BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF027A13

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02169.1|  unnamed protein product                                254   5e-81   Coffea canephora [robusta coffee]
dbj|BAO49717.1|  nuclear pore complex protein Sec13c                    250   2e-79   Nicotiana benthamiana
ref|XP_009623350.1|  PREDICTED: protein SEC13 homolog                   249   4e-79   Nicotiana tomentosiformis
ref|NP_001275312.1|  protein transport SEC13-like protein               249   8e-79   Solanum tuberosum [potatoes]
ref|XP_009764554.1|  PREDICTED: protein SEC13 homolog                   248   1e-78   Nicotiana sylvestris
ref|XP_011098538.1|  PREDICTED: protein transport protein SEC13 h...    246   9e-78   Sesamum indicum [beniseed]
gb|EYU44682.1|  hypothetical protein MIMGU_mgv1a010776mg                245   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_004232260.1|  PREDICTED: protein transport protein SEC13 h...    244   3e-77   Solanum lycopersicum
dbj|BAO49718.1|  nuclear pore complex protein Sec13d                    244   4e-77   Nicotiana benthamiana
dbj|BAO49715.1|  nuclear pore complex protein Sec13a                    244   5e-77   Nicotiana benthamiana
ref|XP_002281856.1|  PREDICTED: protein transport protein SEC13 h...    244   5e-77   Vitis vinifera
gb|KDP43859.1|  hypothetical protein JCGZ_20869                         243   1e-76   Jatropha curcas
ref|XP_009759579.1|  PREDICTED: protein transport protein SEC13-like    242   3e-76   Nicotiana sylvestris
ref|XP_002265971.1|  PREDICTED: protein transport protein SEC13 h...    242   4e-76   Vitis vinifera
ref|XP_010033246.1|  PREDICTED: protein SEC13 homolog                   241   5e-76   Eucalyptus grandis [rose gum]
gb|KHM99531.1|  Protein SEC13 like                                      243   5e-76   Glycine soja [wild soybean]
ref|XP_008380946.1|  PREDICTED: protein transport protein SEC13-like    242   5e-76   Malus domestica [apple tree]
ref|XP_003551869.1|  PREDICTED: protein SEC13 homolog                   241   6e-76   Glycine max [soybeans]
ref|XP_011021702.1|  PREDICTED: protein transport protein SEC13 h...    241   7e-76   Populus euphratica
emb|CAN81348.1|  hypothetical protein VITISV_021485                     241   7e-76   Vitis vinifera
ref|XP_011085795.1|  PREDICTED: protein transport protein SEC13 h...    241   8e-76   Sesamum indicum [beniseed]
gb|KHN12541.1|  Protein SEC13 like                                      241   9e-76   Glycine soja [wild soybean]
gb|ACU20139.1|  unknown                                                 241   9e-76   Glycine max [soybeans]
gb|KHM99522.1|  Protein SEC13 like                                      241   9e-76   Glycine soja [wild soybean]
ref|XP_007145729.1|  hypothetical protein PHAVU_007G263000g             241   1e-75   Phaseolus vulgaris [French bean]
ref|XP_006586096.1|  PREDICTED: protein SEC13 homolog isoform X1        241   1e-75   Glycine max [soybeans]
gb|KCW52832.1|  hypothetical protein EUGRSUZ_J02164                     241   1e-75   Eucalyptus grandis [rose gum]
ref|XP_011072420.1|  PREDICTED: protein transport protein SEC13 h...    240   1e-75   Sesamum indicum [beniseed]
ref|XP_010094976.1|  Protein SEC13-like protein                         240   2e-75   Morus notabilis
ref|XP_010267185.1|  PREDICTED: protein transport protein SEC13 h...    239   3e-75   Nelumbo nucifera [Indian lotus]
gb|KHG11308.1|  Protein SEC13                                           239   3e-75   Gossypium arboreum [tree cotton]
ref|XP_003551800.1|  PREDICTED: protein SEC13 homolog isoform X1        239   4e-75   
gb|AGV54445.1|  protein transport SEC13-like protein                    239   4e-75   Phaseolus vulgaris [French bean]
ref|XP_010099520.1|  Protein SEC13-like protein                         239   4e-75   Morus notabilis
ref|XP_003532149.2|  PREDICTED: protein SEC13 homolog isoform X1        241   5e-75   
gb|KJB45573.1|  hypothetical protein B456_007G314500                    239   6e-75   Gossypium raimondii
ref|XP_006586103.1|  PREDICTED: protein SEC13 homolog isoform X2        241   6e-75   
ref|XP_006410056.1|  hypothetical protein EUTSA_v10016789mg             241   6e-75   
ref|XP_010550097.1|  PREDICTED: protein transport protein SEC13 h...    239   6e-75   Tarenaya hassleriana [spider flower]
ref|XP_002315836.1|  transport protein SEC13                            238   6e-75   
ref|XP_006410057.1|  hypothetical protein EUTSA_v10016789mg             241   7e-75   
dbj|BAJ10727.1|  SEC13 family protein                                   238   1e-74   Lotus japonicus
ref|XP_008462440.1|  PREDICTED: protein SEC13 homolog                   238   1e-74   Cucumis melo [Oriental melon]
emb|CAN79974.1|  hypothetical protein VITISV_009154                     238   1e-74   Vitis vinifera
emb|CAN80755.1|  hypothetical protein VITISV_027966                     238   1e-74   Vitis vinifera
gb|ACU18089.1|  unknown                                                 238   2e-74   Glycine max [soybeans]
ref|XP_004302867.1|  PREDICTED: protein transport protein SEC13 h...    238   2e-74   Fragaria vesca subsp. vesca
ref|XP_002321555.1|  hypothetical protein POPTR_0015s080101g            237   2e-74   
ref|XP_006446433.1|  hypothetical protein CICLE_v10016079mg             237   2e-74   Citrus clementina [clementine]
ref|XP_006470402.1|  PREDICTED: protein SEC13 homolog                   237   2e-74   
emb|CAN63472.1|  hypothetical protein VITISV_000787                     237   3e-74   Vitis vinifera
ref|XP_011466663.1|  PREDICTED: protein transport protein SEC13 h...    237   3e-74   Fragaria vesca subsp. vesca
ref|XP_002266827.2|  PREDICTED: protein transport protein SEC13 h...    237   3e-74   Vitis vinifera
ref|XP_009603401.1|  PREDICTED: protein transport protein SEC13-like    233   4e-74   Nicotiana tomentosiformis
ref|XP_011466664.1|  PREDICTED: protein transport protein SEC13 h...    237   4e-74   Fragaria vesca subsp. vesca
ref|XP_004141658.1|  PREDICTED: protein SEC13 homolog                   236   4e-74   Cucumis sativus [cucumbers]
ref|XP_011028666.1|  PREDICTED: protein transport protein SEC13 h...    236   4e-74   Populus euphratica
ref|XP_011080528.1|  PREDICTED: protein transport protein SEC13 h...    236   4e-74   Sesamum indicum [beniseed]
gb|AFK36737.1|  unknown                                                 233   5e-74   Lotus japonicus
ref|XP_007144311.1|  hypothetical protein PHAVU_007G145400g             236   5e-74   Phaseolus vulgaris [French bean]
ref|XP_007024275.1|  Transducin family protein / WD-40 repeat fam...    236   1e-73   
ref|XP_004150601.1|  PREDICTED: protein SEC13 homolog                   235   1e-73   Cucumis sativus [cucumbers]
gb|AAM65185.1|  transport protein SEC13, putative                       234   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186783.1|  transport protein SEC13B                              234   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272104.1|  PREDICTED: protein transport protein SEC13 h...    234   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010551882.1|  PREDICTED: protein transport protein SEC13 h...    234   3e-73   Tarenaya hassleriana [spider flower]
