [robusta coffee]
ref|XP_010028888.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  82.4    6e-16   
ref|XP_002311546.2|  dihydroflavonol 4-reductase family protein       82.4    7e-16   
ref|XP_006379787.1|  hypothetical protein POPTR_0008s13800g           82.4    7e-16   
ref|XP_010548188.1|  PREDICTED: tetraketide alpha-pyrone reductas...  82.0    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_004486774.1|  PREDICTED: tetraketide alpha-pyrone reductas...  82.0    9e-16   Cicer arietinum [garbanzo]
ref|XP_008448150.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  82.0    1e-15   Cucumis melo [Oriental melon]
emb|CDY24810.1|  BnaA08g15000D                                        81.3    1e-15   Brassica napus [oilseed rape]
ref|XP_009109293.1|  PREDICTED: tetraketide alpha-pyrone reductas...  81.3    1e-15   Brassica rapa
ref|XP_007150619.1|  hypothetical protein PHAVU_005G167400g           81.3    1e-15   Phaseolus vulgaris [French bean]
ref|XP_006412106.1|  hypothetical protein EUTSA_v10025703mg           81.3    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_004139985.1|  PREDICTED: tetraketide alpha-pyrone reductas...  81.3    2e-15   Cucumis sativus [cucumbers]
ref|XP_004957228.1|  PREDICTED: tetraketide alpha-pyrone reductas...  81.3    2e-15   Setaria italica
ref|XP_009386710.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  79.7    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003597698.1|  Dihydroflavonol-4-reductase                      79.7    6e-15   Medicago truncatula
ref|XP_011024587.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  79.7    7e-15   Populus euphratica
ref|XP_002462592.1|  hypothetical protein SORBIDRAFT_02g028700        79.0    1e-14   Sorghum bicolor [broomcorn]
gb|KDP31942.1|  hypothetical protein JCGZ_12403                       78.2    1e-14   Jatropha curcas
gb|EMS64586.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  78.2    2e-14   Triticum urartu
ref|XP_010531309.1|  PREDICTED: tetraketide alpha-pyrone reductas...  78.6    2e-14   Tarenaya hassleriana [spider flower]
dbj|BAK06753.1|  predicted protein                                    78.2    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010932167.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  79.0    3e-14   Elaeis guineensis
gb|EMT20121.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  78.2    3e-14   
gb|ACN27587.1|  unknown                                               76.6    4e-14   Zea mays [maize]
ref|XP_008651868.1|  PREDICTED: dihydroflavanoid reductase-like1 ...  77.4    5e-14   
ref|XP_008651870.1|  PREDICTED: dihydroflavanoid reductase-like1 ...  77.0    5e-14   
ref|XP_006661385.1|  PREDICTED: tetraketide alpha-pyrone reductas...  77.8    5e-14   
ref|XP_008356276.1|  PREDICTED: LOW QUALITY PROTEIN: tetraketide ...  76.3    8e-14   
ref|NP_001105644.1|  dihydroflavanoid reductase-like1                 76.6    8e-14   
gb|ACG40388.1|  dihydroflavonol-4-reductase                           76.6    8e-14   Zea mays [maize]
gb|ACG33357.1|  dihydroflavonol-4-reductase                           77.0    9e-14   Zea mays [maize]
gb|ACG40042.1|  hypothetical protein                                  76.6    9e-14   Zea mays [maize]
ref|XP_003578347.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  76.3    1e-13   Brachypodium distachyon [annual false brome]
gb|EMS53116.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  76.3    2e-13   Triticum urartu
gb|AAD24584.3|AF134807_1  putative dihydroflavonol reductase          75.1    3e-13   Oryza sativa [red rice]
ref|XP_008799152.1|  PREDICTED: tetraketide alpha-pyrone reductase 1  75.1    3e-13   Phoenix dactylifera
gb|EEC84809.1|  hypothetical protein OsI_31879                        75.1    3e-13   Oryza sativa Indica Group [Indian rice]
dbj|BAC78578.1|  dihydroflavonol reductase                            75.1    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063545.1|  Os09g0493500                                     75.1    5e-13   
dbj|BAK08080.1|  predicted protein                                    73.6    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS73655.1|  hypothetical protein M569_01100                       73.2    2e-12   Genlisea aurea
gb|EMT24226.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  72.8    3e-12   
ref|XP_006849855.1|  hypothetical protein AMTR_s00022p00057010        71.6    4e-12   Amborella trichopoda
gb|EEE68992.1|  hypothetical protein OsJ_27928                        71.6    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83876.1|  hypothetical protein OsI_29874                        70.9    6e-12   Oryza sativa Indica Group [Indian rice]
dbj|BAD09991.1|  putative dihydroflavonol reductase                   71.6    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973909.1|  PREDICTED: tetraketide alpha-pyrone reductas...  71.2    8e-12   Setaria italica
gb|ACF79507.1|  unknown                                               68.2    4e-11   Zea mays [maize]
gb|ACF86157.1|  unknown                                               68.2    4e-11   Zea mays [maize]
ref|XP_010548187.1|  PREDICTED: tetraketide alpha-pyrone reductas...  68.9    7e-11   
ref|NP_001141357.1|  uncharacterized protein LOC100273448             68.6    8e-11   Zea mays [maize]
ref|XP_007199298.1|  hypothetical protein PRUPE_ppa023144mg           66.2    1e-10   
ref|XP_006660279.1|  PREDICTED: tetraketide alpha-pyrone reductas...  67.4    2e-10   Oryza brachyantha
ref|XP_002983967.1|  hypothetical protein SELMODRAFT_119444           65.5    8e-10   
ref|XP_002960169.1|  hypothetical protein SELMODRAFT_74610            65.1    1e-09   
ref|XP_002444755.1|  hypothetical protein SORBIDRAFT_07g027340        61.6    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006659892.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        59.7    1e-07   
ref|XP_004238461.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        58.9    2e-07   Solanum lycopersicum
emb|CAA18727.1|  putative protein                                     57.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131614.1|  hypothetical protein                             58.5    2e-07   Zea mays [maize]
gb|EEC70426.1|  hypothetical protein OsI_01433                        58.5    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_007145529.1|  hypothetical protein PHAVU_007G246200g           58.5    2e-07   Phaseolus vulgaris [French bean]
gb|EMT05436.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  58.2    3e-07   
gb|ACU24315.1|  unknown                                               57.4    5e-07   Glycine max [soybeans]
ref|XP_003530329.1|  PREDICTED: cinnamoyl-CoA reductase 1             57.4    5e-07   Glycine max [soybeans]
gb|ADY39751.1|  cinnamoyl-CoA reductase                               57.8    5e-07   Cenchrus purpureus [elephant grass]
gb|AIS23632.1|  cinnamoyl-CoA reductase family protein                57.4    5e-07   Camellia sinensis [black tea]
ref|XP_008794349.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        57.4    6e-07   Phoenix dactylifera
gb|EMS52078.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  57.4    6e-07   Triticum urartu
gb|EAY73549.1|  hypothetical protein OsI_01432                        57.4    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004973552.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        57.4    6e-07   Setaria italica
gb|EAZ11468.1|  hypothetical protein OsJ_01337                        57.0    7e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB39960.1|  putative cinnamoyl-CoA reductase                     57.0    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001772000.1|  predicted protein                                57.0    8e-07   
ref|XP_010527306.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        56.6    8e-07   Tarenaya hassleriana [spider flower]
ref|NP_001151213.1|  dihydroflavonol-4-reductase                      56.6    9e-07   Zea mays [maize]
ref|NP_001042767.1|  Os01g0283600                                     56.6    9e-07   
gb|AFW87409.1|  hypothetical protein ZEAMMB73_924621                  56.6    9e-07   
ref|XP_010645686.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X1  56.6    9e-07   Vitis vinifera
gb|EEC70428.1|  hypothetical protein OsI_01435                        56.6    9e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001042768.1|  Os01g0283700                                     56.6    9e-07   
gb|EEE54350.1|  hypothetical protein OsJ_01338                        56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AGS10090.1|  cinnamoyl CoA reductase                               56.6    1e-06   Paspalum dilatatum [dallisgrass]
ref|NP_001266837.1|  uncharacterized protein LOC101027223             56.6    1e-06   Zea mays [maize]
gb|EMS49127.1|  Dihydroflavonol-4-reductase                           54.3    1e-06   Triticum urartu
ref|XP_002445566.1|  hypothetical protein SORBIDRAFT_07g021680        56.2    2e-06   Sorghum bicolor [broomcorn]
emb|CAA13176.1|  cinnamoyl-CoA reductase                              56.2    2e-06   Saccharum officinarum [noble cane]
gb|AJD79908.1|  CCR                                                   55.8    2e-06   Punica granatum [granado]
ref|XP_008775468.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        55.5    2e-06   Phoenix dactylifera
ref|XP_009606417.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        55.5    2e-06   Nicotiana tomentosiformis
gb|ACZ74584.1|  cinnamoyl CoA reductase 1e                            55.8    2e-06   Panicum virgatum
ref|XP_009354188.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        55.5    2e-06   Pyrus x bretschneideri [bai li]
emb|CAN83703.1|  hypothetical protein VITISV_003030                   55.1    2e-06   Vitis vinifera
ref|XP_002280010.2|  PREDICTED: cinnamoyl-CoA reductase 2             55.5    2e-06   Vitis vinifera
ref|XP_002267718.2|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X2  55.5    2e-06   Vitis vinifera
gb|KDO48510.1|  hypothetical protein CISIN_1g020753mg                 55.5    2e-06   Citrus sinensis [apfelsine]
ref|XP_008664204.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        54.7    2e-06   
tpg|DAA48904.1|  TPA: hypothetical protein ZEAMMB73_257653            54.3    3e-06   
gb|ACZ74581.1|  cinnamoyl CoA reductase 1b                            55.5    3e-06   Panicum virgatum
gb|ACZ74580.1|  cinnamoyl CoA reductase 1a                            55.5    3e-06   Panicum virgatum
ref|XP_002889086.1|  cinnamoyl-CoA reductase                          55.1    3e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_008361199.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        55.1    3e-06   Malus domestica [apple tree]
ref|XP_008375542.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        55.1    3e-06   Malus domestica [apple tree]
gb|ADK62523.1|  cinnamoyl-CoA reductase                               55.1    3e-06   Pyrus pyrifolia [sha li]
ref|XP_002438696.1|  hypothetical protein SORBIDRAFT_10g024510        55.1    4e-06   Sorghum bicolor [broomcorn]
tpg|DAA48900.1|  TPA: hypothetical protein ZEAMMB73_257653            54.3    4e-06   
tpg|DAA48903.1|  TPA: hypothetical protein ZEAMMB73_257653            54.3    4e-06   
gb|ACI14382.1|  cinnamoyl-CoA reductase                               55.1    4e-06   Vaccinium corymbosum [American blueberry]
gb|AAN71760.1|  cinnamoyl CoA reductase                               54.7    4e-06   Hordeum vulgare [barley]
emb|CDX88284.1|  BnaC06g37280D                                        54.7    4e-06   
ref|XP_008228815.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.1    4e-06   Prunus mume [ume]
ref|XP_006433232.1|  hypothetical protein CICLE_v10001855mg           54.7    4e-06   Citrus clementina [clementine]
gb|AGS10091.1|  cinnamoyl CoA reductase                               54.7    4e-06   Paspalum dilatatum [dallisgrass]
gb|KDP41979.1|  hypothetical protein JCGZ_26997                       54.7    5e-06   Jatropha curcas
gb|AFD29890.1|  cinnamoyl-CoA reductase                               54.3    5e-06   Bambusa emeiensis
ref|XP_006342181.1|  PREDICTED: cinnamoyl-CoA reductase 2             54.3    5e-06   Solanum tuberosum [potatoes]
ref|NP_001234612.1|  cinnamoyl-CoA reductase                          54.3    5e-06   Solanum lycopersicum
ref|XP_009354190.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        54.3    5e-06   Pyrus x bretschneideri [bai li]
gb|ABQ95549.1|  cinnamoyl CoA reductase                               53.1    6e-06   Corymbia citriodora subsp. variegata
ref|NP_001148831.1|  LOC100282448                                     54.3    6e-06   Zea mays [maize]
gb|ACG33996.1|  dihydroflavonol-4-reductase                           54.3    6e-06   Zea mays [maize]
ref|NP_001048476.1|  Os02g0811800                                     54.3    6e-06   
gb|AHX56186.1|  cinnamoyl-CoA reductase 1                             54.3    6e-06   Petunia x hybrida [garden petunia]
ref|NP_001105488.1|  cinnamoyl CoA reductase1                         54.3    6e-06   Zea mays [maize]
emb|CAA66707.1|  cinnamoyl-CoA reductase                              54.3    6e-06   Zea mays [maize]
pdb|4R1S|A  Chain A, Crystal Structure Of Petunia Hydrida Cinnamo...  54.3    6e-06   Petunia x hybrida [garden petunia]
ref|XP_006410504.1|  hypothetical protein EUTSA_v10017002mg           53.9    7e-06   
gb|ACF85456.1|  unknown                                               54.3    7e-06   Zea mays [maize]
ref|XP_006383800.1|  hypothetical protein POPTR_0005s27910g           52.8    7e-06   
gb|AHM10331.1|  cinnamoyl-CoA reductase                               54.3    7e-06   Pyrus pyrifolia [sha li]
ref|XP_008648792.1|  PREDICTED: cinnamoyl CoA reductase1 isoform X1   54.3    7e-06   Zea mays [maize]
ref|XP_006648088.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.9    7e-06   Oryza brachyantha
gb|ACZ74583.1|  cinnamoyl CoA reductase 1d                            54.3    7e-06   Panicum virgatum
gb|ACZ74582.1|  cinnamoyl CoA reductase 1c                            54.3    7e-06   Panicum virgatum
ref|XP_002280095.1|  PREDICTED: cinnamoyl-CoA reductase 2             53.9    7e-06   Vitis vinifera
gb|AGA82783.1|  dihydroflavonol reductase 2                           53.9    8e-06   Clarkia gracilis
ref|XP_010942096.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.9    8e-06   Elaeis guineensis
ref|XP_010929159.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.9    8e-06   Elaeis guineensis
ref|XP_011034796.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  53.9    8e-06   Populus euphratica
ref|XP_004965850.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.9    8e-06   Setaria italica
ref|XP_002300620.2|  hypothetical protein POPTR_0002s00600g           53.9    9e-06   Populus trichocarpa [western balsam poplar]
emb|CDP19334.1|  unnamed protein product                              53.1    9e-06   Coffea canephora [robusta coffee]
gb|AAP46143.1|  cinnamoyl CoA reductase                               53.9    9e-06   Fragaria x ananassa
ref|XP_011034795.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  53.9    9e-06   Populus euphratica
ref|XP_006383798.1|  hypothetical protein POPTR_0005s27910g           53.1    9e-06   
ref|XP_006433229.1|  hypothetical protein CICLE_v10001868mg           53.5    9e-06   Citrus clementina [clementine]
ref|XP_009782740.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        53.5    9e-06   Nicotiana sylvestris
gb|EAY87969.1|  hypothetical protein OsI_09393                        53.9    9e-06   Oryza sativa Indica Group [Indian rice]
gb|AFW87421.1|  hypothetical protein ZEAMMB73_660708                  51.6    1e-05   
ref|XP_004303244.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.5    1e-05   Fragaria vesca subsp. vesca
gb|AFQ36033.1|  cinnamoyl CoA reductase                               53.5    1e-05   Fragaria x ananassa
ref|XP_010265623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.6    1e-05   Nelumbo nucifera [Indian lotus]
gb|AES86489.2|  cinnamoyl-CoA reductase                               53.5    1e-05   Medicago truncatula
gb|AFX98066.1|  cinnamoyl-CoA reductase                               53.5    1e-05   Cunninghamia lanceolata [China fir]
gb|AFK46072.1|  unknown                                               53.5    1e-05   Medicago truncatula
gb|AES86491.2|  cinnamoyl-CoA reductase                               53.5    1e-05   Medicago truncatula
ref|XP_006644074.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.5    1e-05   
gb|EMS35640.1|  Dihydroflavonol-4-reductase                           53.1    1e-05   Triticum urartu
gb|AEO13438.1|  cinnamoyl-CoA reductase                               53.5    1e-05   Ginkgo biloba [ginkgo]
emb|CAN60237.1|  hypothetical protein VITISV_028852                   53.1    1e-05   Vitis vinifera
ref|XP_008659824.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        51.6    1e-05   
ref|XP_004499176.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  53.5    1e-05   Cicer arietinum [garbanzo]
ref|XP_009606418.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        53.1    1e-05   Nicotiana tomentosiformis
ref|XP_011041140.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.1    1e-05   Populus euphratica
ref|XP_006383799.1|  hypothetical protein POPTR_0005s27910g           53.1    1e-05   
ref|XP_008655508.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.1    2e-05   Zea mays [maize]
gb|AJK93559.1|  dihydroflavonol reductase 1                           53.1    2e-05   Vicia faba [broad bean]
ref|XP_006356249.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.1    2e-05   Solanum tuberosum [potatoes]
ref|XP_008228791.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.6    2e-05   Prunus mume [ume]
gb|AID69232.1|  cinnamoyl CoA reductase                               51.6    2e-05   Garcinia mangostana [mangosteen]
ref|XP_009782741.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        52.8    2e-05   Nicotiana sylvestris
gb|EMS65144.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  53.1    2e-05   Triticum urartu
ref|XP_008799656.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        53.1    2e-05   
gb|ACF87800.1|  unknown                                               52.8    2e-05   Zea mays [maize]
ref|XP_004965851.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        52.8    2e-05   Setaria italica
gb|ABQ95548.1|  cinnamoyl CoA reductase                               51.2    2e-05   Corymbia citriodora subsp. variegata
gb|ADU64758.1|  cinnamoyl-CoA reductase                               52.8    2e-05   Hevea brasiliensis [jebe]
gb|ABQ95555.1|  cinnamoyl CoA reductase                               51.2    2e-05   Corymbia citriodora subsp. variegata
ref|XP_008228789.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        52.8    2e-05   Prunus mume [ume]
gb|AAG42528.1|  cinnamoyl-CoA reductase                               51.2    2e-05   Prunus persica
ref|XP_009631380.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        52.8    2e-05   Nicotiana tomentosiformis
gb|ABC40968.2|  cinnamoyl CoA reductase                               51.2    2e-05   Corymbia citriodora subsp. variegata
ref|XP_009106316.1|  PREDICTED: cinnamoyl-CoA reductase 2             52.4    2e-05   Brassica rapa
ref|XP_009762377.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        52.4    2e-05   Nicotiana sylvestris
gb|AAF43141.1|AF217958_1  cinnamoyl CoA reductase                     52.4    3e-05   Populus tremuloides
gb|AAR83344.1|  cinnamoyl CoA reductase                               52.4    3e-05   Populus tomentosa [Chinese white poplar]
ref|XP_004967172.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        52.4    3e-05   Setaria italica
gb|AIB06741.1|  dihydroflavonol 4-reductase                           52.4    3e-05   Mangifera indica
gb|AAG09817.1|  cinnamoyl CoA reductase                               52.4    3e-05   Lolium perenne [perennial ryegrass]
ref|XP_002303845.1|  cinnamoyl CoA reductase family protein           52.4    3e-05   Populus trichocarpa [western balsam poplar]
gb|EMT12003.1|  Dihydroflavonol-4-reductase                           51.2    3e-05   
emb|CAC07424.1|  cinnamoyl-CoA reductase                              52.4    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007216959.1|  hypothetical protein PRUPE_ppa015546mg           51.6    3e-05   
gb|ACE95172.1|  cinnamoyl-CoA reductase                               52.4    3e-05   Populus tomentosa [Chinese white poplar]
emb|CAA12276.1|  cinnamoyl CoA reductase                              52.4    3e-05   Populus trichocarpa [western balsam poplar]
gb|ACF17647.1|  putative cinnamoyl-CoA reductase                      52.4    3e-05   Capsicum annuum
gb|AAP20866.1|  putative dihydroflavonol 4-reductase                  52.4    3e-05   Anthurium andraeanum [flamingo-lily]
gb|ABR21214.1|  CCR                                                   48.9    3e-05   Lilium hybrid cultivar
emb|CDX87593.1|  BnaA07g32800D                                        52.0    3e-05   
ref|XP_007215504.1|  hypothetical protein PRUPE_ppa006945mg           50.8    3e-05   
ref|XP_002273454.1|  PREDICTED: cinnamoyl-CoA reductase 1             52.0    3e-05   Vitis vinifera
gb|AHL46438.1|  dihydroflavonol 4-reductase                           52.0    3e-05   Fragaria vesca [alpine strawberry]
gb|AHG93972.1|  dihydroflavonol 4-reductase                           47.4    3e-05   Musa AB Group
ref|XP_004515542.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...  52.0    3e-05   Cicer arietinum [garbanzo]
ref|NP_001292199.1|  bifunctional dihydroflavonol 4-reductase/fla...  52.0    3e-05   Fragaria vesca [alpine strawberry]
ref|XP_002449636.1|  hypothetical protein SORBIDRAFT_05g020500        52.0    4e-05   Sorghum bicolor [broomcorn]
gb|AAN63056.1|  dihydroflavonol reductase                             52.0    4e-05   Populus tremuloides
gb|KCW70363.1|  hypothetical protein EUGRSUZ_F03605                   51.6    4e-05   Eucalyptus grandis [rose gum]