emb|CDP21792.1|  unnamed protein product                                234   3e-73   Coffea canephora [robusta coffee]
ref|XP_002515980.1|  protein transport protein sec13, putative          234   4e-73   Ricinus communis
ref|XP_007215469.1|  hypothetical protein PRUPE_ppa006517mg             237   4e-73   
ref|XP_010524317.1|  PREDICTED: protein transport protein SEC13 h...    233   6e-73   Tarenaya hassleriana [spider flower]
emb|CDY24035.1|  BnaC03g16560D                                          233   9e-73   Brassica napus [oilseed rape]
emb|CDX84863.1|  BnaA03g13670D                                          233   1e-72   
dbj|BAJ10728.1|  SEC13 family protein                                   233   1e-72   Lotus japonicus
ref|XP_008379297.1|  PREDICTED: protein SEC13 homolog                   232   2e-72   Malus domestica [apple tree]
gb|KEH33918.1|  transducin/WD-like repeat-protein                       231   3e-72   Medicago truncatula
ref|XP_006294683.1|  hypothetical protein CARUB_v10023720mg             231   4e-72   Capsella rubella
ref|XP_009335780.1|  PREDICTED: protein SEC13 homolog                   231   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_004512728.1|  PREDICTED: protein SEC13 homolog isoform X1        231   5e-72   Cicer arietinum [garbanzo]
ref|XP_006408491.1|  hypothetical protein EUTSA_v10021223mg             230   1e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010687899.1|  PREDICTED: protein transport protein SEC13 h...    230   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215747.1|  hypothetical protein PRUPE_ppa009252mg             229   2e-71   Prunus persica
ref|XP_008230683.1|  PREDICTED: protein SEC13 homolog                   229   2e-71   Prunus mume [ume]
ref|XP_010510416.1|  PREDICTED: protein transport protein SEC13 h...    229   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010414320.1|  PREDICTED: protein transport protein SEC13 h...    231   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010469902.1|  PREDICTED: protein transport protein SEC13 h...    229   4e-71   Camelina sativa [gold-of-pleasure]
emb|CDY02025.1|  BnaC04g14760D                                          229   4e-71   
gb|EYU21504.1|  hypothetical protein MIMGU_mgv1a010808mg                228   6e-71   Erythranthe guttata [common monkey flower]
dbj|BAO49716.1|  nuclear pore complex protein Sec13b                    228   9e-71   Nicotiana benthamiana
ref|XP_006298213.1|  hypothetical protein CARUB_v10014264mg             228   1e-70   Capsella rubella
ref|XP_002879246.1|  transducin family protein                          227   2e-70   Arabidopsis lyrata subsp. lyrata
gb|KDO51761.1|  hypothetical protein CISIN_1g036510mg                   227   2e-70   Citrus sinensis [apfelsine]
emb|CDY37530.1|  BnaA05g33950D                                          227   2e-70   Brassica napus [oilseed rape]
ref|XP_006426897.1|  hypothetical protein CICLE_v10026168mg             227   2e-70   Citrus clementina [clementine]
gb|AAM65095.1|  putative protein transport protein SEC13                227   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465678.1|  PREDICTED: protein SEC13 homolog                   227   2e-70   Citrus sinensis [apfelsine]
ref|NP_180566.1|  transport protein SEC13A                              227   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500953.1|  PREDICTED: protein transport protein SEC13 h...    226   5e-70   Camelina sativa [gold-of-pleasure]
gb|KJB40797.1|  hypothetical protein B456_007G077700                    226   5e-70   Gossypium raimondii
gb|EPS72747.1|  hypothetical protein M569_02010                         226   5e-70   Genlisea aurea
ref|XP_004235651.1|  PREDICTED: protein transport protein SEC13 h...    226   5e-70   Solanum lycopersicum
ref|XP_010485502.1|  PREDICTED: protein transport protein SEC13 h...    226   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010929133.1|  PREDICTED: protein transport protein SEC13 h...    226   6e-70   Elaeis guineensis
emb|CDY49046.1|  BnaC05g48740D                                          226   6e-70   Brassica napus [oilseed rape]
emb|CDY10705.1|  BnaA05g12310D                                          228   6e-70   Brassica napus [oilseed rape]
ref|XP_008790006.1|  PREDICTED: protein SEC13 homolog                   226   6e-70   Phoenix dactylifera
ref|XP_007032314.1|  Transducin family protein / WD-40 repeat fam...    226   6e-70   
gb|KCW84259.1|  hypothetical protein EUGRSUZ_B01116                     226   7e-70   Eucalyptus grandis [rose gum]
ref|XP_010463534.1|  PREDICTED: protein transport protein SEC13 h...    225   8e-70   Camelina sativa [gold-of-pleasure]
ref|XP_011466267.1|  PREDICTED: protein transport protein SEC13 h...    225   1e-69   Fragaria vesca subsp. vesca
gb|AFX66988.1|  protein transport SEC13-like protein                    226   1e-69   Solanum tuberosum [potatoes]
ref|XP_009147418.1|  PREDICTED: protein SEC13 homolog                   225   1e-69   Brassica rapa
ref|XP_009408052.1|  PREDICTED: protein SEC13 homolog                   223   5e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010665916.1|  PREDICTED: protein transport protein SEC13 h...    223   6e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009141033.1|  PREDICTED: protein SEC13 homolog                   223   6e-69   Brassica rapa
gb|KDP40875.1|  hypothetical protein JCGZ_24874                         223   8e-69   Jatropha curcas
gb|KHG02181.1|  Protein SEC13                                           223   9e-69   Gossypium arboreum [tree cotton]
emb|CDX97854.1|  BnaC04g40850D                                          221   3e-68   
ref|XP_004169158.1|  PREDICTED: protein SEC13 homolog                   221   5e-68   
ref|XP_004147452.1|  PREDICTED: protein SEC13 homolog                   221   5e-68   Cucumis sativus [cucumbers]
ref|XP_008443459.1|  PREDICTED: protein SEC13 homolog                   220   7e-68   Cucumis melo [Oriental melon]
ref|XP_010942123.1|  PREDICTED: protein transport protein SEC13 h...    220   1e-67   Elaeis guineensis
ref|XP_006836221.1|  hypothetical protein AMTR_s00101p00099400          220   1e-67   Amborella trichopoda
emb|CDY29706.1|  BnaA04g17210D                                          226   2e-66   Brassica napus [oilseed rape]
ref|XP_010249546.1|  PREDICTED: protein transport protein SEC13 h...    216   2e-66   
ref|NP_001045820.1|  Os02g0135800                                       217   2e-66   
gb|EMT07862.1|  hypothetical protein F775_17938                         216   3e-66   
gb|EMT13956.1|  hypothetical protein F775_31904                         216   1e-65   
ref|XP_006646853.1|  PREDICTED: protein SEC13 homolog                   214   2e-65   Oryza brachyantha
gb|EMS54340.1|  Protein SEC13-like protein                              214   3e-65   Triticum urartu
ref|XP_003565584.1|  PREDICTED: protein transport protein SEC13 h...    214   4e-65   Brachypodium distachyon [annual false brome]
gb|ACN59487.1|  SEC13                                                   214   4e-65   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ89756.1|  predicted protein                                      213   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010098129.1|  Protein SEC13-like protein                         214   6e-65   
ref|XP_006854548.1|  hypothetical protein AMTR_s00030p00063600          213   7e-65   Amborella trichopoda
ref|NP_001149004.1|  SEC13-related protein                              213   7e-65   
gb|AGT16309.1|  SEC13-related protein                                   213   8e-65   Saccharum hybrid cultivar R570
ref|XP_002454939.1|  hypothetical protein SORBIDRAFT_03g001760          213   8e-65   Sorghum bicolor [broomcorn]
ref|XP_006646846.1|  PREDICTED: protein SEC13 homolog                   213   1e-64   Oryza brachyantha
gb|ACG46695.1|  SEC13-related protein                                   213   1e-64   Zea mays [maize]
gb|AGT17401.1|  SEC13-related protein                                   212   1e-64   Saccharum hybrid cultivar R570
ref|XP_004968630.1|  PREDICTED: protein SEC13 homolog                   211   6e-64   Setaria italica
ref|XP_004956945.1|  PREDICTED: protein SEC13 homolog                   211   6e-64   Setaria italica
ref|XP_010914535.1|  PREDICTED: protein transport protein SEC13 h...    210   7e-64   Elaeis guineensis
ref|NP_001150249.1|  SEC13-related protein                              210   9e-64   Zea mays [maize]
gb|EPS72324.1|  hypothetical protein M569_02435                         207   7e-63   Genlisea aurea
gb|EMT33754.1|  hypothetical protein F775_27473                         204   1e-61   
ref|XP_003563373.1|  PREDICTED: protein transport protein SEC13 h...    199   4e-59   Brachypodium distachyon [annual false brome]
ref|XP_002979018.1|  hypothetical protein SELMODRAFT_109958             196   5e-58   
gb|ABK22893.1|  unknown                                                 196   5e-58   Picea sitchensis
ref|NP_001059284.1|  Os07g0246300                                       195   9e-58   
ref|XP_002988399.1|  hypothetical protein SELMODRAFT_128111             195   1e-57   
ref|XP_006650845.1|  PREDICTED: protein SEC13 homolog                   193   3e-57   Oryza brachyantha
ref|NP_001146460.1|  SEC13 protein                                      191   4e-56   Zea mays [maize]
ref|NP_001051797.1|  Os03g0831800                                       189   8e-56   
gb|EMS55260.1|  Protein SEC13-like protein                              189   1e-55   Triticum urartu
ref|XP_006657588.1|  PREDICTED: protein SEC13 homolog                   189   3e-55   Oryza brachyantha
ref|XP_010228200.1|  PREDICTED: protein transport protein SEC13 h...    188   4e-55   
dbj|BAJ95085.1|  predicted protein                                      188   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT21065.1|  hypothetical protein F775_28222                         189   8e-55   
ref|XP_001781370.1|  predicted protein                                  187   8e-55   
ref|NP_001149986.1|  SEC13-related protein                              186   1e-54   Zea mays [maize]
gb|ACN31668.1|  unknown                                                 186   1e-54   Zea mays [maize]
ref|XP_004955890.1|  PREDICTED: protein SEC13 homolog                   186   2e-54   Setaria italica
ref|XP_008651486.1|  PREDICTED: SEC13-related protein isoform X2        188   3e-54   
ref|XP_002460282.1|  hypothetical protein SORBIDRAFT_02g025945          183   1e-53   
ref|XP_001767345.1|  predicted protein                                  184   1e-53   
ref|XP_001768123.1|  predicted protein                                  181   2e-52   
ref|XP_001774339.1|  predicted protein                                  178   2e-51   
ref|XP_005834017.1|  secretory protein Sec13                            172   4e-49   Guillardia theta CCMP2712
gb|ABK26393.1|  unknown                                                 171   6e-49   Picea sitchensis
gb|ABM55656.1|  putative SEC13-like protein 1                           170   2e-48   Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|XP_006379798.1|  hypothetical protein POPTR_0008s14080g             168   8e-48   
ref|XP_011407281.1|  PREDICTED: protein SEC13 homolog                   169   1e-47   Amphimedon queenslandica
ref|XP_003384987.1|  PREDICTED: protein SEC13 homolog                   168   2e-47   Amphimedon queenslandica
ref|XP_009824525.1|  hypothetical protein H257_02541                    167   3e-47   Aphanomyces astaci
ref|XP_008863897.1|  hypothetical protein H310_02232                    166   9e-47   Aphanomyces invadans
ref|XP_008615576.1|  hypothetical protein SDRG_11321                    166   9e-47   Saprolegnia diclina VS20
ref|XP_004358973.1|  WD40 repeat-containing protein                     166   1e-46   Cavenderia fasciculata
ref|XP_005650517.1|  WD40 repeat-like protein                           166   1e-46   Coccomyxa subellipsoidea C-169
dbj|GAM20430.1|  hypothetical protein SAMD00019534_036050               166   1e-46   Acytostelium subglobosum LB1
gb|KDO31944.1|  hypothetical protein SPRG_03160                         166   1e-46   Saprolegnia parasitica CBS 223.65
gb|ETI55052.1|  hypothetical protein F443_02234                         166   2e-46   Phytophthora parasitica P1569
gb|EMD31608.1|  hypothetical protein CERSUDRAFT_119652                  165   3e-46   Gelatoporia subvermispora B
ref|XP_002900105.1|  protein transport protein SEC13                    165   3e-46   Phytophthora infestans T30-4
ref|XP_008899868.1|  hypothetical protein PPTG_22013                    169   4e-46   Phytophthora parasitica INRA-310
ref|XP_001700438.1|  COP-II coat subunit                                164   5e-46   Chlamydomonas reinhardtii
ref|XP_003287675.1|  hypothetical protein DICPUDRAFT_151816             164   5e-46   Dictyostelium purpureum
ref|XP_003395453.1|  PREDICTED: protein SEC13 homolog                   164   6e-46   Bombus terrestris [large earth bumblebee]
ref|XP_006957939.1|  WD40 repeat-like protein                           164   7e-46   Wallemia mellicola CBS 633.66
ref|XP_393516.3|  PREDICTED: protein SEC13 homolog isoform X2           164   9e-46   Apis mellifera [bee]
gb|EFA85457.1|  WD40 repeat-containing protein                          163   9e-46   Heterostelium album PN500
ref|XP_002949031.1|  hypothetical protein VOLCADRAFT_80440              163   1e-45   Volvox carteri f. nagariensis
ref|XP_011211710.1|  PREDICTED: protein SEC13 homolog                   163   2e-45   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004345908.1|  SEC13, putative                                    162   2e-45   Acanthamoeba castellanii str. Neff