gb|KDO48508.1|  hypothetical protein CISIN_1g030431mg                 50.4    4e-05   Citrus sinensis [apfelsine]
gb|KDO48506.1|  hypothetical protein CISIN_1g030431mg                 50.4    4e-05   Citrus sinensis [apfelsine]
gb|EMS54677.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  52.0    4e-05   Triticum urartu
gb|KJB56522.1|  hypothetical protein B456_009G124300                  51.2    4e-05   Gossypium raimondii
gb|KCW70362.1|  hypothetical protein EUGRSUZ_F03605                   51.6    4e-05   Eucalyptus grandis [rose gum]
gb|AIZ74402.1|  dihydroflavonol 4-reductase                           52.0    4e-05   Anthurium andraeanum [flamingo-lily]
gb|ABC94578.1|  dihydroflavonol 4-reductase                           52.0    4e-05   Anthurium andraeanum [flamingo-lily]
ref|NP_001061909.1|  Os08g0441500                                     52.0    4e-05   
ref|XP_009758397.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.6    4e-05   Nicotiana sylvestris
ref|XP_006660629.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        52.0    4e-05   Oryza brachyantha
ref|XP_008228790.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.6    4e-05   Prunus mume [ume]
ref|XP_010063166.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        51.6    4e-05   Eucalyptus grandis [rose gum]
gb|AEN02913.1|  CCR7                                                  51.6    4e-05   Populus nigra [black poplar]
gb|ABE01414.1|  dihydroflavonol 4-reductase                           51.6    4e-05   Anthurium andraeanum [flamingo-lily]
ref|XP_003563601.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.6    4e-05   Brachypodium distachyon [annual false brome]
gb|AHL46440.1|  dihydroflavonol 4-reductase                           51.6    4e-05   Fragaria vesca [alpine strawberry]
ref|XP_003638261.1|  Dihydroflavonol reductase                        51.6    5e-05   
emb|CBI40770.3|  unnamed protein product                              51.6    5e-05   Vitis vinifera
gb|AAR27014.1|  dihydroflavanol-4-reductase 1                         51.6    5e-05   Medicago truncatula
emb|CDP19336.1|  unnamed protein product                              51.6    5e-05   Coffea canephora [robusta coffee]
ref|XP_010664016.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X1  51.6    5e-05   Vitis vinifera
ref|XP_010664019.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X2  51.6    5e-05   
gb|EEE68772.1|  hypothetical protein OsJ_27480                        51.6    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AGU43753.1|  cinnamoyl-CoA reductase                               51.6    5e-05   Populus tomentosa [Chinese white poplar]
ref|XP_011034793.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        51.2    6e-05   Populus euphratica
dbj|BAO53730.1|  dihydroflavonol 4-reducatase 2                       51.6    6e-05   Glycine max [soybeans]
ref|XP_009594427.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        51.2    6e-05   Nicotiana tomentosiformis
ref|XP_003550388.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  51.6    6e-05   
gb|KJB56520.1|  hypothetical protein B456_009G124300                  51.2    6e-05   
ref|XP_002275562.1|  PREDICTED: cinnamoyl-CoA reductase 2             51.2    6e-05   
gb|KHG14771.1|  Dihydroflavonol-4-reductase                           51.2    6e-05   
ref|XP_006648089.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.2    6e-05   
gb|ACQ59094.1|  cinnamoyl-CoA reductase 4                             51.2    6e-05   
gb|KJB56519.1|  hypothetical protein B456_009G124300                  51.2    6e-05   
gb|AAG51951.1|AC015450_12  putative cinnamoyl-CoA reductase; 2770...  51.2    6e-05   
dbj|BAO53727.1|  dihydroflavonol 4-reducatase 2                       51.2    6e-05   
ref|XP_006601319.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  51.2    6e-05   
ref|XP_004965853.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...  51.2    6e-05   
gb|AAF16654.1|AC012394_3  putative cinnamoyl-CoA reductase; 14056...  51.2    6e-05   
gb|KJB56521.1|  hypothetical protein B456_009G124300                  51.2    6e-05   
ref|NP_177773.2|  NAD(P)-binding Rossmann-fold superfamily protein    51.2    7e-05   
gb|AAU89441.1|  NADPH-dependent reductase A1-b                        50.4    7e-05   
gb|ABQ95551.1|  cinnamoyl CoA reductase                               49.3    7e-05   
gb|AAU89446.1|  NADPH-dependent reductase A1-b                        50.4    7e-05   
gb|ABQ95547.1|  cinnamoyl CoA reductase                               49.3    7e-05   
gb|ABQ95552.1|  cinnamoyl CoA reductase                               49.3    7e-05   
gb|AJK93390.1|  cinnamoyl CoA reductase                               51.2    7e-05   
gb|AAC25960.1|  dihydroflavonol 4-reductase                           51.2    7e-05   
gb|AFK40442.1|  unknown                                               48.9    7e-05   
ref|XP_006648087.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        51.2    7e-05   
ref|XP_007135794.1|  hypothetical protein PHAVU_010G159000g           51.2    7e-05   
gb|AAU89442.1|  NADPH-dependent reductase A1-b                        50.1    7e-05   
gb|ACZ59062.1|  cinnamoyl CoA reductase                               48.5    7e-05   
gb|AAU89468.1|  NADPH-dependent reductase A1-b                        50.1    8e-05   
gb|EMT01339.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  50.8    8e-05   
ref|XP_002300759.1|  dihydroflavonol reductase family protein         51.2    8e-05   
dbj|BAD14922.1|  cinnamoyl coenzyme A reductase                       50.8    8e-05   
ref|XP_007215651.1|  hypothetical protein PRUPE_ppa008280mg           50.8    8e-05   
dbj|BAM05562.1|  cinnamoyl-CoA reductase                              48.5    8e-05   
gb|ABC40969.1|  cinnamoyl CoA reductase                               49.3    8e-05   
gb|AAU12363.1|  dihydroflavonol 4-reductase                           50.8    8e-05   
gb|EEC84581.1|  hypothetical protein OsI_31388                        50.8    8e-05   
ref|XP_006427615.1|  hypothetical protein CICLE_v10026007mg           50.8    8e-05   
gb|EMS45945.1|  Dihydroflavonol-4-reductase                           50.8    8e-05   
ref|XP_010913861.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.8    8e-05   
gb|ACZ59074.1|  cinnamoyl CoA reductase                               48.5    8e-05   
gb|ACZ59070.1|  cinnamoyl CoA reductase                               48.5    8e-05   
emb|CDP19306.1|  unnamed protein product                              50.8    8e-05   
ref|XP_008232658.1|  PREDICTED: vestitone reductase-like              50.8    8e-05   
gb|ACZ59077.1|  cinnamoyl CoA reductase                               48.5    8e-05   
gb|ACZ59065.1|  cinnamoyl CoA reductase                               48.5    8e-05   
gb|KGN58664.1|  hypothetical protein Csa_3G716370                     48.9    8e-05   
gb|AAL47182.1|  cinnamoyl-CoA reductase                               50.8    9e-05   
gb|ACZ59067.1|  cinnamoyl CoA reductase                               48.5    9e-05   
ref|XP_001769440.1|  predicted protein                                50.8    9e-05   
ref|XP_001765354.1|  predicted protein                                50.8    9e-05   
ref|XP_002988921.1|  cinnamoyl-CoA reductase                          50.8    9e-05   
gb|ACZ59075.1|  cinnamoyl CoA reductase                               48.5    9e-05   
gb|ACZ59064.1|  cinnamoyl CoA reductase                               48.5    9e-05   
gb|ACZ59071.1|  cinnamoyl CoA reductase                               48.5    9e-05   
gb|ACZ59069.1|  cinnamoyl CoA reductase                               48.5    9e-05   
gb|ACZ59068.1|  cinnamoyl CoA reductase                               48.5    9e-05   
gb|ACZ59073.1|  cinnamoyl CoA reductase                               48.5    9e-05   
ref|XP_006341347.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2  50.8    9e-05   
ref|XP_011020617.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.8    9e-05   
ref|XP_002971834.1|  hypothetical protein SELMODRAFT_172432           50.8    9e-05   
ref|XP_006433231.1|  hypothetical protein CICLE_v10003684mg           50.8    9e-05   
gb|AJK93560.1|  dihydroflavonol reductase 2                           50.8    1e-04   
gb|KFK42068.1|  hypothetical protein AALP_AA2G207000                  51.2    1e-04   
gb|AGJ84130.1|  putative cinnamoyl-CoA reductase                      50.8    1e-04   
dbj|BAE17125.1|  dihydroflavonol 4-reductase                          50.8    1e-04   
ref|XP_009398122.1|  PREDICTED: dihydroflavonol-4-reductase-like      50.8    1e-04   
gb|EMT05980.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  50.8    1e-04   
gb|ADK24219.1|  cinnamoyl-CoA reductase                               50.8    1e-04   
gb|AEF14420.1|  dihydroflavonol 4-reductase                           50.8    1e-04   
gb|ACZ59080.1|  cinnamoyl CoA reductase                               48.1    1e-04   
ref|XP_008783864.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.4    1e-04   
ref|XP_002974909.1|  cinnamoyl-CoA reductase                          50.4    1e-04   
ref|XP_009396003.1|  PREDICTED: dihydroflavonol-4-reductase-like      50.4    1e-04   
gb|AEI59122.1|  dihydroflavonol 4-reductase                           50.4    1e-04   
ref|XP_008655509.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  50.4    1e-04   
ref|NP_001274901.1|  cinnamoyl CoA reductase                          50.4    1e-04   
gb|ABK27116.1|  unknown                                               50.4    1e-04   
ref|XP_004967651.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.4    1e-04   
emb|CAE47015.1|  dihydroflavonol reductase                            48.1    1e-04   
gb|AAX12421.1|  dihydroflavonol 4-reductase                           50.4    1e-04   
gb|AAL09429.1|AF307997_1  cinnamoyl-CoA reductase I                   50.1    1e-04   
dbj|BAE19953.1|  dihydroflavonol 4-reductase                          50.4    1e-04   
ref|XP_010094511.1|  Bifunctional dihydroflavonol 4-reductase/fla...  50.4    1e-04   
gb|KHN20964.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  50.4    1e-04   
gb|AAS89833.1|  dihydroflavonol 4-reductase                           50.4    1e-04   
gb|AII26023.1|  dihydroflavanol 4-reductase                           50.4    1e-04   
ref|XP_002454758.1|  hypothetical protein SORBIDRAFT_04g036780        50.4    1e-04   
gb|KEH28669.1|  cinnamoyl-CoA reductase                               50.4    1e-04   
ref|XP_003599704.1|  Dihydroflavonol-4-reductase                      50.4    1e-04   
gb|EMT20346.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  50.1    1e-04   
gb|AAU89448.1|  NADPH-dependent reductase A1-b                        49.3    1e-04   
ref|NP_001238612.1|  dihydroflavonol-4-reductase DFR1                 50.4    1e-04   
emb|CDO98223.1|  unnamed protein product                              50.4    1e-04   
gb|AGS10092.1|  cinnamoyl CoA reductase                               50.4    1e-04   
gb|ABE01883.1|  cinnamoyl-CoA reductase                               50.4    1e-04   
ref|NP_001239696.1|  uncharacterized protein LOC100778253             50.1    1e-04   
gb|EMS63443.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  50.4    1e-04   
gb|AAU89443.1|  NADPH-dependent reductase A1-b                        49.3    1e-04   
gb|AAU89444.1|  NADPH-dependent reductase A1-b                        49.3    1e-04   
ref|XP_010910039.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.1    1e-04   
emb|CEL26662.1|  dihydroflavonol 4-reductase                          50.1    1e-04   
ref|XP_006649158.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.1    1e-04   
gb|ABQ95557.1|  cinnamoyl CoA reductase                               49.7    1e-04   
gb|AAV71171.1|  dihydroflavonol reductase                             50.1    2e-04   
ref|XP_002879459.1|  predicted protein                                50.1    2e-04   
gb|AAF23884.2|AF117263_1  dihydroflavanol reductase 3                 50.1    2e-04   
ref|XP_006857188.1|  hypothetical protein AMTR_s00065p00187410        50.1    2e-04   
ref|XP_011028872.1|  PREDICTED: dihydroflavonol-4-reductase-like ...  50.1    2e-04   
gb|AFK35141.1|  unknown                                               50.1    2e-04   
gb|ACR38744.1|  unknown                                               49.7    2e-04   
dbj|BAE19948.1|  dihydroflavonol 4-reductase                          50.1    2e-04   
gb|AHZ97873.1|  dihydroflavonol 4-reductase                           50.1    2e-04   
gb|AAG53687.1|AF320623_1  cinnamoyl CoA reductase CCR2                50.1    2e-04   
ref|XP_010269754.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  50.1    2e-04   
ref|XP_010664020.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X1  50.1    2e-04   
ref|XP_008658129.1|  PREDICTED: hypothetical protein isoform X1       50.1    2e-04   
gb|KCW72984.1|  hypothetical protein EUGRSUZ_E01431                   50.1    2e-04   
ref|XP_007023416.1|  Cinnamoyl coa reductase 1 isoform 1              50.1    2e-04   
ref|XP_002275531.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X2  50.1    2e-04   
emb|CAA75997.1|  dihydroflavonol4-reductase                           50.1    2e-04   
gb|ABB29303.1|  NADPH-dependent reductase                             50.1    2e-04   
gb|AFW87415.1|  hypothetical protein ZEAMMB73_560829                  48.9    2e-04   
ref|XP_008679177.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.1    2e-04   
tpg|DAA58432.1|  TPA: anthocyaninless1                                50.1    2e-04   
gb|AAW66345.1|  NADPH-dependent reductase                             50.1    2e-04   
gb|ABB29305.1|  NADPH-dependent reductase                             50.1    2e-04   
ref|XP_007219194.1|  hypothetical protein PRUPE_ppa016958mg           50.1    2e-04   
ref|XP_008461178.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        50.1    2e-04   
ref|NP_001152467.1|  dihydroflavonol-4-reductase                      50.1    2e-04   
sp|P51108.1|DFRA_MAIZE  RecName: Full=Dihydroflavonol-4-reductase...  50.1    2e-04   
gb|ACZ59066.1|  cinnamoyl CoA reductase                               47.0    2e-04   
ref|XP_002527302.1|  cinnamoyl-CoA reductase, putative                49.7    2e-04   
ref|XP_002300619.2|  cinnamoyl-CoA reductase family protein           49.7    2e-04   
ref|XP_010056321.1|  PREDICTED: vestitone reductase-like              49.7    2e-04   
gb|AJK93396.1|  cinnamoyl CoA reductase                               49.7    2e-04   
gb|AFW87418.1|  hypothetical protein ZEAMMB73_554716                  49.3    2e-04   
ref|XP_008365015.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...  48.1    2e-04   
ref|XP_002967434.1|  hypothetical protein SELMODRAFT_408445           49.7    2e-04   
emb|CAB94914.1|  dihydroflavonol 4-reductase                          49.3    2e-04   
gb|ACZ59063.1|  cinnamoyl CoA reductase                               47.0    2e-04   
dbj|BAK02115.1|  predicted protein                                    49.7    2e-04   
ref|XP_009414816.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        49.7    2e-04   
ref|XP_004964526.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        49.7    2e-04   
dbj|BAK03807.1|  predicted protein                                    49.7    2e-04   
emb|CAE47021.1|  dihydroflavonol reductase                            47.4    2e-04   
gb|AAR27015.1|  dihydroflavonal-4-reductase 2                         49.7    2e-04   
ref|NP_001063189.1|  Os09g0419200                                     49.7    2e-04   
gb|AFK35813.1|  unknown                                               49.7    2e-04   
emb|CEL26661.1|  dihydroflavonol 4-reductase                          49.7    2e-04   
gb|KHG12457.1|  Dihydroflavonol-4-reductase                           49.7    2e-04   
gb|ACZ74588.1|  cinnamoyl CoA reductase-like 1                        49.7    2e-04   
gb|EEC74212.1|  hypothetical protein OsI_09373                        49.7    2e-04   
gb|KJB58243.1|  hypothetical protein B456_009G200600                  48.9    2e-04   
dbj|BAJ98928.1|  predicted protein                                    49.7    2e-04   
gb|ACJ84553.1|  unknown                                               49.7    2e-04   
gb|AFK29457.1|  dihydroflavonol reductase                             47.4    2e-04   
emb|CAD21520.1|  cinnamoyl CoA reductase                              49.7    2e-04   
gb|EAY87967.1|  hypothetical protein OsI_09391                        49.7    2e-04   
ref|XP_004301616.1|  PREDICTED: cinnamoyl-CoA reductase 2-like        49.7    2e-04   
ref|XP_002510730.1|  cinnamoyl-CoA reductase, putative                49.7    2e-04   
emb|CEL26660.1|  dihydroflavonol 4-reductase                          49.3    2e-04   
gb|AGI16384.1|  dihydroflavonol 4-reductase                           49.7    2e-04   
ref|XP_006493351.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        49.3    3e-04   
ref|XP_007135814.1|  hypothetical protein PHAVU_010G160700g           49.3    3e-04   
ref|XP_004135875.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        49.3    3e-04   
ref|XP_011007452.1|  PREDICTED: dihydroflavonol-4-reductase           49.3    3e-04   
ref|NP_001048475.1|  Os02g0811400                                     49.3    3e-04   
gb|AFG26325.1|  cinnamoyl-CoA reductase                               49.3    3e-04   
gb|KGN58667.1|  hypothetical protein Csa_3G717870                     48.9    3e-04   
ref|XP_006294659.1|  hypothetical protein CARUB_v10023695mg           49.3    3e-04   
ref|XP_007160735.1|  hypothetical protein PHAVU_001G012800g           49.3    3e-04   
ref|XP_008377381.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  49.3    3e-04   
gb|ADP09380.1|  dihydroflavonol reductase                             49.3    3e-04   
dbj|BAD38253.1|  putative cinnamoyl CoA reductase                     49.3    3e-04   
gb|AFK36390.1|  unknown                                               48.1    3e-04   
gb|EPS74552.1|  hypothetical protein M569_00199                       49.3    3e-04   
gb|AHI49023.1|  dihydroflavonol 4-reductase                           49.3    3e-04   
gb|EAY87968.1|  hypothetical protein OsI_09392                        49.3    3e-04   
dbj|BAB92999.1|  dihydroflavonol reductase                            49.3    3e-04   
gb|KJB58247.1|  hypothetical protein B456_009G200600                  48.9    3e-04   
dbj|BAJ93680.1|  predicted protein                                    48.9    3e-04   
ref|XP_002307667.2|  dihydroflavonol reductase family protein         49.3    3e-04   
ref|XP_002456016.1|  hypothetical protein SORBIDRAFT_03g028890        49.3    3e-04   
gb|ABC40970.1|  cinnamoyl CoA reductase                               47.4    3e-04   
ref|XP_009336072.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  49.3    3e-04   
gb|EAZ08354.1|  hypothetical protein OsI_30609                        49.3    3e-04   
gb|ABC40976.1|  cinnamoyl CoA reductase                               47.4    3e-04   
gb|ABC40974.1|  cinnamoyl CoA reductase                               47.4    3e-04   
gb|ABC40972.1|  cinnamoyl CoA reductase                               47.4    3e-04   
gb|AAB94015.1|  NADPH-dependent reductase A1-b                        49.3    3e-04   
gb|ABC40973.1|  cinnamoyl CoA reductase                               47.4    3e-04   
gb|KEH39631.1|  cinnamoyl-CoA reductase-like protein                  49.3    3e-04   
ref|XP_010060970.1|  PREDICTED: dihydroflavonol-4-reductase           49.3    3e-04   
gb|AGZ15302.1|  dihydroflavonol 4-reductase                           49.3    3e-04   
ref|XP_009365091.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  49.3    3e-04   
gb|AFF60412.1|  dihydroflavonol reductase                             49.3    3e-04   
gb|AET74075.2|  dihydroflavonol 4-reductase                           49.3    3e-04   
ref|XP_011100066.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        49.3    3e-04   
gb|ABC40975.1|  cinnamoyl CoA reductase                               47.4    3e-04   
gb|AAO39816.1|  dihydroflavonol 4-reductase                           49.3    3e-04   
ref|NP_001280868.1|  bifunctional dihydroflavonol 4-reductase/fla...  49.3    3e-04   
gb|ACP30362.1|  dihydroflavonol-4-reductase protein                   49.3    3e-04   
gb|KJB58246.1|  hypothetical protein B456_009G200600                  49.3    3e-04   
gb|ABC40979.1|  cinnamoyl CoA reductase                               47.4    3e-04   
ref|XP_006383711.1|  hypothetical protein POPTR_0005s25110g           49.3    3e-04   
gb|ABC40978.1|  cinnamoyl CoA reductase                               47.4    3e-04   
ref|XP_003574536.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        49.3    3e-04   
gb|KJB58239.1|  hypothetical protein B456_009G200600                  49.3    3e-04   
gb|ABC40971.1|  cinnamoyl CoA reductase                               47.4    3e-04   
ref|NP_001234297.1|  cinnamoyl-CoA reductase                          48.9    3e-04   
ref|NP_001062712.1|  Os09g0262000                                     49.3    3e-04   
ref|XP_008659818.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...  48.9    3e-04   
ref|XP_010928788.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        48.9    4e-04   
gb|KDP36741.1|  hypothetical protein JCGZ_08032                       48.9    4e-04   
emb|CAD29427.1|  cinnamoyl-CoA reductase                              48.9    4e-04   
ref|XP_009382856.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        48.9    4e-04   
gb|EMS66440.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...  48.9    4e-04   
gb|AIX92152.1|  cinnamoyl-CoA reductase 1                             48.9    4e-04   
ref|XP_007160734.1|  hypothetical protein PHAVU_001G012700g           48.9    4e-04   
gb|ABQ95556.1|  cinnamoyl CoA reductase                               47.0    4e-04   
ref|XP_008659817.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...  48.9    4e-04   
ref|XP_003563599.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        48.9    4e-04   