gb|AGM32573.1|  WD40 domain containing protein                          162   2e-45   Coptotermes formosanus
ref|XP_011188336.1|  PREDICTED: protein SEC13 homolog                   162   2e-45   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001599879.1|  PREDICTED: protein SEC13 homolog                   162   3e-45   Nasonia vitripennis
ref|XP_011258903.1|  PREDICTED: protein SEC13 homolog                   162   4e-45   Camponotus floridanus
ref|XP_011160175.1|  PREDICTED: protein SEC13 homolog                   162   4e-45   Solenopsis invicta [imported red fire ant]
emb|CCA17819.1|  protein transport protein SEC13 putative               164   5e-45   Albugo laibachii Nc14
ref|XP_011144386.1|  PREDICTED: protein SEC13 homolog                   162   6e-45   Harpegnathos saltator
ref|XP_011053770.1|  PREDICTED: protein SEC13 homolog                   161   7e-45   Acromyrmex echinatior
ref|XP_629794.1|  WD40 repeat-containing protein                        160   9e-45   Dictyostelium discoideum AX4
ref|XP_002127937.1|  PREDICTED: protein SEC13 homolog                   161   1e-44   Ciona intestinalis [sea vase]
ref|XP_011343632.1|  PREDICTED: protein SEC13 homolog                   161   1e-44   Ooceraea biroi
emb|CCI42360.1|  unnamed protein product                                160   1e-44   Albugo candida
ref|XP_007145724.1|  hypothetical protein PHAVU_007G2627001g            154   1e-44   Phaseolus vulgaris [French bean]
gb|KDR17793.1|  SEC13-like protein                                      160   2e-44   Zootermopsis nevadensis
ref|XP_008558049.1|  PREDICTED: protein SEC13 homolog                   160   2e-44   Microplitis demolitor
ref|XP_005186970.1|  PREDICTED: protein SEC13 homolog                   160   2e-44   Musca domestica
emb|CDS08364.1|  hypothetical protein LRAMOSA02312                      160   2e-44   Lichtheimia ramosa
emb|CDH60247.1|  wd40 repeat-like protein                               160   2e-44   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIN98473.1|  hypothetical protein M404DRAFT_1005321                  160   2e-44   Pisolithus tinctorius Marx 270
dbj|BAN21266.1|  protein transport protein sec13                        160   3e-44   Riptortus pedestris
ref|XP_011306080.1|  PREDICTED: protein SEC13 homolog                   159   5e-44   Fopius arisanus
ref|XP_011500941.1|  PREDICTED: protein SEC13 homolog                   159   7e-44   Ceratosolen solmsi marchali
ref|XP_003705427.1|  PREDICTED: protein SEC13 homolog                   159   9e-44   Megachile rotundata
gb|EZA51201.1|  SEC13-like protein                                      158   9e-44   Ooceraea biroi
ref|XP_002406173.1|  vesicle coat complex COPII, subunit SEC13, p...    159   9e-44   Ixodes scapularis [blacklegged tick]
ref|XP_002429091.1|  protein transport protein sec13, putative          160   1e-43   Pediculus humanus corporis [human body lice]
gb|EFX87077.1|  hypothetical protein DAPPUDRAFT_221812                  158   1e-43   Daphnia pulex
ref|XP_009269186.1|  Protein transport protein SEC13                    163   2e-43   Wallemia ichthyophaga EXF-994
ref|XP_003031195.1|  hypothetical protein SCHCODRAFT_76913              157   2e-43   Schizophyllum commune H4-8
emb|CCG81563.1|  Protein transport protein sec13                        157   2e-43   Taphrina deformans PYCC 5710
gb|EDK99501.1|  SEC13-like 1 (S. cerevisiae), isoform CRA_a             152   4e-43   Mus musculus [mouse]
ref|XP_002470576.1|  predicted protein                                  155   4e-43   
sp|A5DHD9.2|SEC13_PICGU  RecName: Full=Protein transport protein ...    156   4e-43   Meyerozyma guilliermondii ATCC 6260
gb|EDL91559.1|  SEC13-like 1 (S. cerevisiae), isoform CRA_a             152   5e-43   Rattus norvegicus [brown rat]
ref|XP_006173389.1|  PREDICTED: protein SEC13 homolog                   158   6e-43   
ref|XP_007848859.1|  vesicle budding-related protein                    157   6e-43   
ref|XP_005669827.1|  PREDICTED: protein SEC13 homolog                   151   8e-43   
gb|KIJ19381.1|  hypothetical protein PAXINDRAFT_174886                  156   1e-42   Paxillus involutus ATCC 200175
gb|ERL92416.1|  hypothetical protein D910_09730                         156   1e-42   Dendroctonus ponderosae
gb|KIY47815.1|  protein transporter SEC13                               156   1e-42   Fistulina hepatica ATCC 64428
gb|KIK86600.1|  hypothetical protein PAXRUDRAFT_831899                  156   1e-42   Paxillus rubicundulus Ve08.2h10
emb|CCM02720.1|  predicted protein                                      158   2e-42   Fibroporia radiculosa
gb|KIJ67346.1|  hypothetical protein HYDPIDRAFT_127263                  155   2e-42   Hydnomerulius pinastri MD-312
ref|XP_004923349.1|  PREDICTED: protein SEC13 homolog                   155   2e-42   Bombyx mori [silk moth]
ref|XP_002616529.1|  hypothetical protein CLUG_03770                    154   2e-42   Clavispora lusitaniae ATCC 42720
gb|KFM60497.1|  Protein SEC13-like protein                              155   2e-42   Stegodyphus mimosarum
gb|EHJ78717.1|  putative protein transport protein sec13                155   2e-42   
gb|EMG50389.1|  likely COPII vesicle coat component                     152   3e-42   Candida maltosa Xu316
gb|KFH71651.1|  protein transporter SEC13                               155   3e-42   Mortierella verticillata NRRL 6337
gb|KIK69017.1|  hypothetical protein GYMLUDRAFT_188436                  155   3e-42   Gymnopus luxurians FD-317 M1
ref|XP_001845022.1|  transport protein SEC13                            155   3e-42   Culex quinquefasciatus
gb|KIP02372.1|  hypothetical protein PHLGIDRAFT_32221                   155   4e-42   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003959888.1|  hypothetical protein KAFR_0L01440                  154   4e-42   Kazachstania africana CBS 2517
gb|KIO17537.1|  hypothetical protein M407DRAFT_246718                   155   5e-42   Tulasnella calospora MUT 4182
ref|XP_001631519.1|  predicted protein                                  154   5e-42   Nematostella vectensis
ref|NP_988967.1|  SEC13 homolog                                         154   6e-42   Xenopus tropicalis [western clawed frog]
ref|XP_001382421.2|  hypothetical protein PICST_76043                   153   6e-42   Scheffersomyces stipitis CBS 6054
gb|ABO65080.1|  SEC13-like 1 isoform                                    150   7e-42   Homo sapiens [man]
ref|XP_001484961.1|  conserved hypothetical protein                     153   7e-42   Meyerozyma guilliermondii ATCC 6260
ref|XP_005846000.1|  hypothetical protein CHLNCDRAFT_31922              153   8e-42   Chlorella variabilis
ref|XP_001527200.1|  protein transport protein SEC13                    153   9e-42   Lodderomyces elongisporus NRRL YB-4239
ref|XP_005774314.1|  secretory protein 13                               150   9e-42   Emiliania huxleyi CCMP1516
ref|NP_001265875.1|  protein SEC13 homolog isoform 5                    150   9e-42   Homo sapiens [man]
ref|XP_312881.4|  AGAP003183-PA                                         153   1e-41   Anopheles gambiae str. PEST
emb|CCJ30100.1|  unnamed protein product                                159   1e-41   Pneumocystis jirovecii
gb|KDN35578.1|  WD40 repeat-like protein                                154   1e-41   Tilletiaria anomala UBC 951
gb|KFB48498.1|  AGAP003183-PA-like protein                              153   1e-41   Anopheles sinensis
gb|KIM52349.1|  hypothetical protein SCLCIDRAFT_18187                   153   1e-41   Scleroderma citrinum Foug A
ref|XP_004203292.1|  Piso0_000897                                       152   1e-41   
tpg|DAA34484.1|  TPA: vesicle coat complex COPII subunit SEC13          151   1e-41   Amblyomma variegatum
emb|CCK68710.1|  hypothetical protein KNAG_0B02670                      152   1e-41   Kazachstania naganishii CBS 8797
ref|XP_006807456.1|  PREDICTED: protein SEC13 homolog                   152   2e-41   Neolamprologus brichardi [lyretail cichlid]
emb|CDO70048.1|  hypothetical protein BN946_scf184650.g6                157   2e-41   Trametes cinnabarina
ref|XP_002599724.1|  hypothetical protein BRAFLDRAFT_287194             152   2e-41   Branchiostoma floridae
ref|XP_005265434.1|  PREDICTED: protein SEC13 homolog isoform X1        153   2e-41   
ref|XP_003826330.1|  PREDICTED: protein SEC13 homolog isoform X1        154   2e-41   Pan paniscus [bonobo]
gb|ENN78132.1|  hypothetical protein YQE_05286                          154   2e-41   Dendroctonus ponderosae
sp|Q5AEF2.2|SEC13_CANAL  RecName: Full=Protein transport protein ...    152   2e-41   Candida albicans SC5314
emb|CEI88084.1|  hypothetical protein RMCBS344292_02484                 151   2e-41   Rhizopus microsporus
ref|XP_005066188.1|  PREDICTED: protein SEC13 homolog isoform X1        152   2e-41   
gb|KDQ58034.1|  hypothetical protein JAAARDRAFT_34850                   152   3e-41   Jaapia argillacea MUCL 33604
emb|CCE40285.1|  hypothetical protein CPAR2_103230                      152   3e-41   Candida parapsilosis
ref|NP_001129498.1|  protein SEC13 homolog isoform 3                    153   3e-41   Homo sapiens [man]
ref|XP_007944008.1|  PREDICTED: protein SEC13 homolog                   152   3e-41   Orycteropus afer afer
ref|XP_005066189.1|  PREDICTED: protein SEC13 homolog isoform X2        152   3e-41   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004203875.1|  Piso0_000897                                       152   3e-41   
emb|CBJ29707.1|  conserved unknown protein                              152   3e-41   
ref|XP_720143.1|  likely COPII vesicle coat component                   153   3e-41   
gb|EST05777.1|  putative SEC13-protein transport protein                153   3e-41   
emb|CCF51698.1|  probable SEC13-protein transport protein               153   3e-41   
ref|XP_007517208.1|  PREDICTED: protein SEC13 homolog                   154   3e-41   
ref|XP_002419243.1|  nuclear pore complex subunit, putative; prot...    151   3e-41   
ref|XP_011368966.1|  PREDICTED: protein SEC13 homolog                   152   3e-41   
ref|XP_006917678.1|  PREDICTED: protein SEC13 homolog                   152   3e-41   
gb|KIK21946.1|  hypothetical protein PISMIDRAFT_532584                  152   4e-41   
gb|AAH73381.1|  Unknown (protein for MGC:80813)                         152   4e-41   
dbj|GAN06362.1|  WD40 repeat-like protein                               152   4e-41   
ref|XP_007320210.1|  hypothetical protein SERLADRAFT_471545             152   4e-41   
ref|XP_005265435.1|  PREDICTED: protein SEC13 homolog isoform X2        152   4e-41   
ref|XP_003464126.1|  PREDICTED: protein SEC13 homolog                   152   4e-41   
ref|XP_005145852.1|  PREDICTED: protein SEC13 homolog                   152   4e-41   
gb|KFZ64786.1|  Protein SEC13                                           152   4e-41   
gb|KFP30820.1|  Protein SEC13                                           152   4e-41   
ref|XP_006206940.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    154   4e-41   
gb|KFQ30001.1|  Protein SEC13                                           152   4e-41   
emb|CEP11970.1|  hypothetical protein                                   151   4e-41   
ref|XP_010085319.1|  PREDICTED: protein SEC13 homolog                   152   4e-41   
ref|XP_007060002.1|  PREDICTED: protein SEC13 homolog                   152   5e-41   
ref|NP_001080442.1|  SEC13 homolog                                      152   5e-41   
ref|XP_006132885.1|  PREDICTED: protein SEC13 homolog                   152   5e-41   
ref|XP_009551293.1|  hypothetical protein HETIRDRAFT_421852             152   5e-41   
ref|XP_010172929.1|  PREDICTED: protein SEC13 homolog                   152   5e-41   
gb|EJT98067.1|  WD40 repeat-like protein                                152   5e-41   
ref|XP_003762460.1|  PREDICTED: protein SEC13 homolog                   151   5e-41   
ref|XP_001375694.2|  PREDICTED: protein SEC13 homolog                   151   5e-41   
ref|XP_007766508.1|  WD40 repeat-like protein                           152   5e-41   
ref|NP_001264770.1|  protein SEC13 homolog                              151   6e-41   
gb|EMC83360.1|  Protein SEC13 like protein                              151   6e-41   
gb|KIM29727.1|  hypothetical protein M408DRAFT_67279                    152   6e-41   
gb|KFW82958.1|  Protein SEC13                                           151   6e-41   
gb|KFO59722.1|  Protein SEC13                                           151   6e-41   
ref|XP_008924583.1|  PREDICTED: protein SEC13 homolog                   151   6e-41   
ref|XP_005522008.1|  PREDICTED: protein SEC13 homolog                   151   6e-41   
ref|XP_010159209.1|  PREDICTED: protein SEC13 homolog                   152   6e-41   
gb|KFV84534.1|  Protein SEC13                                           151   6e-41   
ref|XP_004084891.1|  PREDICTED: protein SEC13 homolog                   151   6e-41   
ref|XP_005509092.1|  PREDICTED: protein SEC13 homolog                   151   6e-41   
ref|XP_003894158.1|  PREDICTED: protein SEC13 homolog isoform X1        152   6e-41   
gb|KIL60388.1|  hypothetical protein M378DRAFT_26525                    152   6e-41   
gb|KFM01351.1|  Protein SEC13                                           151   7e-41   
ref|XP_009704500.1|  PREDICTED: protein SEC13 homolog                   151   7e-41   
gb|KFV45554.1|  Protein SEC13                                           151   7e-41   
gb|KFP91989.1|  Protein SEC13                                           151   7e-41   
ref|XP_004033647.1|  PREDICTED: protein SEC13 homolog isoform 3         152   7e-41   
emb|CBQ70973.1|  probable SEC13-protein transport protein               152   7e-41   
ref|XP_009512940.1|  PREDICTED: protein SEC13 homolog                   151   7e-41   
ref|XP_009874190.1|  PREDICTED: protein SEC13 homolog                   151   7e-41   