>ref|XP_003546537.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
1 [Glycine max]
 gb|KHM98728.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=332

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE ED+ GRYLC+ST++   DLAS+L+ RYP LPIS RF K  DR +YE NT KLRSLG
Sbjct  241  VYENEDSHGRYLCSSTVMGEDDLASLLANRYPTLPISKRFEK-LDRPHYELNTGKLRSLG  299

Query  182  MKFKSLEE  205
             KFKS+EE
Sbjct  300  FKFKSVEE  307



>ref|XP_002283345.2| PREDICTED: tetraketide alpha-pyrone reductase 1 [Vitis vinifera]
 emb|CBI37707.3| unnamed protein product [Vitis vinifera]
Length=323

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E+A GRYLCNS ++D   LAS+LS RYP+LP+  RF    DR YYEFNTSKL+SLG
Sbjct  239  VYEHENAHGRYLCNSAVVDNNVLASLLSARYPSLPVPKRFDA-LDRPYYEFNTSKLQSLG  297

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  298  FKFKSIQE  305



>emb|CAN78571.1| hypothetical protein VITISV_020578 [Vitis vinifera]
Length=377

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E+A GRYLCNS ++D   LAS+LS RYP+LP+  RF    DR YYEFNTSKL+SLG
Sbjct  267  VYEHENAHGRYLCNSAVVDNNVLASLLSARYPSLPVPKRFDA-LDRPYYEFNTSKLQSLG  325

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  326  FKFKSIQE  333



>ref|XP_010090741.1| hypothetical protein L484_013763 [Morus notabilis]
 gb|EXB40460.1| hypothetical protein L484_013763 [Morus notabilis]
Length=100

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE +DA GRYLC+ST+ID  DLAS LS RYP+L    RF +  +R YYEFNTSKLRSLG
Sbjct  16   VYEDKDAHGRYLCSSTVIDNNDLASFLSARYPSLSAPKRFEQ-LNRPYYEFNTSKLRSLG  74

Query  182  MKFKSLEE  205
             KFK++ E
Sbjct  75   FKFKTINE  82



>gb|KJB47124.1| hypothetical protein B456_008G012400 [Gossypium raimondii]
Length=333

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST+ID  +L SILS RYP+LPI   F K  DR YYEF+TSK+RSLG
Sbjct  241  VYEHEGASGRYLCSSTVIDNDELVSILSARYPSLPIPKGFAK-LDRPYYEFDTSKIRSLG  299

Query  182  MKFKSLEE  205
             KF+ +EE
Sbjct  300  FKFRPIEE  307



>ref|XP_008349025.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=235

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LS RYP+LPI+ R  K   R YYEF+TSKL+SLG
Sbjct  151  VYEHESAHGRYLCSSTVLDNDELASLLSMRYPSLPIAKRL-KQVSRPYYEFDTSKLQSLG  209

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  210  FKFKSIQE  217



>ref|XP_008382527.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X2 [Malus domestica]
Length=259

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LS RYP+LPI+ R  K   R YYEF+TSKL+SLG
Sbjct  175  VYEHESAHGRYLCSSTVLDNDELASLLSMRYPSLPIAKRL-KQVSRPYYEFDTSKLQSLG  233

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  234  FKFKSIQE  241



>ref|XP_008382526.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Malus domestica]
Length=327

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LS RYP+LPI+ R  K   R YYEF+TSKL+SLG
Sbjct  243  VYEHESAHGRYLCSSTVLDNDELASLLSMRYPSLPIAKRL-KQVSRPYYEFDTSKLQSLG  301

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  302  FKFKSIQE  309



>gb|AEZ53298.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum]
Length=337

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA GRYLC+S ++D   L SILS+RYP+LPI  RF K  DR +YEFNT KL +LG
Sbjct  253  VYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRFKK-LDRPHYEFNTLKLENLG  311

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  312  MKFKSIEE  319



>ref|XP_009776908.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Nicotiana sylvestris]
Length=337

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA GRYLC+S ++D   L SILS+RYP+LPI  RF K  DR +YEFNT KL +LG
Sbjct  253  VYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRFKK-LDRPHYEFNTLKLENLG  311

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  312  MKFKSIEE  319



>ref|XP_009599462.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Nicotiana tomentosiformis]
Length=337

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA GRYLC+S ++D   L SILS+RYP+LPI  RF K  DR +YEFNT KL +LG
Sbjct  253  VYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRFKK-LDRPHYEFNTLKLENLG  311

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  312  MKFKSIEE  319



>ref|XP_011088719.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Sesamum indicum]
Length=335

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE E+A+GRYLC+ST++D   LA+ILS RYP LPI  RF K  DR +YE +TSKL+ LG
Sbjct  243  LYENENAKGRYLCSSTVLDNHQLAAILSARYPTLPIPKRFVK-LDRPHYELDTSKLKGLG  301

Query  182  MKFKSLEE  205
            M+F+S++E
Sbjct  302  MQFRSIQE  309



>ref|XP_006595128.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Glycine 
max]
Length=297

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E + GRYLC+ST++D  DLA++L+ RYP LPIS RF K  DR  YE NT KLRSLG
Sbjct  207  VYENEGSHGRYLCSSTVMDEDDLAALLANRYPTLPISKRFEK-LDRPNYELNTGKLRSLG  265

Query  182  MKFKSLEE  205
              FKS+EE
Sbjct  266  FNFKSVEE  273



>ref|XP_003543630.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoformX1 [Glycine 
max]
 gb|KHN32639.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=331

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E + GRYLC+ST++D  DLA++L+ RYP LPIS RF K  DR  YE NT KLRSLG
Sbjct  241  VYENEGSHGRYLCSSTVMDEDDLAALLANRYPTLPISKRFEK-LDRPNYELNTGKLRSLG  299

Query  182  MKFKSLEE  205
              FKS+EE
Sbjct  300  FNFKSVEE  307



>ref|XP_002523596.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF38791.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=328

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYEQE+A+GRY+C+STI+D  +L S LS RYP+L I  RF +  DR YYEFNTSKL+SLG
Sbjct  240  VYEQENARGRYICSSTILDNNELVSFLSARYPSLSIPKRFEQ-LDRPYYEFNTSKLKSLG  298

Query  182  MKFKSLEE  205
             KFKS+ +
Sbjct  299  FKFKSIHQ  306



>ref|XP_007043128.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao]
 gb|EOX98959.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao]
Length=357

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST+ID  +LA+ILS RYP+L +  RF +  DR YYEFNTSK+RSLG
Sbjct  265  VYEHEAANGRYLCSSTVIDNDELAAILSARYPSLTVPKRF-EDVDRPYYEFNTSKIRSLG  323

Query  182  MKFKSLEESL  211
              F+ +EE L
Sbjct  324  FNFRPIEEML  333



>ref|XP_010270636.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Nelumbo 
nucifera]
Length=326

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKP-EDRQYYEFNTSKLRSL  178
            VYE   AQGRYLC+S ++D  +LAS+L+KRYP LPI  RF     DR YYEFNTSKL SL
Sbjct  243  VYENISAQGRYLCSSKVLDNIELASLLAKRYPLLPIPKRFDSVFGDRPYYEFNTSKLESL  302

Query  179  GMKFKSLEE  205
            G KFKS+EE
Sbjct  303  GFKFKSIEE  311



>gb|AFC36879.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum]
Length=337

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA GRYLC+S ++D   L  ILS+RYP+LPI  RF K  DR +YEFNT KL +LG
Sbjct  253  VYEHPDAHGRYLCSSKVLDNNQLVPILSERYPSLPIPKRFKK-LDRPHYEFNTLKLENLG  311

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  312  MKFKSIEE  319



>ref|XP_010270635.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X1 [Nelumbo 
nucifera]
Length=360

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKP-EDRQYYEFNTSKLRSL  178
            VYE   AQGRYLC+S ++D  +LAS+L+KRYP LPI  RF     DR YYEFNTSKL SL
Sbjct  277  VYENISAQGRYLCSSKVLDNIELASLLAKRYPLLPIPKRFDSVFGDRPYYEFNTSKLESL  336

Query  179  GMKFKSLEE  205
            G KFKS+EE
Sbjct  337  GFKFKSIEE  345



>emb|CDX75502.1| BnaA01g02000D [Brassica napus]
Length=319

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S ++ +++L S LS RYP+LPI  RF K  +R +Y+F+TSK++SLG
Sbjct  231  VFEHEAAQGRYICSSNVVSLEELVSFLSTRYPSLPIPKRFEKL-NRLHYDFDTSKIKSLG  289

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  290  LKFKSLEE  297



>ref|NP_195268.2| dihydroflavonol 4-reductase-like1 [Arabidopsis thaliana]
 sp|Q500U8.1|TKPR1_ARATH RecName: Full=Tetraketide alpha-pyrone reductase 1; AltName: 
Full=Protein DIHYDROFLAVONOL 4-REDUCTASE-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAY34180.1| At4g35420 [Arabidopsis thaliana]
 gb|ABF74722.1| At4g35420 [Arabidopsis thaliana]
 gb|AEE86509.1| dihydroflavonol 4-reductase-like1 [Arabidopsis thaliana]
Length=326

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF K  +R +Y+F+TSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEK-LNRLHYDFDTSKIQSLG  298

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  299  LKFKSLEE  306



>ref|XP_010437474.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Camelina sativa]
Length=326

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF K  +R +Y FNTSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRFEK-LNRLHYNFNTSKIQSLG  298

Query  182  MKFKSLEE  205
             KFKSLEE
Sbjct  299  FKFKSLEE  306



>ref|XP_009358921.1| PREDICTED: LOW QUALITY PROTEIN: tetraketide alpha-pyrone reductase 
1 [Pyrus x bretschneideri]
Length=325

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRY+C+ST++D  +L S+LS RYP+LPI  RF +     YYE NTSK+ SLG
Sbjct  240  VYEHESAHGRYVCSSTVMDNTELGSLLSTRYPSLPIPTRFEQLGRPHYYELNTSKMESLG  299

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  300  FKFKSIQE  307



>ref|XP_008382751.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Malus domestica]
Length=329

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LS RYP+LPI  RF +   R +YE NTSK+ SLG
Sbjct  245  VYEHESAHGRYLCSSTVLDNNELASLLSARYPSLPIPARFEQ-LGRPHYEMNTSKMESLG  303

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  304  FKFKSIQE  311



>ref|XP_002867074.1| dihydroflavonol 4-reductase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43333.1| dihydroflavonol 4-reductase family [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF K  +R +Y F+TSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEK-LNRLHYAFDTSKIQSLG  298

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  299  LKFKSLEE  306



>ref|XP_010432286.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Camelina 
sativa]
Length=326

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF K  +R +Y FNTSK++SLG
Sbjct  240  VFEHEAAQGRYICSSDVISLEELVSFLSTRYPSLPIPKRFEK-LNRLHYNFNTSKIQSLG  298

Query  182  MKFKSLEE  205
             KFKSLEE
Sbjct  299  FKFKSLEE  306



>ref|XP_009102146.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Brassica rapa]
Length=328

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S  + +++L S LS RYP+LPI  RF K  +R +Y+F+TSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNFVSLEELVSFLSTRYPSLPIPKRFEK-LNRLHYDFDTSKIKSLG  298

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  299  LKFKSLEE  306



>gb|KDO68446.1| hypothetical protein CISIN_1g0360952mg, partial [Citrus sinensis]
Length=183

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRS-L  178
            VYE +++ GRYLC+ST++D  +L S+LS RYP LPI  RF +  DR YYEFNTSKL S L
Sbjct  100  VYEHQNSHGRYLCSSTVVDNNELVSLLSTRYPLLPIPERF-ELLDRPYYEFNTSKLTSLL  158

Query  179  GMKFKSLEE  205
            G KFKS+EE
Sbjct  159  GFKFKSIEE  167



>gb|KJB47141.1| hypothetical protein B456_008G012500 [Gossypium raimondii]
Length=303

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST+ID  +L SILS RYP+LPI   F K  DR YY+FNTSKL SLG
Sbjct  222  VYEHEGASGRYLCSSTVIDNDELVSILSARYPSLPIPKGFAK-LDRTYYKFNTSKLTSLG  280

Query  182  MKFKSLEE  205
              FK +EE
Sbjct  281  --FKPIEE  286



>ref|XP_010446925.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Camelina 
sativa]
Length=326

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF K  +R  Y FNTSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRFEK-LNRLSYNFNTSKIQSLG  298

Query  182  MKFKSLEE  205
             KFKSLEE
Sbjct  299  FKFKSLEE  306



>emb|CDY41656.1| BnaC03g62280D [Brassica napus]
Length=317

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+EQE AQGRY+C+S ++ +++L S LS  YP+LP+  RF K  +R +YEF+TSK+ SLG
Sbjct  231  VFEQEAAQGRYICSSKVVSLEELVSFLSTSYPSLPVPKRFEKL-NRLHYEFDTSKIESLG  289

Query  182  MKFKSLEE  205
            +KFK+LEE
Sbjct  290  LKFKTLEE  297



>ref|XP_004290099.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Fragaria vesca 
subsp. vesca]
Length=329

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRY+CNST++D  +LAS+L  RYP+LPI  RF + E R +Y+ +TSKL+SLG
Sbjct  245  VYEHESAHGRYICNSTVLDNNELASLLCTRYPSLPIPERFEELE-RPHYDLSTSKLKSLG  303

Query  182  MKFKSLEE  205
             KFK+++E
Sbjct  304  FKFKTIQE  311



>ref|XP_008235844.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=335

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LSK+YP+LPI  RF +   R  Y+ NTSKL+SLG
Sbjct  252  VYEHESAHGRYLCSSTVLDNNELASLLSKQYPSLPIPKRFEQ-LGRPRYDLNTSKLKSLG  310

Query  182  MKFKSLEE  205
             KFK+++E
Sbjct  311  FKFKTIQE  318



>ref|XP_006486836.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Citrus 
sinensis]
Length=323

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRS-L  178
            VYE +++ GRYLC+ST++D  +L S+LS RYP LPI  RF +  DR YYEFNTSKL S L
Sbjct  240  VYEHQNSHGRYLCSSTVVDNNELVSLLSTRYPLLPIPERF-ELLDRPYYEFNTSKLTSLL  298

Query  179  GMKFKSLEE  205
            G KFKS+EE
Sbjct  299  GFKFKSIEE  307



>ref|XP_006422368.1| hypothetical protein CICLE_v10028834mg [Citrus clementina]
 gb|ESR35608.1| hypothetical protein CICLE_v10028834mg [Citrus clementina]
Length=325

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRS-L  178
            VYE +++ GRYLC+ST++D  +L S+LS RYP LPI  RF +  DR YYEFNTSKL S L
Sbjct  242  VYEHQNSHGRYLCSSTVVDNNELVSLLSTRYPLLPIPERF-ELLDRPYYEFNTSKLTSLL  300

Query  179  GMKFKSLEE  205
            G KFKS+EE
Sbjct  301  GFKFKSIEE  309



>gb|EYU23972.1| hypothetical protein MIMGU_mgv1a009951mg [Erythranthe guttata]
Length=326

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE E A+GRY+C+S ++D  +LA+IL  +YP LPI  RF K E R YYE + SKLR LG
Sbjct  243  LYENESAKGRYICSSRVVDNDELAAILLAQYPTLPIPKRFEKLE-RAYYELDVSKLRGLG  301

Query  182  MKFKSLEE  205
            MKF+S+EE
Sbjct  302  MKFRSIEE  309



>ref|XP_008235846.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=337

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LSK+YP+LPI  RF +   R  Y+ NTSKL+SLG
Sbjct  252  VYEHESANGRYLCSSTVLDNNELASLLSKQYPSLPIPKRFEQ-LGRPRYDLNTSKLKSLG  310

Query  182  MKFKSLEE  205
             KFK+++E
Sbjct  311  FKFKTIQE  318



>gb|EYU23973.1| hypothetical protein MIMGU_mgv1a009951mg [Erythranthe guttata]
Length=321

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE E A+GRY+C+S ++D  +LA+IL  +YP LPI  RF K E R YYE + SKLR LG
Sbjct  238  LYENESAKGRYICSSRVVDNDELAAILLAQYPTLPIPKRFEKLE-RAYYELDVSKLRGLG  296

Query  182  MKFKSLEE  205
            MKF+S+EE
Sbjct  297  MKFRSIEE  304



>ref|XP_004236874.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Solanum lycopersicum]
Length=338

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D   L S+LS+RYP+LPI  RF K  DR  Y+FNT KL  LG
Sbjct  254  VYEHPSAHGRYLCSSKVLDNNQLVSVLSERYPSLPIPKRF-KELDRPSYDFNTLKLEGLG  312

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  313  MKFKSIEE  320



>emb|CDX69139.1| BnaC01g03140D [Brassica napus]
Length=319

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E A GRY+C+S ++ +++L S LS RYP++PI  RF K  +R +Y+F+TSK++SLG
Sbjct  231  VFEHEAAGGRYICSSNVVSLEELVSFLSTRYPSVPIPKRFEKL-NRLHYDFDTSKIKSLG  289

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  290  LKFKSLEE  297



>ref|XP_006360850.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Solanum 
tuberosum]
Length=338

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D   L S+LS+RYP+LPI  RF K  DR  Y+FNT KL  LG
Sbjct  254  VYEHPSAHGRYLCSSKVLDNNQLVSVLSERYPSLPIPKRF-KELDRPSYDFNTLKLEGLG  312

Query  182  MKFKSLEE  205
            MKFKS+EE
Sbjct  313  MKFKSIEE  320



>ref|XP_007200400.1| hypothetical protein PRUPE_ppa008548mg [Prunus persica]
 gb|EMJ01599.1| hypothetical protein PRUPE_ppa008548mg [Prunus persica]
Length=327

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+ST++D  +LAS+LS++YP+LPI  RF +   R  Y+ NTSKL+SLG
Sbjct  244  VYEHESAHGRYLCSSTVLDNNELASLLSRQYPSLPIPKRFEQ-LGRPRYDLNTSKLKSLG  302

Query  182  MKFKSLEE  205
             KFK+++E
Sbjct  303  FKFKTIQE  310



>ref|XP_010690599.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Beta vulgaris 
subsp. vulgaris]
Length=329

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 8/82 (10%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+E+A GRYLC+ST+++  +LAS L+ RYP+ PI   FTK  DR YY +NTSK+ +LG
Sbjct  248  VYEREEAHGRYLCSSTVMEHYELASFLASRYPSYPIPRGFTK-LDRPYYTYNTSKIENLG  306

Query  182  MKFKSLEE-------SLMTLSH  226
             KFK +EE       SL+T  H
Sbjct  307  FKFKPIEEMFDDCVNSLITQGH  328



>gb|KFK30181.1| hypothetical protein AALP_AA7G228100 [Arabis alpina]
Length=326

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF    +R +Y+ +TSK++SLG
Sbjct  240  VFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRFEN-LNRLHYDLDTSKIKSLG  298

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  299  LKFKSLEE  306



>emb|CDP14491.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 81.6 bits (200),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +AQGRYLC+ST++D  +LASILS  YP LPI  RF K ++R  Y+ NTSKL  LG
Sbjct  244  VYERRNAQGRYLCSSTVLDNDELASILSATYPALPIPKRFHKLDNRPSYDLNTSKLEGLG  303

Query  182  MK-FKSLEE  205
             K F+S+ E
Sbjct  304  FKNFRSIRE  312


 Score = 28.9 bits (63),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +1

Query  208  FDDTVTSLMEQGHLS  252
            FDD + SL+EQGHLS
Sbjct  314  FDDCIASLVEQGHLS  328



>ref|XP_010028888.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Eucalyptus grandis]
 gb|KCW55714.1| hypothetical protein EUGRSUZ_I01552 [Eucalyptus grandis]
Length=330

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+  A  RY+C++ ++D  +L S LS RYP+LP+  RF +P DR YYE+NTSKL+SLG
Sbjct  241  VYEERSACRRYICSAVVLDNNELVSFLSSRYPSLPVPRRF-EPLDRPYYEYNTSKLKSLG  299

Query  182  MKFKSLEE  205
             +FKS+EE
Sbjct  300  FEFKSVEE  307



>ref|XP_002311546.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa]
 gb|EEE88913.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa]
Length=320

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+S ++D  +LAS LS+RYP+LPI  RF + + R YYEFNTS+L  LG
Sbjct  231  VYEDETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRFEQLK-RPYYEFNTSRLERLG  289

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  290  FKFKPIQE  297



>ref|XP_006379787.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa]
 gb|ERP57584.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa]
Length=329

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+S ++D  +LAS LS+RYP+LPI  RF + + R YYEFNTS+L  LG
Sbjct  240  VYEDETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRFEQLK-RPYYEFNTSRLERLG  298

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  299  FKFKPIQE  306



>ref|XP_010548188.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Tarenaya 
hassleriana]
Length=329

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE + A GRY+C+STI+D+++L S LS RY +LPI  RF K  +R +Y+F+TSK++SLG
Sbjct  241  VYEHKAAHGRYICSSTIVDLEELISFLSTRYASLPIPKRFEK-LNRLHYDFDTSKIKSLG  299

Query  182  MKFKSLEE  205
             +FK LEE
Sbjct  300  FEFKPLEE  307



>ref|XP_004486774.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cicer arietinum]
Length=333

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE + + GRYLC+STI++  DL ++L+ RYP LPI  RF K  DR +YE +T KLRSLG
Sbjct  243  LYEDKASHGRYLCSSTIMENDDLVAMLATRYPALPIPKRFQK-LDRPHYELDTEKLRSLG  301

Query  182  MKFKSLEE  205
             KFKS+EE
Sbjct  302  FKFKSVEE  309



>ref|XP_008448150.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Cucumis melo]
Length=328

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            +E +DAQGRY+C+S +++I DLAS LS RYP  PIS +F +  +R YY++N SK+  LGM
Sbjct  245  FENKDAQGRYICSSIVLEINDLASRLSSRYPLFPISKKF-EASNRPYYDYNMSKIEKLGM  303

Query  185  KFKSLEE  205
            KFK +EE
Sbjct  304  KFKCVEE  310



>emb|CDY24810.1| BnaA08g15000D [Brassica napus]
Length=317

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+EQE A+GRY+C+S ++ +++L S LS RYP+LPI  RF K  +R +Y+ +TSK++SLG
Sbjct  231  VFEQEAAKGRYICSSKVVSLEELVSFLSTRYPSLPIPKRFKK-LNRLHYDLDTSKIKSLG  289

Query  182  MKFKSLEE  205
            ++FK LEE
Sbjct  290  LEFKPLEE  297



>ref|XP_009109293.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Brassica 
rapa]
Length=326

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+EQE A+GRY+C+S ++ +++L S LS RYP+LPI  RF K  +R +Y+ +TSK++SLG
Sbjct  240  VFEQEAAKGRYICSSKVVSLEELVSFLSTRYPSLPIPKRFKK-LNRLHYDLDTSKIKSLG  298

Query  182  MKFKSLEE  205
            ++FK LEE
Sbjct  299  LEFKPLEE  306



>ref|XP_007150619.1| hypothetical protein PHAVU_005G167400g [Phaseolus vulgaris]
 gb|ESW22613.1| hypothetical protein PHAVU_005G167400g [Phaseolus vulgaris]
Length=323

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E + GRYLC+S +++  DLA++L+ RYP L IS RF K  DR  Y+ NT KL+SLG
Sbjct  237  VYEDEGSHGRYLCSSVVMNEDDLAALLANRYPTLSISPRFEKV-DRAQYQLNTQKLKSLG  295

Query  182  MKFKSLEE  205
             KFKS+EE
Sbjct  296  FKFKSIEE  303



>ref|XP_006412106.1| hypothetical protein EUTSA_v10025703mg [Eutrema salsugineum]
 gb|ESQ53559.1| hypothetical protein EUTSA_v10025703mg [Eutrema salsugineum]
Length=326

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V+E + A+GRY+C+S ++ + +L S LS RYP+LPI  RF K  +R +Y  +TSK+RSLG
Sbjct  240  VFEHKAARGRYICSSNVVSLDELVSFLSTRYPSLPIPKRFEK-LNRLHYNLDTSKIRSLG  298

Query  182  MKFKSLEE  205
            +KFKSLEE
Sbjct  299  LKFKSLEE  306



>ref|XP_004139985.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 ref|XP_004171590.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 gb|KGN46632.1| hypothetical protein Csa_6G116160 [Cucumis sativus]
Length=328

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             +E +DAQGRY+C+S +++I DLAS LS RYP  PIS RF +  +R YY++N SK+  LG
Sbjct  244  AFENKDAQGRYICSSIVLEIDDLASRLSSRYPLFPISKRF-EASNRPYYDYNMSKIEKLG  302

Query  182  MKFKSLEE  205
            MK K +EE
Sbjct  303  MKLKCVEE  310



>ref|XP_004957228.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Setaria 
italica]
Length=329

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRYLC+S ++D  +L S L+KRYP  PI  R  KP  +Q Y+ NTSKL+ LG
Sbjct  242  VYETPEATGRYLCSSVVLDNDELVSFLAKRYPIFPIPRRLDKPYGKQTYQLNTSKLQGLG  301

Query  182  MKFKSLEE  205
             KF+ L+E
Sbjct  302  FKFRGLQE  309



>ref|XP_009386710.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Musa acuminata 
subsp. malaccensis]
Length=326

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            VYE ++AQGRYLC+S ++D  ++A++L+ RYP+LPI NRF     +   Y+F+TSKLR L
Sbjct  242  VYENDNAQGRYLCSSNVLDNHEVAALLANRYPSLPIPNRFHNYHAEIPRYQFDTSKLRDL  301

Query  179  GMKFKSLEE  205
            G KFK  EE
Sbjct  302  GFKFKGTEE  310



>ref|XP_003597698.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES67949.1| dihydroflavonol reductase [Medicago truncatula]
Length=330

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE + + GRYLC+S I+D  DL  +L+ RYP  PI  RF K  DR +YE NT KL SLG
Sbjct  238  LYENKASDGRYLCSSKIMDNDDLVGMLANRYPGFPIPKRFKK-LDRPHYELNTGKLESLG  296

Query  182  MKFKSLEE  205
             KFKS+EE
Sbjct  297  FKFKSVEE  304



>ref|XP_011024587.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Populus euphratica]
Length=329

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GRYLC+S ++D  +LAS LS+RYP+LPI  RF + + R YYEF+T++L  LG
Sbjct  240  VYEDETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRFEQLK-RPYYEFDTTRLERLG  298

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  299  FKFKPIQE  306



>ref|XP_002462592.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor]
 gb|EER99113.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor]
Length=329

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S+L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  242  VYETPHATGRYLCSSVVLDNDELVSLLAKRYPVFPIPRRLNSPYGKQSYQLNTSKLQGLG  301

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  302  FKFRGVQE  309



>gb|KDP31942.1| hypothetical protein JCGZ_12403 [Jatropha curcas]
Length=269

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE + A GRYLC+S+++D  +L S LS  YP+LP+  RF +  +R +Y+FNTSKL+SLG
Sbjct  182  VYEHQSAVGRYLCSSSVLDNDELVSFLSAHYPSLPVPKRFEQ-LNRPFYDFNTSKLKSLG  240

Query  182  MKFKSLEE  205
             +FKS+++
Sbjct  241  FEFKSIKK  248



>gb|EMS64586.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=293

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRYLC+S ++D  +L  +L+K++P  PI  R + P  +Q Y+ NTSKL+ LG
Sbjct  206  VYETPEASGRYLCSSVVLDNNELVGLLTKQFPVFPIPRRLSNPYGKQAYQLNTSKLQGLG  265

Query  182  MKFKSLEE  205
            +KFK ++E
Sbjct  266  LKFKGVQE  273



>ref|XP_010531309.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Tarenaya 
hassleriana]
Length=322

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQ--YYEFNTSKLRS  175
            VYE + A+GRYLC+S ++ +  L S+ S RYP+LPI+   T+ ED +  +Y++NTSK+ S
Sbjct  240  VYEHKAARGRYLCSSAVVGLDQLVSLFSARYPSLPIAT--TRIEDTKELHYDYNTSKITS  297

Query  176  LGMKFKSLEE  205
            LG+KFKSLEE
Sbjct  298  LGLKFKSLEE  307



>dbj|BAK06753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A+GRYLC+S ++D  +L  +L+K++P  PI  R + P  +Q Y+ NTSKL+ LG
Sbjct  252  VYETPEARGRYLCSSVVLDNNELVGLLTKQFPVFPIPRRLSNPYGKQAYQLNTSKLQGLG  311

Query  182  MKFKSLEE  205
            +KFK ++E
Sbjct  312  LKFKGVQE  319



>ref|XP_010932167.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Elaeis guineensis]
Length=424

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQ-YYEFNTSKLRSL  178
            VYE   A GRYLC+S ++D  +LA I++KRYP+LPI  RF     +  YYEFNTSKL+ L
Sbjct  338  VYEDAKAHGRYLCSSPVLDNHELAGIIAKRYPSLPIPKRFKNYYGKTPYYEFNTSKLQDL  397

Query  179  GMKFKSLEE  205
            G  F+ +EE
Sbjct  398  GFMFRGIEE  406



>gb|EMT20121.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Aegilops tauschii]
Length=364

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A+GRYLC+S ++D  +L  +L+K++P  PI  R + P  +Q Y+ NTSKL+ LG
Sbjct  277  VYETPEARGRYLCSSVVLDNNELVGLLTKQFPVFPIPRRLSNPYGKQAYQLNTSKLQGLG  336

Query  182  MKFKSLEE  205
            +KFK ++E
Sbjct  337  LKFKGVQE  344



>gb|ACN27587.1| unknown [Zea mays]
Length=255

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  168  VYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  227

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  228  FKFRGVQE  235



>ref|XP_008651868.1| PREDICTED: dihydroflavanoid reductase-like1 isoform X1 [Zea mays]
 tpg|DAA62088.1| TPA: dihydroflavonol-4-reductase [Zea mays]
Length=331

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  244  VYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  303

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  304  FKFRGVQE  311



>ref|XP_008651870.1| PREDICTED: dihydroflavanoid reductase-like1 isoform X2 [Zea mays]
Length=325

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  238  VYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  297

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  298  FKFRGVQE  305



>ref|XP_006661385.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Oryza brachyantha]
Length=358

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLCNS ++D  +L ++L+K++P  P+  R   P  +Q Y+ NTSK++ LG
Sbjct  271  VYETPQATGRYLCNSVVLDNNELVALLAKQFPVFPVPRRLRSPYGKQSYQLNTSKIQELG  330

Query  182  MKFKSLEE  205
            +KFK +EE
Sbjct  331  LKFKGVEE  338



>ref|XP_008356276.1| PREDICTED: LOW QUALITY PROTEIN: tetraketide alpha-pyrone reductase 
1-like [Malus domestica]
Length=357

 Score = 76.3 bits (186),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE E A GR +C+ST++D  +L S+LS RYP+LPI  RF +    +YYE NTSKL   G
Sbjct  273  VYEHESAHGRCICSSTVMDNTELGSLLSTRYPSLPIPTRFEQLGRPRYYELNTSKL-GRG  331

Query  182  MKFKSLEE  205
             KFKS++E
Sbjct  332  FKFKSIQE  339


 Score = 26.9 bits (58),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +1

Query  208  FDDTVTSLMEQGHL  249
            FDD + SL+EQGHL
Sbjct  341  FDDCIASLVEQGHL  354



>ref|NP_001105644.1| dihydroflavanoid reductase-like1 [Zea mays]
 gb|AAK52955.1|AF366295_1 dihydro-flavanoid reductase-like protein [Zea mays]
Length=331

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  244  VYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  303

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  304  FKFRGVQE  311



>gb|ACG40388.1| dihydroflavonol-4-reductase [Zea mays]
Length=332

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  245  VYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  304

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  305  FKFRGVQE  312



>gb|ACG33357.1| dihydroflavonol-4-reductase [Zea mays]
Length=364

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  277  VYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQSYQLNTSKLQGLG  336

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  337  FKFRGVQE  344



>gb|ACG40042.1| hypothetical protein [Zea mays]
Length=332

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLC+S ++D  +L S L+KRYP  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  245  VYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNTPYGKQSYQLNTSKLQGLG  304

Query  182  MKFKSLEE  205
             KF+ ++E
Sbjct  305  FKFRGVQE  312



>ref|XP_003578347.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Brachypodium 
distachyon]
Length=347

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRYLC+S ++D  +L  +L+K++P  PI  R   P  +Q Y+ NTSKL+ LG
Sbjct  260  VYETPEAMGRYLCSSVVLDNTELVGLLAKQFPVFPIPRRLNNPYGKQSYQLNTSKLQGLG  319

Query  182  MKFKSLEE  205
             KFK L E
Sbjct  320  FKFKGLRE  327



>gb|EMS53116.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=370

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA+GRY+CNS ++D  +L ++L+KR+P+ PI          Q Y +NTSK+R LG
Sbjct  283  VYETADAKGRYICNSAVLDSNELVALLAKRFPSFPIPKSLPNIYGEQTYGYNTSKIRKLG  342

Query  182  MKFKSLEE  205
            ++F+ +EE
Sbjct  343  LEFRGVEE  350



>gb|AAD24584.3|AF134807_1 putative dihydroflavonol reductase [Oryza sativa]
Length=330

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLCNS ++D  +L ++L+K++P  PI      P ++Q YE NTSK++ LG
Sbjct  243  VYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQSYELNTSKIQQLG  302

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  303  FKFKGVQE  310



>ref|XP_008799152.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Phoenix dactylifera]
Length=329

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            VYE   A GRYLC+ST++D  +LA IL+KRYP+LPI   F     +  YY F+TSK++ L
Sbjct  243  VYEDAKAHGRYLCSSTVLDNHELAGILAKRYPSLPIPKSFKNYYGETPYYVFDTSKIQDL  302

Query  179  GMKFKSLEE  205
            G  FK +EE
Sbjct  303  GFMFKGIEE  311



>gb|EEC84809.1| hypothetical protein OsI_31879 [Oryza sativa Indica Group]
Length=330

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLCNS ++D  +L ++L+K++P  PI      P ++Q YE NTSK++ LG
Sbjct  243  VYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQSYELNTSKIQQLG  302

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  303  FKFKGVQE  310



>dbj|BAC78578.1| dihydroflavonol reductase [Oryza sativa Japonica Group]
 gb|EEE69972.1| hypothetical protein OsJ_29865 [Oryza sativa Japonica Group]
Length=330

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLCNS ++D  +L ++L+K++P  PI      P ++Q YE NTSK++ LG
Sbjct  243  VYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQSYELNTSKIQQLG  302

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  303  FKFKGVQE  310



>ref|NP_001063545.1| Os09g0493500 [Oryza sativa Japonica Group]
 dbj|BAF25459.1| Os09g0493500 [Oryza sativa Japonica Group]
Length=366

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A GRYLCNS ++D  +L ++L+K++P  PI      P ++Q YE NTSK++ LG
Sbjct  279  VYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQSYELNTSKIQQLG  338

Query  182  MKFKSLEE  205
             KFK ++E
Sbjct  339  FKFKGVQE  346



>dbj|BAK08080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  DA+GRY+CNS ++   +L ++L+KR+P+ PI          Q Y +NTSK+R LG
Sbjct  242  VYETADAKGRYICNSAVLGSDELVALLAKRFPSFPIPKSLPNIYGEQTYGYNTSKIRKLG  301

Query  182  MKFKSLEE  205
            ++F+ +EE
Sbjct  302  LEFRGVEE  309



>gb|EPS73655.1| hypothetical protein M569_01100 [Genlisea aurea]
Length=359

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQY--YEFNTSKLRS  175
            VYE+++A+GRY+C+S +++  +LA+ILS RYP LPI  RF K    +   YEF+TSKL+ 
Sbjct  240  VYEKDNAEGRYICSSAVLENDELAAILSHRYPTLPIPRRFEKAAGHRASGYEFDTSKLKR  299

Query  176  LGM  184
            LGM
Sbjct  300  LGM  302



>gb|EMT24226.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Aegilops tauschii]
Length=363

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A+GRY+CNS ++   +L ++L+KR+P+ PI          Q Y +NTSK+R LG
Sbjct  276  VYETAGAKGRYICNSAVLGSAELVALLAKRFPSFPIPKSLPNIHGEQTYGYNTSKIRKLG  335

Query  182  MKFKSLEE  205
            ++F+ +EE
Sbjct  336  LEFRGVEE  343



>ref|XP_006849855.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda]
 gb|ERN11436.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda]
Length=320

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE   A+GRYLC+STI++  +L S L +RYPNL IS+    P  R YYE NT KL +LG
Sbjct  240  VYEDAKAKGRYLCSSTILENYELTSFLKERYPNLTISSFGKHP--RPYYELNTFKLENLG  297

Query  182  MKFKSLEE  205
              F+S+EE
Sbjct  298  FTFRSIEE  305



>gb|EEE68992.1| hypothetical protein OsJ_27928 [Oryza sativa Japonica Group]
Length=330

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE   A GRY+CNS ++D+ +L ++L++R+P+ PI          Q Y F+T+K+R LG
Sbjct  243  LYETPRAAGRYICNSAVLDVNELVTLLARRFPSYPIPKSLPCVYGEQTYGFSTAKVRELG  302

Query  182  MKFKSLEE  205
            MKF+ +EE
Sbjct  303  MKFRDVEE  310



>gb|EEC83876.1| hypothetical protein OsI_29874 [Oryza sativa Indica Group]
Length=294

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE   A GRY+CNS ++D+ +L ++L++R+P+ PI          Q Y F+T+K+R LG
Sbjct  207  LYETPRAAGRYICNSAVLDVNELITLLARRFPSYPIPKSLPCVYGEQTYGFSTAKVRELG  266

Query  182  MKFKSLEE  205
            MKF+ +EE
Sbjct  267  MKFRDVEE  274



>dbj|BAD09991.1| putative dihydroflavonol reductase [Oryza sativa Japonica Group]
Length=361

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE   A GRY+CNS ++D+ +L ++L++R+P+ PI          Q Y F+T+K+R LG
Sbjct  274  LYETPRAAGRYICNSAVLDVNELVTLLARRFPSYPIPKSLPCVYGEQTYGFSTAKVRELG  333

Query  182  MKFKSLEE  205
            MKF+ +EE
Sbjct  334  MKFRDVEE  341



>ref|XP_004973909.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Setaria 
italica]
Length=336

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   AQGRY+CN+ ++D  DLA++L++R+P+ PI          Q Y+++TSK R+LG
Sbjct  242  AYEAAGAQGRYICNAVVLDCGDLAALLARRFPSYPIPKSLPNIYGEQSYDYDTSKARALG  301

Query  182  MK-FKSLEE  205
            M+ +K +EE
Sbjct  302  MRGYKGVEE  310



>gb|ACF79507.1| unknown [Zea mays]
 tpg|DAA48037.1| TPA: hypothetical protein ZEAMMB73_510026 [Zea mays]
Length=236

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   A+GRY+C++ ++D  DLA++L++R+P  P+     +    Q Y F+TSK R+LG
Sbjct  144  AYEAAGARGRYICSAAVLDCGDLAALLARRFPAYPVPRSLPRAYGEQSYGFDTSKARALG  203

Query  182  M-KFKSLEE  205
            + +FK +EE
Sbjct  204  LAEFKGVEE  212



>gb|ACF86157.1| unknown [Zea mays]
Length=258

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   A+GRY+C++ ++D  DLA++L++R+P  P+     +    Q Y F+TSK R+LG
Sbjct  166  AYEAAGARGRYICSAAVLDCGDLAALLARRFPAYPVPRSLPRAYGEQSYGFDTSKARALG  225

Query  182  M-KFKSLEE  205
            + +FK +EE
Sbjct  226  LAEFKGVEE  234



>ref|XP_010548187.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X1 [Tarenaya 
hassleriana]
Length=360

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 30/98 (31%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPE----------------  133
            VYE + A GRY+C+STI+D+++L S LS RY +LPI  R    E                
Sbjct  241  VYEHKAAHGRYICSSTIVDLEELISFLSTRYASLPIPKRLALTERDLNPNSEHYPETICR  300

Query  134  --------------DRQYYEFNTSKLRSLGMKFKSLEE  205
                          +R +Y+F+TSK++SLG +FK LEE
Sbjct  301  HKSHLCYFFRFEKLNRLHYDFDTSKIKSLGFEFKPLEE  338



>ref|NP_001141357.1| uncharacterized protein LOC100273448 [Zea mays]
 gb|ACG34664.1| dihydroflavonol-4-reductase [Zea mays]
 tpg|DAA48040.1| TPA: dihydroflavonol-4-reductase [Zea mays]
Length=334

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   A+GRY+C++ ++D  DLA++L++R+P  P+     +    Q Y F+TSK R+LG
Sbjct  242  AYEAAGARGRYICSAAVLDCGDLAALLARRFPAYPVPRSLPRAYGEQSYGFDTSKARALG  301

Query  182  M-KFKSLEE  205
            + +FK +EE
Sbjct  302  LAEFKGVEE  310



>ref|XP_007199298.1| hypothetical protein PRUPE_ppa023144mg, partial [Prunus persica]
 gb|EMJ00497.1| hypothetical protein PRUPE_ppa023144mg, partial [Prunus persica]
Length=213

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +2

Query  35   LCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGMKFKSLEE  205
            LC+ST++D  +LAS+LSK+YP+LPI  RF +   R  Y+ NTSKL+SLG KFK+++E
Sbjct  139  LCSSTVLDNNELASLLSKQYPSLPIPKRFEQ-LGRPRYDLNTSKLKSLGFKFKTIQE  194



>ref|XP_006660279.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Oryza brachyantha]
Length=333

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG-  181
            YE   A GRY+CNS ++D+ +L ++L++R+P+ PI          Q Y+F+T+K+R LG 
Sbjct  244  YETARAAGRYICNSAVLDVNELLALLARRFPSYPIPKSLPCVYGEQTYDFSTAKVRELGM  303

Query  182  MKFKSLEE  205
            MKF+ +EE
Sbjct  304  MKFRDVEE  311



>ref|XP_002983967.1| hypothetical protein SELMODRAFT_119444 [Selaginella moellendorffii]
 gb|EFJ14979.1| hypothetical protein SELMODRAFT_119444 [Selaginella moellendorffii]
Length=338

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V E   A+GRY+C+ST++D   L  +L+ RYP   +  +F +    +YY  +TSKL  LG
Sbjct  249  VMEAPGARGRYICSSTVMDNDKLGELLAMRYPQFKVPTKFPESYKSKYYTLDTSKLEKLG  308

Query  182  MKFKSLEE  205
            +KF+S+E+
Sbjct  309  LKFRSVED  316



>ref|XP_002960169.1| hypothetical protein SELMODRAFT_74610 [Selaginella moellendorffii]
 gb|EFJ37708.1| hypothetical protein SELMODRAFT_74610 [Selaginella moellendorffii]
Length=338

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            V E   A+GRY+C+ST++D   L  +L+ RYP   +  +F +    +YY  +TSKL  LG
Sbjct  249  VMEAPGARGRYICSSTVMDNDKLGELLAMRYPQFNVPTKFPESYKSKYYTLDTSKLEKLG  308

Query  182  MKFKSLEE  205
            +KF+S+E+
Sbjct  309  LKFRSVED  316



>ref|XP_002444755.1| hypothetical protein SORBIDRAFT_07g027340 [Sorghum bicolor]
 gb|EES14250.1| hypothetical protein SORBIDRAFT_07g027340 [Sorghum bicolor]
Length=335

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE   A GRY+CN+ ++   DL ++L++R+P  PI          Q Y F+TSK R+LG+
Sbjct  243  YESAGAHGRYICNAAVLCCGDLVALLARRFPAYPIPRSLPSVYGEQTYGFDTSKARALGL  302

Query  185  -KFKSLEE  205
               K +EE
Sbjct  303  VDLKGVEE  310



>ref|XP_006659892.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Oryza brachyantha]
Length=429

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE+ +A GRYLC+ST   + D+ +I    YPN P   RF + ED     F++ KLR LG
Sbjct  348  AYEKPEASGRYLCSSTPRKLSDIINISKSLYPNFPYPKRFVEEEDT--ITFSSEKLRKLG  405

Query  182  MKFKSLEESL  211
              F+ +EE++
Sbjct  406  WTFRPIEETI  415



>ref|XP_004238461.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum lycopersicum]
Length=321

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            VYE+ +A+GRYLC +  +  +DL ++L K+YPN     RFT   ED     F++ KL+ L
Sbjct  240  VYERPEAEGRYLCMAHAVKSEDLVAMLKKQYPNYNYPKRFTDVTEDGG---FSSEKLQKL  296

Query  179  GMKFKSLEESLM  214
            G ++++LEE+L+
Sbjct  297  GWQYRALEETLV  308



>emb|CAA18727.1| putative protein [Arabidopsis thaliana]
 emb|CAB80259.1| putative protein [Arabidopsis thaliana]
Length=247

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF  121
            V+E E AQGRY+C+S +I +++L S LS RYP+LPI  RF
Sbjct  202  VFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRF  241



>ref|NP_001131614.1| hypothetical protein [Zea mays]
 gb|ACF80104.1| unknown [Zea mays]
 gb|AFW87411.1| hypothetical protein ZEAMMB73_580650 [Zea mays]
Length=320

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A GRY+C+S  I + D+ +IL   YP+ P    F + +D   Y  ++ KL+ LG 
Sbjct  240  YEKPEASGRYICSSHAIKVADMINILKTLYPSYPYPKNFVEDDDNSVY--SSEKLQKLGW  297

Query  185  KFKSLEESL  211
             FK +EESL
Sbjct  298  SFKPIEESL  306



>gb|EEC70426.1| hypothetical protein OsI_01433 [Oryza sativa Indica Group]
Length=327

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI+ R    +KP  +  Y+F+  +L+
Sbjct  234  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKP-YQFSVQRLK  292

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  293  ALGMRFTPLKESL  305



>ref|XP_007145529.1| hypothetical protein PHAVU_007G246200g [Phaseolus vulgaris]
 gb|ESW17523.1| hypothetical protein PHAVU_007G246200g [Phaseolus vulgaris]
Length=329

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            ++E+  A+GRY+CN+  + I  +A +++K+YP   +  RF K P++ +    ++ K+R L
Sbjct  241  LFEEPKAEGRYICNACDVTIHHIAKLINKKYPEYKVPTRFEKIPDELELVRLSSKKIREL  300

Query  179  GMKFK-SLEE  205
            G KFK SLE+
Sbjct  301  GFKFKYSLED  310



>gb|EMT05436.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Aegilops tauschii]
Length=336

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE  +A GRY+C++  + + ++ SI+   YPNL    ++ +  D++   F++ KLR LG
Sbjct  255  AYESPEAAGRYICSAHAMKVSEMVSIVRSMYPNLNYPKKYVQAGDQK--AFSSEKLRRLG  312

Query  182  MKFKSLEESL  211
             +F++LEE+L
Sbjct  313  WRFRTLEETL  322



>gb|ACU24315.1| unknown [Glycine max]
Length=321

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A+GRY+C+S  I  +D+   L   YPN     ++T+ +D  Y  F++ KL+ LG 
Sbjct  239  YEKLEAEGRYICHSHTIKTRDMLEKLKSIYPNYKYPAKYTEVDD--YISFSSEKLQRLGW  296

Query  185  KFKSLEESLM  214
            K++SLEE+L+
Sbjct  297  KYRSLEETLV  306



>ref|XP_003530329.1| PREDICTED: cinnamoyl-CoA reductase 1 [Glycine max]
 gb|KHN01290.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=321

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A+GRY+C+S  I  +D+   L   YPN     ++T+ +D  Y  F++ KL+ LG 
Sbjct  239  YEKLEAEGRYICHSHTIKTRDMLEKLKSIYPNYKYPAKYTEVDD--YISFSSEKLQRLGW  296

Query  185  KFKSLEESLM  214
            K++SLEE+L+
Sbjct  297  KYRSLEETLV  306



>gb|ADY39751.1| cinnamoyl-CoA reductase [Cenchrus purpureus]
 gb|AFA51048.1| cinnamoyl-CoA reductase [Cenchrus purpureus]
Length=369

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +  ++  +Q Y+F   KLR 
Sbjct  255  VFESAAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEKNPRKQPYKFTNQKLRD  314

Query  176  LGMKFKSLEESL  211
            LGM+F+ + +SL
Sbjct  315  LGMEFRPVSQSL  326



>gb|AIS23632.1| cinnamoyl-CoA reductase family protein [Camellia sinensis]
Length=319

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE+ +A+GRY+C + +I  QDL  IL K YPN     +FT  E ++  + ++ KL+ LG
Sbjct  238  AYEKPEAEGRYICTAYMIKSQDLVEILRKNYPNYNYPKKFT--EGKEEEKLSSEKLQKLG  295

Query  182  MKFKSLEESLM  214
              ++ +EE+L+
Sbjct  296  WSYRPIEETLV  306



>ref|XP_008794349.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Phoenix dactylifera]
Length=329

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC  T++  +DL  IL++ +P  P+  R +   +  +Q YEF+  +L+ 
Sbjct  241  VYEAPGAAGRYLCAETVLHREDLVRILAELFPEYPVPTRCSDEVNPRKQPYEFSNQRLKD  300

Query  176  LGMKFKSLEESL  211
            LG+ F  +  SL
Sbjct  301  LGLHFTPVTRSL  312



>gb|EMS52078.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=343

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
             YE   A GRY+C++    + ++ SI+   +PNL  +NRF +  ED +   F+T KL+ L
Sbjct  261  AYESPGAAGRYICSAHARKVSEMVSIVRSLHPNLNCANRFVQLVEDEKV--FSTEKLQRL  318

Query  179  GMKFKSLEESL  211
            G KF++LEE+L
Sbjct  319  GWKFRTLEETL  329



>gb|EAY73549.1| hypothetical protein OsI_01432 [Oryza sativa Indica Group]
Length=326

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI+ R    +KP  +  Y+F+  +L 
Sbjct  233  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKS-YQFSVQRLE  291

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  292  ALGMQFTPLKESL  304



>ref|XP_004973552.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=367

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +  E+  +Q Y F+  KLR 
Sbjct  250  VFESPAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEENPRKQPYRFSNQKLRD  309

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  310  LGLEFRPVSQSL  321



>gb|EAZ11468.1| hypothetical protein OsJ_01337 [Oryza sativa Japonica Group]
Length=326

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI+ R    +KP  +  Y+F+  +L 
Sbjct  233  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKP-YQFSVQRLE  291

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  292  ALGMQFTPLKESL  304



>dbj|BAB39960.1| putative cinnamoyl-CoA reductase [Oryza sativa Japonica Group]
Length=326

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI+ R    +KP  +  Y+F+  +L 
Sbjct  233  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKP-YQFSVQRLE  291

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  292  ALGMQFTPLKESL  304



>ref|XP_001772000.1| predicted protein [Physcomitrella patens]
 gb|EDQ63261.1| predicted protein [Physcomitrella patens]
Length=356

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQ-YYEFNTSKLRSL  178
            VYE   AQGRY+C++     Q+L   L+ RYP+L IS +F     +  YY+ NT+KL+ L
Sbjct  247  VYETPSAQGRYICSAQEATPQELVQYLADRYPHLQISTKFNDELPKMPYYKLNTTKLQRL  306

Query  179  GMKFKSLE  202
            G+  K L+
Sbjct  307  GLNCKPLD  314



>ref|XP_010527306.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=320

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+  A+GRY+C+S  +  QD+   L  RYPN     R+ + EDR     ++ KL  LG
Sbjct  239  VYEKPGAEGRYMCSSHAVKEQDIVEKLKSRYPNYNYPKRYIEAEDR--VRVSSEKLLKLG  296

Query  182  MKFKSLEESLM  214
              ++SL+E+L+
Sbjct  297  WNYRSLDETLV  307



>ref|NP_001151213.1| dihydroflavonol-4-reductase [Zea mays]
 gb|ACG41993.1| dihydroflavonol-4-reductase [Zea mays]
 gb|AFW87410.1| dihydroflavonol-4-reductase [Zea mays]
Length=319

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A GRY+C+S  I I D+ +IL   YP+ P    F   ED     +++ KL+ LG 
Sbjct  239  YEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFV--EDDVNSVYSSEKLQKLGW  296