ref|XP_007983410.1|  PREDICTED: protein SEC13 homolog isoform X1        152   7e-41   
ref|XP_009881170.1|  PREDICTED: protein SEC13 homolog                   151   7e-41   
ref|XP_007251556.1|  PREDICTED: protein SEC13 homolog                   151   7e-41   
ref|XP_003785488.1|  PREDICTED: protein SEC13 homolog isoform 2         151   7e-41   
ref|XP_002187493.1|  PREDICTED: protein SEC13 homolog                   152   7e-41   
gb|KFP72681.1|  Protein SEC13                                           151   8e-41   
ref|XP_006902250.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_009925138.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   8e-41   
ref|XP_009080512.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_009490110.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_008057837.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_005490235.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_008632704.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_009318389.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
gb|EDK99502.1|  SEC13-like 1 (S. cerevisiae), isoform CRA_b             151   8e-41   
ref|XP_009946398.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
gb|EMS20580.1|  vesicle budding-related protein, protein transpor...    151   8e-41   
ref|XP_004559093.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_009282024.1|  PREDICTED: protein SEC13 homolog                   151   8e-41   
ref|XP_009816902.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   9e-41   
ref|XP_009679424.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   9e-41   
ref|XP_005413135.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_003265017.1|  PREDICTED: protein SEC13 homolog                   152   9e-41   
ref|XP_009577357.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_009963519.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   9e-41   
ref|XP_004901951.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_004368382.1|  PREDICTED: protein SEC13 homolog isoform 1         151   9e-41   
gb|ELK07876.1|  Protein SEC13 like protein                              153   9e-41   
ref|XP_005797173.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_008853099.1|  PREDICTED: protein SEC13 homolog isoform X1        151   9e-41   
ref|XP_006900603.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_004443648.1|  PREDICTED: protein SEC13 homolog isoform 1         151   9e-41   
ref|NP_077168.2|  protein SEC13 homolog                                 151   9e-41   
ref|XP_010281426.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_010617575.1|  PREDICTED: protein SEC13 homolog                   151   9e-41   
ref|XP_001662344.1|  AAEL012240-PA                                      152   9e-41   
ref|XP_004452753.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
ref|XP_003867590.1|  Sec13 protein transport factor                     150   1e-40   
ref|XP_008150256.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
ref|XP_002548300.1|  protein transport protein SEC13                    150   1e-40   
ref|XP_010951346.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
ref|XP_006994752.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
ref|XP_010588271.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
ref|XP_004392737.1|  PREDICTED: protein SEC13 homolog isoform 1         151   1e-40   
ref|XP_003982518.1|  PREDICTED: protein SEC13 homolog                   151   1e-40   
gb|AAH02128.1|  Sec13 protein                                           151   1e-40   
ref|XP_850437.1|  PREDICTED: protein SEC13 homolog isoformX1            150   1e-40   
ref|NP_001006979.1|  protein SEC13 homolog                              150   1e-40   
ref|XP_006083906.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_002925064.1|  PREDICTED: protein SEC13 homolog isoform X1        150   1e-40   
ref|XP_010300088.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   1e-40   
ref|XP_010862020.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_003785487.1|  PREDICTED: protein SEC13 homolog isoform 1         150   1e-40   
ref|XP_005365083.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_004368383.1|  PREDICTED: protein SEC13 homolog isoform 2         150   1e-40   
ref|XP_005333860.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_007075531.1|  PREDICTED: protein SEC13 homolog isoform X1        150   1e-40   
ref|XP_009468260.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    151   1e-40   
ref|XP_007569682.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
gb|KDQ26882.1|  hypothetical protein PLEOSDRAFT_1105781                 151   1e-40   
ref|XP_005997883.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_005696117.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
emb|CEG77402.1|  Putative WD40 repeat-like protein                      150   1e-40   
ref|XP_004651480.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_004274879.1|  PREDICTED: protein SEC13 homolog isoform 2         150   1e-40   
ref|XP_004738581.1|  PREDICTED: protein SEC13 homolog isoform X1        151   1e-40   
ref|XP_004274878.1|  PREDICTED: protein SEC13 homolog isoform 1         150   1e-40   
ref|XP_004018574.1|  PREDICTED: protein SEC13 homolog                   150   1e-40   
ref|XP_011398741.1|  SEC13-like protein                                 149   1e-40   
ref|XP_969127.1|  PREDICTED: protein SEC13 homolog                      150   1e-40   
ref|XP_010983235.1|  PREDICTED: protein SEC13 homolog                   151   2e-40   
ref|XP_006077544.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
ref|NP_001069033.1|  protein SEC13 homolog                              150   2e-40   
gb|KIK45891.1|  hypothetical protein CY34DRAFT_801043                   150   2e-40   
dbj|BAB26480.1|  unnamed protein product                                150   2e-40   
ref|NP_001267197.1|  protein SEC13 homolog                              150   2e-40   
ref|XP_004625281.1|  PREDICTED: protein SEC13 homolog                   151   2e-40   
gb|ELR56129.1|  Protein SEC13-like protein                              150   2e-40   
ref|XP_005896173.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
ref|XP_008587479.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
dbj|GAC98825.1|  hypothetical protein PHSY_006420                       152   2e-40   
gb|EPQ10095.1|  Protein SEC13 like protein                              151   2e-40   
gb|ETS60765.1|  hypothetical protein PaG_04673                          150   2e-40   
ref|XP_007983411.1|  PREDICTED: protein SEC13 homolog isoform X2        150   2e-40   
ref|NP_109598.2|  protein SEC13 homolog isoform 4                       150   2e-40   
ref|XP_461910.1|  DEHA2G08338p                                          149   2e-40   
ref|XP_005956736.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
emb|CEG81796.1|  Putative WD40 repeat-like protein                      150   2e-40   