Query  185  KFKSLEESL  211
             FK +EESL
Sbjct  297  SFKPIEESL  305



>ref|NP_001042767.1| Os01g0283600 [Oryza sativa Japonica Group]
 dbj|BAF04681.1| Os01g0283600 [Oryza sativa Japonica Group]
Length=337

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI+ R    +KP  +  Y+F+  +L 
Sbjct  233  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKP-YQFSVQRLE  291

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  292  ALGMQFTPLKESL  304



>gb|AFW87409.1| hypothetical protein ZEAMMB73_924621 [Zea mays]
Length=320

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A GRY+C+S  I I D+ +IL   YP+ P    F   ED     +++ KL+ LG 
Sbjct  240  YEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFV--EDDVNSVYSSEKLQKLGW  297

Query  185  KFKSLEESL  211
             FK +EESL
Sbjct  298  SFKPIEESL  306



>ref|XP_010645686.1| PREDICTED: cinnamoyl-CoA reductase 2 isoform X1 [Vitis vinifera]
Length=325

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYP--NLPISNRFTKPEDRQYYEFNTSKLRS  175
            +Y++ +A+GRY+C+S  I +Q L   L   YP  N P S+ +T+ E  + ++ ++ KL S
Sbjct  240  IYDKPEAEGRYICSSYTILVQKLIEKLKNIYPNYNYPKSDSYTEVE--EAFKLSSKKLES  297

Query  176  LGMKFKSLEESLM  214
            LG K++SLEE+LM
Sbjct  298  LGWKYRSLEETLM  310



>gb|EEC70428.1| hypothetical protein OsI_01435 [Oryza sativa Indica Group]
Length=328

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI++R    +KP  +  Y+F+  +L 
Sbjct  234  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITSRCKDNSKPMVKP-YKFSVQRLE  292

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  293  TLGMQFTPLKESL  305



>ref|NP_001042768.1| Os01g0283700 [Oryza sativa Japonica Group]
 dbj|BAB39961.1| putative cinnamoyl-CoA reductase [Oryza sativa Japonica Group]
 dbj|BAB39976.1| putative cinnamoyl-CoA reductase [Oryza sativa Japonica Group]
 dbj|BAB64221.1| putative cinnamoyl-CoA reductase [Oryza sativa Japonica Group]
 dbj|BAF04682.1| Os01g0283700 [Oryza sativa Japonica Group]
Length=328

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI++R    +KP  +  Y+F+  +L 
Sbjct  234  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITSRCKDNSKPMVKP-YKFSVQRLE  292

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  293  TLGMQFTPLKESL  305



>gb|EEE54350.1| hypothetical protein OsJ_01338 [Oryza sativa Japonica Group]
Length=300

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC  +++   +   +L + +P  PI++R    +KP  +  Y+F+  +L 
Sbjct  206  VYEHPDARGRYLCIGSVLHRSEFVRLLRELFPQYPITSRCKDNSKPMVKP-YKFSVQRLE  264

Query  173  SLGMKFKSLEESL  211
            +LGM+F  L+ESL
Sbjct  265  TLGMQFTPLKESL  277



>gb|AGS10090.1| cinnamoyl CoA reductase [Paspalum dilatatum]
Length=366

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  249  VFESPRAAGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQPYKFSNQKLRD  308

Query  176  LGMKFKSLEESL  211
            LG++F+S+ +SL
Sbjct  309  LGLEFRSVSQSL  320



>ref|NP_001266837.1| uncharacterized protein LOC101027223 [Zea mays]
 ref|XP_008658695.1| PREDICTED: dihydroflavonol-4-reductase isoform X1 [Zea mays]
 gb|ACN36170.1| unknown [Zea mays]
 gb|AFW87408.1| hypothetical protein ZEAMMB73_924621 [Zea mays]
Length=346

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A GRY+C+S  I I D+ +IL   YP+ P    F   ED     +++ KL+ LG 
Sbjct  266  YEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFV--EDDVNSVYSSEKLQKLGW  323

Query  185  KFKSLEESL  211
             FK +EESL
Sbjct  324  SFKPIEESL  332



>gb|EMS49127.1| Dihydroflavonol-4-reductase [Triticum urartu]
Length=152

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE  +A GRY+C++    + +  SI+   YPNL    ++ +  D++   F++ KLR LG 
Sbjct  72   YESPEAAGRYICSAHARKVSETVSIVRSMYPNLNYPKKYVQVGDQKV--FSSEKLRRLGW  129

Query  185  KFKSLEESL  211
            KF++LEE L
Sbjct  130  KFRTLEEML  138



>ref|XP_002445566.1| hypothetical protein SORBIDRAFT_07g021680 [Sorghum bicolor]
 gb|EES15061.1| hypothetical protein SORBIDRAFT_07g021680 [Sorghum bicolor]
Length=374

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  260  VFESPAASGRYLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQPYKFSNQKLRD  319

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  320  LGLEFRPVSQSL  331



>emb|CAA13176.1| cinnamoyl-CoA reductase [Saccharum officinarum]
Length=372

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  257  VFESPRASGRYLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQPYKFSNQKLRD  316

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  317  LGLEFRPVSQSL  328



>gb|AJD79908.1| CCR [Punica granatum]
Length=338

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  P+    +   KP  +  Y+F+T KLR
Sbjct  240  VFETPSASGRYLCAESVLHRGDVVEILAKFFPEYPVPTECSDKVKPRAKP-YKFSTQKLR  298

Query  173  SLGMKFKSLEESL  211
             LGM+F S+++ L
Sbjct  299  DLGMEFISVKQCL  311



>ref|XP_008775468.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Phoenix dactylifera]
Length=323

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A GRY+C S +I +QDL  +L   YPN      F + ++    + ++ KL+ LG
Sbjct  240  VYEKPEASGRYICASHLIKLQDLVDMLKSMYPNYNYPKSFVEVDEGS--QLSSEKLKMLG  297

Query  182  MKFKSLEESLM  214
             K + LEESL+
Sbjct  298  WKCRRLEESLI  308



>ref|XP_009606417.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana tomentosiformis]
Length=321

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A+GRY+C +  +  QDL  +L + YPN     RFT   +   Y  ++ KL+ LG
Sbjct  240  VYERPEAEGRYICTAHKVKSQDLVDMLKRHYPNYNYPKRFTDLMEEGSY--SSEKLQKLG  297

Query  182  MKFKSLEESLM  214
             +++ LEE+L+
Sbjct  298  WQYRQLEETLI  308



>gb|ACZ74584.1| cinnamoyl CoA reductase 1e [Panicum virgatum]
Length=363

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  254  VFEAPAASGRHLCADRVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQAYKFSNQKLRD  313

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  314  LGLEFRPVSQSL  325



>ref|XP_009354188.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=339

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI N+     KP  +  Y+F   KLR
Sbjct  240  VYETPTASGRYLCAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPRAKP-YKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++ +L
Sbjct  299  DLGLEFTPVKHTL  311



>emb|CAN83703.1| hypothetical protein VITISV_003030 [Vitis vinifera]
Length=272

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A GRY+C+S  I  Q+L   L   YPN      +   E  ++ + ++ KL+SLG
Sbjct  189  VYEKPEAHGRYICSSYTISTQELVEKLKSMYPNYSYPKSYI--EGEEHLKLSSQKLQSLG  246

Query  182  MKFKSLEESLM  214
             K++ LEE+L+
Sbjct  247  WKYRPLEETLV  257



>ref|XP_002280010.2| PREDICTED: cinnamoyl-CoA reductase 2 [Vitis vinifera]
 emb|CBI31772.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A GRY+C+S  I  Q+L   L   YPN      +   E  ++ + ++ KL+SLG
Sbjct  237  VYEKPEAHGRYICSSYTISTQELVEKLKSMYPNYSYPKSYI--EGEEHLKLSSQKLQSLG  294

Query  182  MKFKSLEESLM  214
             K++ LEE+L+
Sbjct  295  WKYRPLEETLV  305



>ref|XP_002267718.2| PREDICTED: cinnamoyl-CoA reductase 2 isoform X2 [Vitis vinifera]
 emb|CBI17735.3| unnamed protein product [Vitis vinifera]
Length=323

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +Y++ +A+GRY+C+S  I +Q L   L   YPN      +T+ E  + ++ ++ KL SLG
Sbjct  240  IYDKPEAEGRYICSSYTILVQKLIEKLKNIYPNYNYPKSYTEVE--EAFKLSSKKLESLG  297

Query  182  MKFKSLEESLM  214
             K++SLEE+LM
Sbjct  298  WKYRSLEETLM  308



>gb|KDO48510.1| hypothetical protein CISIN_1g020753mg [Citrus sinensis]
Length=322

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE+ +A+GRY+C S  I +Q LA  +   YPN   S  FTK ++      ++ KL++LG
Sbjct  239  IYEKPEAKGRYICTSFTIRMQALAEKIKSMYPNYDYSKSFTKVDEE--LRLSSGKLQNLG  296

Query  182  MKFKSLEESL  211
             K++ LEES+
Sbjct  297  WKYRPLEESI  306



>ref|XP_008664204.1| PREDICTED: cinnamoyl-CoA reductase 1-like, partial [Zea mays]
Length=226

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A GRY+C+S  I I D+ +IL   YP+ P    F   ED     +++ KL+ LG 
Sbjct  146  YEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFV--EDDVNSVYSSEKLQKLGW  203

Query  185  KFKSLEESL  211
             F  +EESL
Sbjct  204  PFNPIEESL  212



>tpg|DAA48904.1| TPA: hypothetical protein ZEAMMB73_257653 [Zea mays]
Length=220

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  106  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  165

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  166  LGLQFRPVSQSL  177



>gb|ACZ74581.1| cinnamoyl CoA reductase 1b [Panicum virgatum]
Length=364

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F   KLR 
Sbjct  254  VFESPAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQAYKFTNQKLRD  313

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  314  LGLEFRPVSQSL  325



>gb|ACZ74580.1| cinnamoyl CoA reductase 1a [Panicum virgatum]
Length=364

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F   KLR 
Sbjct  254  VFESPAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQAYKFTNQKLRD  313

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  314  LGLEFRPVSQSL  325



>ref|XP_002889086.1| cinnamoyl-CoA reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65345.1| cinnamoyl-CoA reductase [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A+GRY+CNS  + I  L   L   YP       FT+ ++++    +  KL++LG
Sbjct  240  VYENREAKGRYICNSHSLHIDTLMEKLKNMYPKRNFPESFTEVKEKEVRPLSAEKLKNLG  299

Query  182  MKFKSLEESL  211
             KF+ LEE++
Sbjct  300  WKFRPLEETI  309



>ref|XP_008361199.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=339

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI N+     KP   + Y+F   KLR
Sbjct  240  VYETPSAGGRYLCAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPR-AEPYKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++++L
Sbjct  299  DLGLEFTPVKQAL  311



>ref|XP_008375542.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=339

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI N+     KP   + Y+F   KLR
Sbjct  240  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPR-AEPYKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++ +L
Sbjct  299  DLGLEFTPVKHTL  311



>gb|ADK62523.1| cinnamoyl-CoA reductase [Pyrus pyrifolia]
Length=339

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI N+     KP   + Y+F   KLR
Sbjct  240  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPR-AEPYKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++ +L
Sbjct  299  DLGLEFTPVKHTL  311



>ref|XP_002438696.1| hypothetical protein SORBIDRAFT_10g024510 [Sorghum bicolor]
 gb|EER90063.1| hypothetical protein SORBIDRAFT_10g024510 [Sorghum bicolor]
Length=320

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE+ +A GRY+C+S  I + D+ +IL   YP  P    F + +D   Y  ++ KL+ LG
Sbjct  239  AYEKPEASGRYICSSQPIKVSDMINILKTLYPTYPYPKNFVEMDDNSIY--SSEKLQKLG  296

Query  182  MKFKSLEESL  211
              F+ +EE+L
Sbjct  297  WTFRPIEETL  306



>tpg|DAA48900.1| TPA: hypothetical protein ZEAMMB73_257653, partial [Zea mays]
Length=229

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  115  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  174

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  175  LGLQFRPVSQSL  186



>tpg|DAA48903.1| TPA: hypothetical protein ZEAMMB73_257653 [Zea mays]
Length=255

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  141  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  200

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  201  LGLQFRPVSQSL  212



>gb|ACI14382.1| cinnamoyl-CoA reductase [Vaccinium corymbosum]
Length=347

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCKDETKPRAKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F   ++SL
Sbjct  293  DLGLEFTPTKQSL  305



>gb|AAN71760.1| cinnamoyl CoA reductase [Hordeum vulgare]
 dbj|BAK07589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC   ++  QD+  IL+K +P  P+  R +   +  +Q Y+ +  KL+ 
Sbjct  247  VFEAPQASGRYLCAERVLHRQDVVHILAKLFPEYPVPTRCSDEVNPRKQPYKMSNQKLQD  306

Query  176  LGMKFKSLEESL  211
            LG+KF  + +SL
Sbjct  307  LGLKFTPVNDSL  318



>emb|CDX88284.1| BnaC06g37280D [Brassica napus]
Length=323

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYE----FNTSKL  169
            VYE ++A+GRY+CNS  +   DL   L   YPN      F++ +++Q  E     ++ KL
Sbjct  235  VYENQEAKGRYICNSHSLHNNDLMEKLMNMYPNRNFPKSFSERKEKQVNENILRISSEKL  294

Query  170  RSLGMKFKSLEESL  211
              LG KF+SLEE++
Sbjct  295  EKLGWKFRSLEETI  308



>ref|XP_008228815.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Prunus mume]
Length=188

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+  T KL+
Sbjct  82   VYETPSASGRYLCGESVLHRGDVVEILAKSFPEYPIPTKCSDEVKPRVKP-YKLTTHKLQ  140

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  141  DLGVEFTPVKQCL  153



>ref|XP_006433232.1| hypothetical protein CICLE_v10001855mg [Citrus clementina]
 ref|XP_006471933.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471934.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR46472.1| hypothetical protein CICLE_v10001855mg [Citrus clementina]
Length=322

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            +YE+ +A+GRY+C S  I +Q LA  +   YPN   S  FTK ++      ++ KL++LG
Sbjct  239  LYEKPEAKGRYICTSFTIRMQALAEKIKSMYPNYDYSKSFTKVDEE--LRLSSGKLQNLG  296

Query  182  MKFKSLEESL  211
             K++ LEES+
Sbjct  297  WKYRPLEESI  306



>gb|AGS10091.1| cinnamoyl CoA reductase [Paspalum dilatatum]
Length=365

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  249  VFESPRAAGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQPYKFSNQKLRD  308

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  309  LGLEFRPVSQSL  320



>gb|KDP41979.1| hypothetical protein JCGZ_26997 [Jatropha curcas]
Length=338

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC  +++   D+  IL+K +P  PI  R +  ++   + Y+F+  KL+ 
Sbjct  240  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTRCSDEKNPRAKPYKFSNQKLKD  299

Query  176  LGMKFKSLEESL  211
            LGM+F  +++ L
Sbjct  300  LGMEFTPVKQCL  311



>gb|AFD29890.1| cinnamoyl-CoA reductase, partial [Bambusa emeiensis]
Length=293

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT--KPEDRQYYEFNTSKLRS  175
            V+E   A GRYLC   ++  +D+  IL+K +P  P+  R +  K   +Q Y+ +  KLR 
Sbjct  183  VFEAPAASGRYLCAERVLHREDVVRILAKLFPEYPVPTRCSDEKNPRKQPYKMSNQKLRD  242

Query  176  LGMKFKSLEESL  211
            +G++F+ + +SL
Sbjct  243  IGLEFRPVNQSL  254



>ref|XP_006342181.1| PREDICTED: cinnamoyl-CoA reductase 2 [Solanum tuberosum]
Length=321

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A+GRYLC +  +  +DL ++L K YPN      FT  +  +   F++ KL+ LG
Sbjct  240  VYERPEAEGRYLCAAHTVKSEDLVAMLKKHYPNYYYPKCFT--DMMEDTSFSSEKLQKLG  297

Query  182  MKFKSLEESLM  214
             +++ LEE+L+
Sbjct  298  WQYRPLEETLV  308



>ref|NP_001234612.1| cinnamoyl-CoA reductase [Solanum lycopersicum]
 gb|AAY41879.1| cinnamoyl-CoA reductase [Solanum lycopersicum]
Length=332

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE   A GRYLC  +++   D+  IL+K +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  LYETPSASGRYLCAESVLHRGDIVEILAKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LGM+F  +++ L
Sbjct  293  DLGMEFTPVKQCL  305



>ref|XP_009354190.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=341

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRY+C  +++   D+  IL+K +P  PI N+     KP   + Y+F   KLR
Sbjct  240  VYETPSASGRYICAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPR-AESYKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++ +L
Sbjct  299  DLGLEFTPVKHTL  311



>gb|ABQ95549.1| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
Length=238

 Score = 53.1 bits (126),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  P   + +   KP  +  YEF+  KLR
Sbjct  140  VFETPSASGRYLCAESVLHRGDVVEILAKFFPEYPFPTKCSDEVKPRAKP-YEFSNQKLR  198

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  199  DLGLEFTPVKQCL  211


 Score = 23.5 bits (49),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAPP  267
            +TV SL E+GHL P+ PP
Sbjct  213  ETVKSLQEKGHL-PVPPP  229



>ref|NP_001148831.1| LOC100282448 [Zea mays]
 gb|ACG33054.1| dihydroflavonol-4-reductase [Zea mays]
Length=322

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   A GRYLC+S  I + D+ +IL   YP      +F + E    Y  NT KLR LG
Sbjct  241  AYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTY--NTEKLRKLG  298

Query  182  MKFKSLEESL  211
               + +EE+L
Sbjct  299  WTSRPMEETL  308



>gb|ACG33996.1| dihydroflavonol-4-reductase [Zea mays]
Length=367

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  253  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  312

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  313  LGLQFRPVSQSL  324



>ref|NP_001048476.1| Os02g0811800 [Oryza sativa Japonica Group]
 dbj|BAD22038.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
 dbj|BAD22378.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
 dbj|BAF10390.1| Os02g0811800 [Oryza sativa Japonica Group]
 gb|EAZ25041.1| hypothetical protein OsJ_08830 [Oryza sativa Japonica Group]
 dbj|BAG88919.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86880.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
Length=339

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 12/77 (16%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPIS-------NRFTKPEDRQYYEFNT  160
            VYE   A+GRYLC  T+I   +L  +L + +P  P++       N+  KP     Y+F+ 
Sbjct  243  VYEHHGARGRYLCIGTVIHRAELLRMLKELFPQYPVTSKCEDEGNQMVKP-----YKFSN  297

Query  161  SKLRSLGMKFKSLEESL  211
             +LR LG++F  L +SL
Sbjct  298  QRLRDLGLEFTPLRKSL  314



>gb|AHX56186.1| cinnamoyl-CoA reductase 1 [Petunia x hybrida]
Length=333

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE  +A GRYLC  +++   D+  ILSK +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  LYETPEASGRYLCAESVLHRGDVVEILSKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  293  DLGLEFTPVKQCL  305



>ref|NP_001105488.1| cinnamoyl CoA reductase1 [Zea mays]
 emb|CAA74071.1| cinnamoyl CoA reductase [Zea mays]
Length=371

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  257  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  316