ref|XP_011388583.1|  putative protein transport protein                 151   2e-40   
ref|XP_003976966.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
ref|XP_007423317.1|  PREDICTED: protein SEC13 homolog                   150   2e-40   
ref|XP_010375603.1|  PREDICTED: protein SEC13 homolog                   149   3e-40   
ref|XP_001742270.1|  hypothetical protein                               149   3e-40   
ref|XP_006152053.1|  PREDICTED: protein SEC13 homolog                   150   3e-40   
ref|NP_899195.1|  protein SEC13 homolog isoform 1                       150   3e-40   
ref|XP_007305823.1|  vesicle budding-like protein                       150   3e-40   
pdb|3BG0|A  Chain A, Architecture Of A Coat For The Nuclear Pore ...    149   3e-40   
ref|XP_003826328.1|  PREDICTED: protein SEC13 homolog isoform X2        150   3e-40   
ref|XP_007868434.1|  WD40 repeat-like protein                           150   3e-40   
ref|XP_009044725.1|  hypothetical protein LOTGIDRAFT_207505             149   3e-40   
ref|XP_003927110.1|  PREDICTED: protein SEC13 homolog                   149   3e-40   
ref|NP_001253899.1|  protein SEC13 homolog                              149   3e-40   
ref|XP_007983412.1|  PREDICTED: protein SEC13 homolog isoform X3        149   3e-40   
ref|XP_010745417.1|  PREDICTED: protein SEC13 homolog                   149   3e-40   
dbj|BAD96739.1|  SEC13-like 1 isoform b variant                         149   3e-40   
ref|XP_001509095.2|  PREDICTED: protein SEC13 homolog                   149   3e-40   
ref|XP_004581358.1|  PREDICTED: protein SEC13 homolog                   149   3e-40   
dbj|BAD92791.1|  SEC13-like 1 isoform b variant                         149   3e-40   
ref|XP_008303874.1|  PREDICTED: protein SEC13 homolog                   149   3e-40   
gb|ADO28267.1|  sec13-like                                              149   3e-40   
emb|CEP62572.1|  LALA0S05e08614g1_1                                     149   3e-40   
ref|XP_007376323.1|  protein transport protein SEC13                    149   3e-40   
gb|ETE71337.1|  Protein SEC13-like protein                              149   3e-40   
ref|NP_001187522.1|  protein SEC13 homolog                              149   3e-40   
ref|XP_003685521.1|  hypothetical protein TPHA_0D04530                  149   3e-40   
dbj|GAK64138.1|  vesicle budding-like protein                           150   4e-40   
ref|NP_998500.1|  protein SEC13 homolog                                 149   4e-40   
ref|XP_003224930.2|  PREDICTED: protein SEC13 homolog                   150   4e-40   
ref|XP_002962084.1|  hypothetical protein SELMODRAFT_76631              149   4e-40   
emb|CCW62673.1|  unnamed protein product                                149   4e-40   
ref|XP_009236976.1|  PREDICTED: protein SEC13 homolog isoform X1        150   5e-40   
ref|XP_007409327.1|  hypothetical protein MELLADRAFT_43221              149   5e-40   
ref|XP_007888672.1|  PREDICTED: protein SEC13 homolog                   149   5e-40   
ref|XP_008479694.1|  PREDICTED: protein SEC13 homolog isoform X2        149   5e-40   
ref|XP_002509166.1|  predicted protein                                  148   5e-40   
ref|XP_006684558.1|  protein transport protein SEC13                    148   6e-40   
gb|KDE08446.1|  hypothetical protein MVLG_01228                         156   6e-40   
ref|XP_006872266.1|  PREDICTED: protein SEC13 homolog                   148   6e-40   
ref|XP_008479693.1|  PREDICTED: protein SEC13 homolog isoform X1        149   6e-40   
ref|NP_001134240.1|  protein SEC13 homolog                              147   7e-40   
emb|CAF89860.1|  unnamed protein product                                149   7e-40   
ref|XP_001838138.2|  protein transporter SEC13                          149   7e-40   
gb|KIY73878.1|  WD40 repeat-like protein                                149   7e-40   
ref|XP_003686204.1|  hypothetical protein TPHA_0F02890                  148   7e-40   
gb|KIJ53339.1|  hypothetical protein M422DRAFT_202256                   149   7e-40   
ref|XP_001357877.2|  GA19854                                            149   8e-40   
ref|XP_003195851.1|  vesicle budding-related protein                    149   8e-40   
gb|KII90409.1|  hypothetical protein PLICRDRAFT_38938                   149   8e-40   
ref|XP_007269359.1|  WD40 repeat-like protein                           149   9e-40   
ref|XP_008248147.1|  PREDICTED: protein SEC13 homolog                   148   9e-40   
ref|XP_006457176.1|  hypothetical protein AGABI2DRAFT_196016            149   9e-40   
ref|XP_007874241.1|  hypothetical protein PNEG_02252                    147   1e-39   
ref|XP_003677730.1|  hypothetical protein NCAS_0H00700                  147   1e-39   
ref|XP_002813484.1|  PREDICTED: protein SEC13 homolog isoform X2        148   1e-39   
gb|EPZ32794.1|  hypothetical protein O9G_000869                         147   1e-39   
ref|XP_007388233.1|  protein transporter SEC13                          148   1e-39   
ref|XP_001998472.1|  moj137                                             149   1e-39   
emb|CEJ94197.1|  Putative Protein transport protein sec-13              147   1e-39   
emb|CDQ92083.1|  unnamed protein product                                148   1e-39   
ref|XP_003320453.1|  hypothetical protein PGTG_01365                    148   2e-39   
ref|XP_002098417.1|  GE10367                                            148   2e-39   
ref|XP_004692285.1|  PREDICTED: protein SEC13 homolog                   149   2e-39   
gb|AAD46849.2|AF160909_1  LD03471p                                      149   2e-39   
ref|XP_001982150.1|  GG11201                                            148   2e-39   
gb|ERE66933.1|  plasma membrane calcium-transporting ATPase 2 iso...    155   2e-39   
ref|XP_002032337.1|  GM26501                                            148   2e-39   
gb|ELU04892.1|  hypothetical protein CAPTEDRAFT_149284                  147   2e-39   
ref|NP_651977.1|  Sec13 ortholog, isoform A                             148   2e-39   
emb|CDH10636.1|  Protein transport protein SEC13                        147   2e-39   
gb|ETN66954.1|  transport protein SEC13                                 147   2e-39   
ref|XP_002052974.1|  GJ23624                                            148   2e-39   
gb|ERE66934.1|  plasma membrane calcium-transporting ATPase 2 iso...    154   2e-39   
gb|ERE66932.1|  plasma membrane calcium-transporting ATPase 2 iso...    154   2e-39   
ref|XP_002971002.1|  hypothetical protein SELMODRAFT_94917              147   2e-39   
gb|ENH69635.1|  Protein transport protein sec-13                        147   2e-39   
ref|XP_448090.1|  hypothetical protein                                  147   2e-39   
emb|CCT65135.1|  probable SEC13-protein transport protein               147   2e-39   
ref|XP_002813485.1|  PREDICTED: protein SEC13 homolog isoform X3        147   2e-39   
emb|CDF91246.1|  ZYBA0S10-02982g1_1                                     147   2e-39   