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  317  LGLQFRPVSQSL  328



>emb|CAA66707.1| cinnamoyl-CoA reductase [Zea mays]
 gb|ACN31052.1| unknown [Zea mays]
Length=371

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  257  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  316

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  317  LGLQFRPVSQSL  328



>pdb|4R1S|A Chain A, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase
 pdb|4R1S|B Chain B, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase
 pdb|4R1T|A Chain A, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase
Length=337

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE  +A GRYLC  +++   D+  ILSK +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  238  LYETPEASGRYLCAESVLHRGDVVEILSKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  296

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  297  DLGLEFTPVKQCL  309



>ref|XP_006410504.1| hypothetical protein EUTSA_v10017002mg [Eutrema salsugineum]
 gb|ESQ51957.1| hypothetical protein EUTSA_v10017002mg [Eutrema salsugineum]
Length=300

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A+GRY+C +  +  QD+   L   YPN     R+ + E+R   + ++ KL+ LG
Sbjct  219  VYEEAEAEGRYICVAHTVKEQDIVEKLKSLYPNYNYPKRYVEVEERA--KMSSEKLQKLG  276

Query  182  MKFKSLEESLM  214
              F+ LEE+L+
Sbjct  277  WTFRPLEETLV  287



>gb|ACF85456.1| unknown [Zea mays]
 tpg|DAA48901.1| TPA: cinnamoyl CoA reductase [Zea mays]
Length=371

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  257  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  316

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  317  LGLQFRPVSQSL  328



>ref|XP_006383800.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
 gb|ERP61597.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
Length=187

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE  +A+GRY+C +  I ++DL   L   YPN      FT+ E+++    ++ KL+ LG 
Sbjct  106  YETPEAEGRYICTAHAIRVKDLVEKLRSMYPNYNYPKSFTE-EEQEAVMISSEKLQRLGW  164

Query  185  KFKSLEESLM  214
             F+SL+E+L+
Sbjct  165  SFRSLDETLI  174



>gb|AHM10331.1| cinnamoyl-CoA reductase [Pyrus pyrifolia]
Length=339

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE     GRYLC  +++   D+  IL+K +P  PI N+     KP+  + Y+F   KLR
Sbjct  240  VYETPSVSGRYLCAESVLHRGDVVEILAKFFPEYPIPNKCKDNGKPK-AEPYKFTNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  ++++L
Sbjct  299  DLGLEFTPVKQAL  311



>ref|XP_008648792.1| PREDICTED: cinnamoyl CoA reductase1 isoform X1 [Zea mays]
Length=372

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F+  KLR 
Sbjct  258  VFESPRASGRHLCAERVLHREDVVRILAKLFPEYPVPARCSDEVNPRKQPYKFSNQKLRD  317

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  318  LGLQFRPVSQSL  329



>ref|XP_006648088.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Oryza brachyantha]
Length=335

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 12/77 (16%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPIS-------NRFTKPEDRQYYEFNT  160
            VYE+ DA+GRYLC  T++   DL  +L   +P  P +       N   KP     Y+F+ 
Sbjct  240  VYERPDARGRYLCIGTVVHRADLLRMLKDLFPCYPATSKCEDERNPMVKP-----YKFSN  294

Query  161  SKLRSLGMKFKSLEESL  211
             +LR LG++F  L +SL
Sbjct  295  QRLRDLGLEFTPLRQSL  311



>gb|ACZ74583.1| cinnamoyl CoA reductase 1d [Panicum virgatum]
Length=364

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V++   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F   KLR 
Sbjct  254  VFQSPAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQAYKFTNQKLRD  313

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  314  LGLEFRPVSQSL  325



>gb|ACZ74582.1| cinnamoyl CoA reductase 1c [Panicum virgatum]
Length=364

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V++   A GR+LC   ++  +D+  IL+K +P  P+  R +   +  +Q Y+F   KLR 
Sbjct  254  VFQSPAASGRHLCAERVLHREDVVRILAKLFPEYPVPTRCSDEVNPRKQAYKFTNQKLRD  313

Query  176  LGMKFKSLEESL  211
            LG++F+ + +SL
Sbjct  314  LGLEFRPVSQSL  325



>ref|XP_002280095.1| PREDICTED: cinnamoyl-CoA reductase 2 [Vitis vinifera]
 emb|CBI31779.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +AQGRY+C+S  I  Q+L   L   YPN      +T  E  +    ++ KL+ LG
Sbjct  240  VYEKPEAQGRYICSSYTISTQELVEKLKSMYPNYNYPKSYTAVEGLK---LSSEKLQGLG  296

Query  182  MKFKSLEESLM  214
             K++ LEE+L+
Sbjct  297  WKYRPLEETLV  307



>gb|AGA82783.1| dihydroflavonol reductase 2, partial [Clarkia gracilis]
Length=306

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDR-QYYEFNTSKLRSL  178
            +YE   A+GRY+C+S  I I  LA +L ++YPN  I   F   +D+ +   F++ KLR L
Sbjct  240  LYENPKAKGRYICSSHDITILGLAKMLQQKYPNYNIQTEFEGVDDKLESVAFSSKKLREL  299

Query  179  GMKFK  193
            G +FK
Sbjct  300  GFEFK  304



>ref|XP_010942096.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=329

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC  +++  +D+  IL+K +P  P+  + +   +  ++ Y+F+  +LR 
Sbjct  241  VYEAPGAAGRYLCAESVLHREDVVRILAKLFPGYPVPTKCSDEVNPRKKPYKFSNQRLRD  300

Query  176  LGMKFKSLEESL  211
            LG++F  + +S+
Sbjct  301  LGLQFTPVTQSI  312



>ref|XP_010929159.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=330

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC   ++  +DL  IL+  +P  P+  R +   +  +Q Y F+  +L+ 
Sbjct  242  VYEAPGAAGRYLCAEAVLHREDLVRILADLFPGYPVPTRCSDEVNPRKQPYRFSNQRLKD  301

Query  176  LGMKFKSLEESL  211
            LG++F  + +SL
Sbjct  302  LGLQFIPVTQSL  313



>ref|XP_011034796.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Populus 
euphratica]
Length=321

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYP--NLPISNRFTKPEDRQYYEFNTSKLRS  175
            +YE+++A+GRY+C+S  I  QDLA  L   YP  N P S     P      + ++ KL +
Sbjct  238  IYEKDEAEGRYICSSHDITTQDLAEKLKAMYPHYNYPKSFAGGMPS----MDMSSEKLLN  293

Query  176  LGMKFKSLEESLM  214
            LG K++SLEESL+
Sbjct  294  LGWKYRSLEESLV  306



>ref|XP_004965850.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=320

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE+ +A GRY+CNS  I + D+ +IL   YP       F + E+   Y F   KL+ LG
Sbjct  239  AYEKPEASGRYICNSPPIKVSDMINILKNLYPTYRYPKNFEEVEESSVYSFE--KLQKLG  296

Query  182  MKFKSLEESL  211
              F+ +EE+L
Sbjct  297  WTFRPVEETL  306



>ref|XP_002300620.2| hypothetical protein POPTR_0002s00600g [Populus trichocarpa]
 gb|EEE79893.2| hypothetical protein POPTR_0002s00600g [Populus trichocarpa]
Length=321

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYP--NLPISNRFTKPEDRQYYEFNTSKLRS  175
            +YE+++A+GRY+C+S  I  QDLA  L   YP  N P S     P      + ++ KL +
Sbjct  238  IYEKDEAEGRYICSSHDITTQDLAEKLKAMYPHYNYPKSFSGGMPS----MDMSSEKLLN  293

Query  176  LGMKFKSLEESLM  214
            LG K++SLEESL+
Sbjct  294  LGWKYRSLEESLV  306



>emb|CDP19334.1| unnamed protein product [Coffea canephora]
Length=237

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQ-YYEFNTSKLRSL  178
            VY + +A+GRY+C+S +   +D   IL K YPN     RF + +D Q     ++ KL+ L
Sbjct  153  VYGRPEAEGRYICSSHLTTTKDTVEILRKNYPNYKYPKRFIEVKDDQGRGNVSSGKLQRL  212

Query  179  GMKFKSLEESLM  214
            G +++ +EE+L+
Sbjct  213  GWRYRPVEETLV  224



>gb|AAP46143.1| cinnamoyl CoA reductase [Fragaria x ananassa]
Length=339

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI ++     KP     Y+F+  KL+
Sbjct  241  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPSKLKDDGKPRAIP-YKFSNQKLQ  299

Query  173  SLGMKFKSLEESL  211
             LG++F S+++SL
Sbjct  300  DLGLEFTSVKQSL  312



>ref|XP_011034795.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
Length=327

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYP--NLPISNRFTKPEDRQYYEFNTSKLRS  175
            +YE+++A+GRY+C+S  I  QDLA  L   YP  N P S     P      + ++ KL +
Sbjct  244  IYEKDEAEGRYICSSHDITTQDLAEKLKAMYPHYNYPKSFAGGMPS----MDMSSEKLLN  299

Query  176  LGMKFKSLEESLM  214
            LG K++SLEESL+
Sbjct  300  LGWKYRSLEESLV  312



>ref|XP_006383798.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
 gb|ERP61595.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
Length=240

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE  +A+GRY+C +  I ++DL   L   YPN      FT+ E+++    ++ KL+ LG 
Sbjct  159  YETPEAEGRYICTAHAIRVKDLVEKLRSMYPNYNYPKSFTE-EEQEAVMISSEKLQRLGW  217

Query  185  KFKSLEESLM  214
             F+SL+E+L+
Sbjct  218  SFRSLDETLI  227



>ref|XP_006433229.1| hypothetical protein CICLE_v10001868mg [Citrus clementina]
 ref|XP_006480211.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Citrus sinensis]
 gb|ESR46469.1| hypothetical protein CICLE_v10001868mg [Citrus clementina]
 gb|KDO48504.1| hypothetical protein CISIN_1g020924mg [Citrus sinensis]
Length=319

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE+ +A+GRY+C + +I  +DL   L   YPN      FT+ ED       + KL+ LG 
Sbjct  239  YEKAEAEGRYICTAHMIRARDLVDKLKSLYPNYNYPKSFTEKEDEVM--LTSEKLQKLGW  296

Query  185  KFKSLEESLM  214
             ++SLEE+L+
Sbjct  297  SYRSLEETLV  306



>ref|XP_009782740.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana sylvestris]
Length=319

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A+GR++C +     QDL  +L + YPN     RFT   +   Y  +T KL+ LG
Sbjct  238  VYEKPEAEGRHICMAHKAKSQDLVDMLKRHYPNYKYPKRFTNVMEEGGY--STEKLQKLG  295

Query  182  MKFKSLEESLM  214
             K + LEE+L+
Sbjct  296  WKCRPLEETLI  306



>gb|EAY87969.1| hypothetical protein OsI_09393 [Oryza sativa Indica Group]
Length=343

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 12/77 (16%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPIS-------NRFTKPEDRQYYEFNT  160
            VYE   A+GRYLC  T+I   +L  +L + +P  P++       N+  KP     Y+F+ 
Sbjct  247  VYENHGARGRYLCIGTVIHRAELLRMLKELFPQYPVTSKCEDEGNQMVKP-----YKFSN  301

Query  161  SKLRSLGMKFKSLEESL  211
             +LR LG++F  L +SL
Sbjct  302  QRLRDLGLEFTPLRKSL  318



>gb|AFW87421.1| hypothetical protein ZEAMMB73_660708 [Zea mays]
Length=149

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRY+CNS    + D+  +L   YP    + +F +        F+++KL++LG
Sbjct  68   VYETPEASGRYICNSHARLVSDVIRLLRSWYPTYQCATKFVQVSHEP--AFSSNKLQALG  125

Query  182  MKFKSLEESL  211
             KF+  EE+L
Sbjct  126  WKFRPFEETL  135



>ref|XP_004303244.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=339

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI ++     KP     Y+F+  KL+
Sbjct  241  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPSKLKDDGKPRAIP-YKFSNQKLQ  299

Query  173  SLGMKFKSLEESL  211
             LG++F S+++SL
Sbjct  300  DLGLEFTSVKQSL  312



>gb|AFQ36033.1| cinnamoyl CoA reductase [Fragaria x ananassa]
Length=339

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI ++     KP     Y+F+  KL+
Sbjct  241  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPSKLKDDGKPRAIP-YKFSNQKLQ  299

Query  173  SLGMKFKSLEESL  211
             LG++F S+++SL
Sbjct  300  DLGLEFTSVKQSL  312



>ref|XP_010265623.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nelumbo nucifera]
Length=337

 Score = 51.6 bits (122),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +I+   ++  IL+K +P  PI  +    T+P  +  Y+F   K+R
Sbjct  238  VYETPSASGRYLCAESILHRGEVVDILAKFFPEYPIPTKCSDETRPRAKP-YKFTNQKMR  296

Query  173  SLGMKFKSLEESL  211
             LG++F  + + L
Sbjct  297  DLGLEFTPVMQCL  309


 Score = 23.9 bits (50),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 1/17 (6%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAP  264
            DTV SL E+GHL PL P
Sbjct  311  DTVKSLQEKGHL-PLPP  326



>gb|AES86489.2| cinnamoyl-CoA reductase [Medicago truncatula]
Length=326

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE   A GRY+C S  I+ +DL   L   YPN      + + +D  Y   ++ KL+SLG 
Sbjct  244  YENHKADGRYICTSHTINTRDLVERLKSIYPNYKYPTNYIEMDD--YKMLSSEKLQSLGW  301

Query  185  KFKSLEESLM  214
            KF+ LEE+L+
Sbjct  302  KFRPLEETLI  311



>gb|AFX98066.1| cinnamoyl-CoA reductase [Cunninghamia lanceolata]
Length=324

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  +L+K +P+ PI NR +   KP  +  Y F+  KL+
Sbjct  238  VFENTSASGRYLCAESVLHRGDVVDLLAKMFPHYPIPNRCSDEVKPRMKP-YNFSNQKLK  296

Query  173  SLGMKFKSLEESL  211
             +G++F  +++ L
Sbjct  297  DIGLEFTPVKQCL  309



>gb|AFK46072.1| unknown [Medicago truncatula]
Length=326

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE   A GRY+C S  I+ +DL   L   YPN      + + +D  Y   ++ KL+SLG 
Sbjct  244  YENHKADGRYICTSHTINTRDLVERLKSIYPNYKYPTNYIEMDD--YKMLSSEKLQSLGW  301

Query  185  KFKSLEESLM  214
            KF+ LEE+L+
Sbjct  302  KFRPLEETLI  311



>gb|AES86491.2| cinnamoyl-CoA reductase [Medicago truncatula]
Length=330

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE   A GRY+C S  I+ +DL   L   YPN      + + +D  Y   ++ KL+SLG 
Sbjct  248  YENHKADGRYICTSHTINTRDLVERLKSIYPNYKYPTNYIEMDD--YKMLSSEKLQSLGW  305

Query  185  KFKSLEESLM  214
            KF+ LEE+L+
Sbjct  306  KFRPLEETLI  315



>ref|XP_006644074.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Oryza brachyantha]
Length=330

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A+GRYLC + ++   + A IL + +P  P++ R    +KP  +  Y+F+  +L 
Sbjct  236  VYEHPAARGRYLCIAGVLHRSEFARILRELFPQYPVTTRCEDNSKPLVKP-YKFSVQRLE  294

Query  173  SLGMKFKSLEESL  211
            +LGM F  L+ES 
Sbjct  295  ALGMHFTPLKESF  307



>gb|EMS35640.1| Dihydroflavonol-4-reductase [Triticum urartu]
Length=262

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +  GRY+C+S    + D+  +L   YP    +N+F + +D     F+++KL  LG
Sbjct  181  VYETPEVSGRYVCSSHARKVSDVIDLLKGMYPAYKFANKFVQVDDEP--SFSSTKLEMLG  238

Query  182  MKFKSLEESL  211
             K K LEE+L
Sbjct  239  WKIKPLEETL  248



>gb|AEO13438.1| cinnamoyl-CoA reductase [Ginkgo biloba]
Length=323

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC  T +   DL  +L+K +P+ P+  + +  ++  ++ Y+F+  KL++
Sbjct  238  VYETPSASGRYLCAETNLHRGDLVDMLAKMFPHYPLPTKCSDEKNPRKKAYKFSNQKLKN  297

Query  176  LGMKFKSLEESL  211
            LG+ F  ++ SL
Sbjct  298  LGLSFTPIKSSL  309



>emb|CAN60237.1| hypothetical protein VITISV_028852 [Vitis vinifera]
Length=268

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +AQGRY+C+S  I  Q+L   L   YP+      +T  E  +    ++ KL+ LG
Sbjct  186  VYEKPEAQGRYICSSYTISTQELVEKLKSMYPBYNYPKSYTAVEGLK---LSSEKLQGLG  242

Query  182  MKFKSLEESLM  214
             K++ LEE+L+
Sbjct  243  WKYRPLEETLV  253



>ref|XP_008659824.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Zea mays]
Length=177

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRY+CNS    + D+  +L   YP    + +F +        F+++KL++LG
Sbjct  96   VYETPEASGRYICNSHARLVSDVIRLLRSWYPTYQCATKFVQVSHEP--AFSSNKLQALG  153

Query  182  MKFKSLEESL  211
             KF+  EE+L
Sbjct  154  WKFRPFEETL  163



>ref|XP_004499176.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like isoform X1 [Cicer arietinum]
Length=341

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            ++E   A+GRY+C S    I D+A++++K+YP+  +  +F   P+  +  +F++ K+  L
Sbjct  241  LFENPKAEGRYICCSHEATIHDVATLINKKYPHFNVPTKFKDIPDQLEIIKFSSKKITEL  300

Query  179  GMKFK-SLEE  205
            G KFK SLE+
Sbjct  301  GFKFKYSLED  310



>ref|XP_009606418.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana tomentosiformis]
Length=319

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ +A+GR++C +     QDL  +L + YPN     RFT   +   Y  +T KL+ LG
Sbjct  238  VYEKPEAEGRHICMAHKAKSQDLVDMLKRHYPNYNYPKRFTDVMEEGSY--STEKLQKLG  295

Query  182  MKFKSLEESLM  214
             K + LEE+L+
Sbjct  296  WKCRPLEETLI  306



>ref|XP_011041140.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=320

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE   A+GRY+C +  I ++DL   L   YPN      FT+ E+++    ++ KL+ LG 
Sbjct  239  YETPRAEGRYICTAHAIRVKDLVEKLRSMYPNYNYPKSFTE-EEQEAVMISSEKLQRLGW  297

Query  185  KFKSLEESLM  214
             F+SLEE+L+
Sbjct  298  SFRSLEETLI  307



>ref|XP_006383799.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
 gb|ERP61596.1| hypothetical protein POPTR_0005s27910g [Populus trichocarpa]
Length=320

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    YEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGM  184
            YE  +A+GRY+C +  I ++DL   L   YPN      FT+ E+++    ++ KL+ LG 
Sbjct  239  YETPEAEGRYICTAHAIRVKDLVEKLRSMYPNYNYPKSFTE-EEQEAVMISSEKLQRLGW  297

Query  185  KFKSLEESLM  214
             F+SL+E+L+
Sbjct  298  SFRSLDETLI  307



>ref|XP_008655508.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Zea mays]
 gb|AFW79671.1| hypothetical protein ZEAMMB73_925860 [Zea mays]
Length=327

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQY---YEFNTSKLR  172
            VYE     GRYLC   ++ +     ++ + +P  PI+N+  K E++     Y+F+T +L 
Sbjct  234  VYEDLRTHGRYLCIGDMLHLSKYVQMMRELFPQYPITNK-CKDENKPMVKPYKFSTKRLG  292

Query  173  SLGMKFKSLEESL  211
            +LGMKF +L+ESL
Sbjct  293  ALGMKFTTLKESL  305



>gb|AJK93559.1| dihydroflavonol reductase 1, partial [Vicia faba]
Length=317

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTK-PEDRQYYEFNTSKLRSL  178
            ++E  + +GRY+CN++  +I D+A +++ ++P   +  +F   P++ ++ +F++ K++ L
Sbjct  236  LFEHMEVEGRYICNASEANIHDIAKLINAKFPEYNVPTKFKNIPDELEHIKFSSKKIKDL  295

Query  179  GMKFKSLEESLMT  217
            G +FK   E + T
Sbjct  296  GFEFKYNLEDMFT  308



>ref|XP_006356249.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=332

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE   A GRYLC  +++   D+  IL+K +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  LYETPSASGRYLCAESVLHRGDIVEILAKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  293  DLGLEFTPVKQCL  305



>ref|XP_008228791.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Prunus mume]
Length=338

 Score = 51.6 bits (122),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+F+  KL+
Sbjct  240  VYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKP-YKFSNQKLQ  298

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  299  DLGLEFTPVKQCL  311


 Score = 23.1 bits (48),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +1

Query  214  DTVTSLMEQGHLS  252
            DTV SL E+GHL+
Sbjct  313  DTVKSLQEKGHLA  325



>gb|AID69232.1| cinnamoyl CoA reductase, partial [Garcinia mangostana]
Length=179

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 39/72 (54%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT--KPEDRQYYEFNTSKLRS  175
            V+E   A GRYLC  T++   D+  IL K +P  PI  + +  K    + Y+F   KL+ 
Sbjct  81   VFETPSASGRYLCAETVLHRGDVVEILVKLFPGYPIPTKCSDEKNPRAKPYKFTNKKLKD  140

Query  176  LGMKFKSLEESL  211
            LG++F  + + L
Sbjct  141  LGLEFTPVRQCL  152



>ref|XP_009782741.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana sylvestris]
Length=321

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE+ + +GRY+C +  +  QDL  +L + YPN     RFT   +   Y  ++ KL+ LG
Sbjct  240  VYERPETEGRYICTAHQVKSQDLVDMLKRHYPNYNYPKRFTDLLEEGSY--SSEKLQKLG  297

Query  182  MKFKSLEESLM  214
             K + LEE+L+
Sbjct  298  WKCRPLEETLI  308



>gb|EMS65144.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=372

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +  GRY+C+S    + D+  +L   YP    +N+F + +D     F+++KL  LG
Sbjct  291  VYETPEVSGRYVCSSHARKVSDVIDLLKGMYPAYKFANKFVQVDDEP--SFSSTKLEMLG  348

Query  182  MKFKSLEESL  211
             K K LEE+L
Sbjct  349  WKIKPLEETL  358



>ref|XP_008799656.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Phoenix dactylifera]
Length=356

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            VYE   A GRYLC  +++  +D+  +L+K +P  P+  + +   +  +Q Y+F+  +L+ 
Sbjct  272  VYEAPGAAGRYLCAESVLHREDVVRLLAKLFPEYPVPTKCSDEVNPRKQPYKFSNQRLKD  331

Query  176  LGMKFKSLEESL  211
            LG+ F  + +SL
Sbjct  332  LGLPFTPVTQSL  343



>gb|ACF87800.1| unknown [Zea mays]
 gb|AFW56892.1| dihydroflavonol-4-reductase [Zea mays]
Length=322

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE   A GRYLC+S  I + D+ +IL   YP      +F + E    Y  NT KLR LG
Sbjct  241  AYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTY--NTEKLRKLG  298

Query  182  MKFKSLEESL  211
               + +E++L
Sbjct  299  WTSRPMEDTL  308



>ref|XP_004965851.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=320

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
             YE+ +A GRY+C+S  I + D+ +IL   YP  P    F + E+      N+ KL+ LG
Sbjct  239  AYEKPEASGRYICSSHPIKVSDMINILKNLYPTYPYPKNFMEVEENTVN--NSEKLQKLG  296

Query  182  MKFKSLEESL  211
              F+ +EE+L
Sbjct  297  WTFRPIEETL  306



>gb|ABQ95548.1| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
 gb|ABQ95550.1| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
 gb|ABQ95553.1| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
Length=238

 Score = 51.2 bits (121),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  P   + +   KP  +  Y+F+  KLR
Sbjct  140  VFETPSASGRYLCAESVLHRGDVVEILAKFFPEYPFPTKCSDEVKPRAKP-YKFSNQKLR  198

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  199  DLGLEFTPVKQCL  211


 Score = 23.5 bits (49),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAPP  267
            +TV SL E+GHL P+ PP
Sbjct  213  ETVKSLQEKGHL-PVPPP  229



>gb|ADU64758.1| cinnamoyl-CoA reductase [Hevea brasiliensis]
Length=338

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT--KPEDRQYYEFNTSKLRS  175
            VYE   A GRYLC  +++   ++  IL+K +P  PI  R +  K    + Y+F+  KL+ 
Sbjct  240  VYEIPSASGRYLCAESVLHRGEVVEILAKSFPEYPIPTRCSDEKNPRAKPYKFSNQKLKD  299

Query  176  LGMKFKSLEESL  211
            LGM+F  +++ L
Sbjct  300  LGMEFTPVKQCL  311



>gb|ABQ95555.1| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
Length=238

 Score = 51.2 bits (121),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  P   + +   KP  +  Y+F+  KLR
Sbjct  140  VFETPSASGRYLCAESVLHRGDVVEILAKFFPEYPFPTKCSDEVKPRAKP-YKFSNQKLR  198

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  199  DLGLEFTPVKQCL  211


 Score = 23.5 bits (49),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAPP  267
            +TV SL E+GHL P+ PP
Sbjct  213  ETVKSLQEKGHL-PVPPP  229



>ref|XP_008228789.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Prunus mume]
Length=346

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+  T KL+
Sbjct  240  VYETPSASGRYLCGESVLHRGDVVEILAKSFPEYPIPTKCSDEVKPRVKP-YKLTTHKLQ  298

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  299  DLGVEFTPVKQCL  311



>gb|AAG42528.1| cinnamoyl-CoA reductase, partial [Prunus persica]
Length=185

 Score = 51.2 bits (121),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+F+  KL+
Sbjct  87   VYEIPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKP-YKFSNQKLQ  145

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  146  DLGLEFTPVKQCL  158


 Score = 23.5 bits (49),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +1

Query  214  DTVTSLMEQGHLS  252
            DTV SL E+GHL+
Sbjct  160  DTVKSLQEKGHLA  172



>ref|XP_009631380.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
 gb|AIL30516.1| cinnamoyl-CoA reductase [Nicotiana tabacum]
Length=332

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE   A GRYLC  +++   D+  IL+K +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  LYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  293  DLGLEFTPVKQCL  305



>gb|ABC40968.2| cinnamoyl CoA reductase [Corymbia citriodora subsp. variegata]
Length=270

 Score = 51.2 bits (121),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  P   + +   KP  +  Y+F+  KLR
Sbjct  172  VFETPSASGRYLCAESVLHRGDVVEILAKFFPEYPFPTKCSDEVKPRAKP-YKFSNQKLR  230

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  231  DLGLEFTPVKQCL  243


 Score = 23.1 bits (48),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAPP  267
            +TV SL E+GHL P+ PP
Sbjct  245  ETVKSLQEKGHL-PVPPP  261



>ref|XP_009106316.1| PREDICTED: cinnamoyl-CoA reductase 2 [Brassica rapa]
Length=329

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYE----FNTSKL  169
            VYE ++A+GRY+CNS  +   DL   L   YP       F++ +++Q  E     ++ KL
Sbjct  240  VYENQEAKGRYICNSHSLHNNDLMEKLMNMYPKRKFPKSFSERKEKQVNENILRISSEKL  299

Query  170  RSLGMKFKSLEESL  211
              LG KF+SLEE++
Sbjct  300  EKLGWKFRSLEETI  313



>ref|XP_009762377.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris]
Length=338

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNR---FTKPEDRQYYEFNTSKLR  172
            +YE   A GRYLC  +++   D+  IL+K +P  PI  +    TKP  +  Y+F+  KL+
Sbjct  234  LYETPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDVTKPRVKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  293  DLGLEFTPVKQCL  305



>gb|AAF43141.1|AF217958_1 cinnamoyl CoA reductase [Populus tremuloides]
Length=337

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  239  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  298

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  299  LGFEFTPVKQCL  310



>gb|AAR83344.1| cinnamoyl CoA reductase [Populus tomentosa]
 gb|AGG37872.1| cinnamoyl-CoA reductase [Populus tomentosa]
Length=338

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  240  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  299

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  300  LGFEFTPVKQCL  311



>ref|XP_004967172.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Setaria italica]
Length=316

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE ++A GRY+CNS    + ++  +L   YP    +  F    D     FN+ KL++LG
Sbjct  235  VYETQEASGRYICNSHPKHVSEVIKLLKSWYPAYRYATNFVPVSDEP--SFNSKKLQALG  292

Query  182  MKFKSLEESL  211
             K K LEE+L
Sbjct  293  WKCKPLEETL  302



>gb|AIB06741.1| dihydroflavonol 4-reductase [Mangifera indica]
Length=333

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDR-QYYEFNTSKLRSL  178
            +YE+ +A+GRY+C+S    I ++A +L ++YP   I  +F   +D  + Y+F++ KL  L
Sbjct  239  LYEKPEAKGRYICSSDSATILEVAKLLREKYPEYNIPTKFKGVDDNLENYKFSSKKLTDL  298

Query  179  GMKFK  193
            G KFK
Sbjct  299  GFKFK  303



>gb|AAG09817.1| cinnamoyl CoA reductase [Lolium perenne]
Length=344

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E  +A GRYLC   ++   D+  ILSK +P  P+  R +   +  +Q Y+ +  KL+ 
Sbjct  244  VFEAPEASGRYLCAERVLHRGDVVQILSKLFPEYPVPTRCSDEVNPRKQPYKMSNQKLQD  303

Query  176  LGMKFKSLEESL  211
            LG++F  + +SL
Sbjct  304  LGLQFTPVNDSL  315



>ref|XP_002303845.1| cinnamoyl CoA reductase family protein [Populus trichocarpa]
 gb|ACC63879.1| cinnamoyl CoA reductase [Populus trichocarpa]
 gb|EEE78824.1| cinnamoyl CoA reductase family protein [Populus trichocarpa]
Length=338

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  240  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  299

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  300  LGFEFTPVKQCL  311



>gb|EMT12003.1| Dihydroflavonol-4-reductase [Aegilops tauschii]
Length=342

 Score = 51.2 bits (121),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE  DA+GRYLC   ++   DL  +L   +P   I+ +     KP  R  Y F+  +LR
Sbjct  245  VYECPDARGRYLCIGAVVHRADLVQLLGDLFPEYQITAKCEDDGKPMARP-YRFSNQRLR  303

Query  173  SLGMKFKSLEESL  211
             LG++F  L ++L
Sbjct  304  DLGLEFTPLRQTL  316


 Score = 23.1 bits (48),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +1

Query  214  DTVTSLMEQGHL  249
            DTV SL +QGHL
Sbjct  318  DTVVSLQQQGHL  329



>emb|CAC07424.1| cinnamoyl-CoA reductase [Populus trichocarpa]
Length=338

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  240  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  299

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  300  LGFEFTPVKQCL  311



>ref|XP_007216959.1| hypothetical protein PRUPE_ppa015546mg [Prunus persica]
 gb|EMJ18158.1| hypothetical protein PRUPE_ppa015546mg [Prunus persica]
Length=228

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+  +P  PI  R +   KP  +  Y+  T KL+
Sbjct  82   VYETPSASGRYLCGESVLHRGDVVEILATFFPEYPIPTRCSDEVKPRVKP-YKLTTQKLQ  140

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  141  DLGVEFTPVKQCL  153



>gb|ACE95172.1| cinnamoyl-CoA reductase [Populus tomentosa]
 gb|AFZ78550.1| cinnamoyl-CoA reductase [Populus tomentosa]
Length=338

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  240  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  299

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  300  LGFEFTPVKQCL  311



>emb|CAA12276.1| cinnamoyl CoA reductase [Populus trichocarpa]
Length=338

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E   A GRYLC+ +++   ++  IL+K +P  PI  + +  ++  +Q Y+F+  KLR 
Sbjct  240  VFETPSASGRYLCSESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKQPYKFSNQKLRD  299

Query  176  LGMKFKSLEESL  211
            LG +F  +++ L
Sbjct  300  LGFEFTPVKQCL  311



>gb|ACF17647.1| putative cinnamoyl-CoA reductase [Capsicum annuum]
Length=334

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRF---TKPEDRQYYEFNTSKLR  172
            VYE   A GRY+C  +++   D+  IL+K +P  PI  +    T+P  +  Y+F+  KL+
Sbjct  234  VYETRSASGRYICAESVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKP-YKFSNQKLK  292

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  293  DLGLEFTPVKQCL  305



>gb|AAP20866.1| putative dihydroflavonol 4-reductase [Anthurium andraeanum]
Length=347

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            ++E  DA+GRY+C+S  + I  LA IL +RYP   +   F + E      +++ KL  LG
Sbjct  241  LFECPDAKGRYICSSHDVTIAGLAQILRQRYPEFDVPTEFGEMEVFDIISYSSKKLTDLG  300

Query  182  MKFK-SLEE  205
             +FK SLE+
Sbjct  301  FEFKYSLED  309



>gb|ABR21214.1| CCR [Lilium hybrid cultivar]
Length=389

 Score = 48.9 bits (115),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLRS  175
            V+E  +A GRYLC  +++   D+   L+K +P  P+  R +   +  +Q Y+F+  +LR 
Sbjct  242  VFEAPEASGRYLCAESVLHRADVVRYLAKLFPEYPLPTRCSDEVNPRKQPYKFSNKRLRD  301

Query  176  LGMKF  190
            LG++F
Sbjct  302  LGLEF  306


 Score = 25.0 bits (53),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = +1

Query  163  KVKELRNEVQVPGREFDDTVTSLMEQGHLSPLAPP  267
            ++++L  E     R F DTV SL E+G L  +A P
Sbjct  298  RLRDLGLEFTPAIRCFYDTVKSLQEKGCLPAVASP  332



>emb|CDX87593.1| BnaA07g32800D [Brassica napus]
Length=324

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYE----FNTSKL  169
            VYE ++A+GRY+CNS  +   DL   L   YP       F++ +++Q  E     ++ KL
Sbjct  235  VYENQEAKGRYICNSHSLHNNDLMEKLMNMYPKRNFPKSFSERKEKQVNENILRISSEKL  294

Query  170  RSLGMKFKSLEESL  211
              LG KF+SLEE++
Sbjct  295  EKLGWKFRSLEETI  308



>ref|XP_007215504.1| hypothetical protein PRUPE_ppa006945mg [Prunus persica]
 gb|EMJ16703.1| hypothetical protein PRUPE_ppa006945mg [Prunus persica]
Length=389

 Score = 50.8 bits (120),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            VYE   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+F+  KL+
Sbjct  291  VYEIPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKP-YKFSNQKLQ  349

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  350  DLGLEFTPVKQCL  362


 Score = 23.1 bits (48),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +1

Query  214  DTVTSLMEQGHLS  252
            DTV SL E+GHL+
Sbjct  364  DTVKSLQEKGHLA  376



>ref|XP_002273454.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI38941.3| unnamed protein product [Vitis vinifera]
Length=338

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFT---KPEDRQYYEFNTSKLR  172
            V+E   A GRYLC  +++   D+  IL+K +P  PI  + +   KP  +  Y+F+  KLR
Sbjct  240  VFEAPSASGRYLCAESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRAKP-YKFSNQKLR  298

Query  173  SLGMKFKSLEESL  211
             LG++F  +++ L
Sbjct  299  ELGLEFIPVKQCL  311



>gb|AHL46438.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46439.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46441.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDR-QYYEFNTSKLRSL  178
            +YE   A+GRY+C+S    I D+A +L++RYP   +  +F   E+      F++ KL+ +
Sbjct  243  LYEHPKAEGRYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEM  302

Query  179  GMKFKSLEESLMT  217
            G +FK   E + T
Sbjct  303  GFEFKHSLEDMFT  315



>gb|AHG93972.1| dihydroflavonol 4-reductase [Musa AB Group]
Length=336

 Score = 47.4 bits (111),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    VYEQEDAQG-RYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPED--RQYYEFNTSKLR  172
            VYE   A G R++C   ++  +D+  IL+K +P  P+ NR +   +  ++ Y F+   LR
Sbjct  241  VYETAGAAGKRFICAERVLHREDVVRILAKLFPEYPVPNRCSDEVNPRKKPYNFSDQGLR  300

Query  173  SLGMKFKSLEESL  211
             LG++ K + +SL
Sbjct  301  DLGLQCKPVSQSL  313


 Score = 26.6 bits (57),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%)
 Frame = +1

Query  214  DTVTSLMEQGHLSPLAPPSH  273
            DTV SL E+GHL P+ PP +
Sbjct  315  DTVKSLQEKGHL-PVMPPQY  333



>ref|XP_004515542.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004515543.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Cicer arietinum]
Length=323

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  8    EQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLGMK  187
            + +DA+ RY+C S  I  +DLA  L   YPN      + + +D  Y   ++ KL+SLG K
Sbjct  242  KHDDAEARYICTSHGITTRDLAEKLKSIYPNYKYPTNYIEVDD--YKMLSSEKLKSLGWK  299

Query  188  FKSLEESLM  214
            +++LEE+L+
Sbjct  300  YRTLEETLI  308



>ref|NP_001292199.1| bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like 
[Fragaria vesca]
 gb|AHL46442.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDR-QYYEFNTSKLRSL  178
            +YE   A+GRY+C+S    I D+A +L++RYP   +  +F   E+      F++ KL+ +
Sbjct  243  LYEHPKAEGRYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEM  302

Query  179  GMKFKSLEESLMT  217
            G +FK   E + T
Sbjct  303  GFEFKHSLEDMFT  315



>ref|XP_002449636.1| hypothetical protein SORBIDRAFT_05g020500 [Sorghum bicolor]
 gb|EES08624.1| hypothetical protein SORBIDRAFT_05g020500 [Sorghum bicolor]
Length=326

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    VYEQEDAQGRYLCNSTIIDIQDLASILSKRYPNLPISNRFTKPEDRQYYEFNTSKLRSLG  181
            VYE  +A GRY+C S  + + ++  I+   YPNL   N F K +D +   F + KL++LG
Sbjct  244  VYETPEASGRYICRSYPMSMTEILDIIKSFYPNLSYPNNFVKVQDERM--FTSKKLQALG  301

Query  182  MKFKSLEESL  211
              ++  EE+ 
Sbjct  302  WSYRPAEETF  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535