>emb|CDP02169.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+DTVHDVSMDYYGKRVATASSD++IK+IGVSNN+TSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVSMDYYGKRVATASSDSTIKVIGVSNNNTSQHLATLSGHQGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DGKVI+WKEGNQNEW+QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSLLASCSYDGKVIIWKEGNQNEWSQAHVFSDHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>dbj|BAO49717.1| nuclear pore complex protein Sec13c [Nicotiana benthamiana]
Length=302

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAH+F+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHIFSDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_009623350.1| PREDICTED: protein SEC13 homolog [Nicotiana tomentosiformis]
Length=302

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  121  ACGSSDGCISV  131



>ref|NP_001275312.1| protein transport SEC13-like protein [Solanum tuberosum]
 gb|ABC01897.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=303

 Score =   249 bits (635),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+DTVHDV+MDYYGKRVATASSD +IKI GVSNN+TSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVTMDYYGKRVATASSDTTIKITGVSNNATSQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF++HKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSEHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_009764554.1| PREDICTED: protein SEC13 homolog [Nicotiana sylvestris]
Length=302

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF+DH SSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFSDHISSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_011098538.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=302

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDV+MDYYGKRVATASSDA+IKIIG+SNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDVVHDVAMDYYGKRVATASSDATIKIIGISNNSTSQHLATLSGHQGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS LASCS+DGKVI+WKEGNQNEW+Q  VF DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSALASCSYDGKVIIWKEGNQNEWSQFQVFTDHKSSVNSIAWAPHELGFCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>gb|EYU44682.1| hypothetical protein MIMGU_mgv1a010776mg [Erythranthe guttata]
Length=302

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGHS+ VHDV+MDYYGKRVATASSDA+IKIIGV NNSTSQHLATL GH GPVW
Sbjct  1    MPAQKIETGHSNVVHDVAMDYYGKRVATASSDATIKIIGVGNNSTSQHLATLTGHQGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQ EW+Q HVF+DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVIIWKEGNQKEWSQFHVFSDHKSSVNSIAWAPHELGFCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_004232260.1| PREDICTED: protein transport protein SEC13 homolog B [Solanum 
lycopersicum]
Length=302

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+DTVHDV+MDYYGKRVATASSD +IKI GVSNN+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVTMDYYGKRVATASSDTTIKITGVSNNAASQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q  WAHPKFGS+LASCS+DGKVI+WKEGNQNEW QAHVF++HKSSVNSISWAPHELGLCL
Sbjct  61   QAGWAHPKFGSILASCSYDGKVIIWKEGNQNEWAQAHVFSEHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>dbj|BAO49718.1| nuclear pore complex protein Sec13d [Nicotiana benthamiana]
Length=302

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDV+MDYYGKRVATASSD +IKI GVS N+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVTMDYYGKRVATASSDTTIKITGVSYNAASQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSMLASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>dbj|BAO49715.1| nuclear pore complex protein Sec13a [Nicotiana benthamiana]
Length=302

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDV+MDYYGKRVATASSD +IKI GVS N+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVTMDYYGKRVATASSDTTIKITGVSYNAASQHLATLSGHTGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_002281856.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CAN73348.1| hypothetical protein VITISV_040760 [Vitis vinifera]
Length=301

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKRVATASSD +IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRVATASSDTTIKIIGVSNNA-SQHLATLIGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSILASCSYDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KDP43859.1| hypothetical protein JCGZ_20869 [Jatropha curcas]
Length=301

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGVSNN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRIATASSDHSIKIIGVSNN-TSQHLAQLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHEIGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_009759579.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759644.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759712.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759764.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759824.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759881.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759950.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
Length=302

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+DTVHDVSMDYY KR+ATASSD +IKI+GV +NS SQHLA+L+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVSMDYYRKRMATASSDNTIKIVGVGDNSASQHLASLSGHSGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            AC SSDGNISV
Sbjct  121  ACASSDGNISV  131



>ref|XP_002265971.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
Length=301

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_010033246.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033247.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033248.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 gb|KCW52833.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
 gb|KCW52834.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=302

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDV+MDYYGKRVATASSD +IKIIGVSN+S SQHLA+L+GH GPVW
Sbjct  1    MPSQKIETGHQDIVHDVAMDYYGKRVATASSDTTIKIIGVSNSSGSQHLASLSGHKGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+W QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGQVILWKEGNQNDWAQAHVFNDHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>gb|KHM99531.1| Protein SEC13 like, partial [Glycine soja]
Length=358

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 1/133 (1%)
 Frame = +1

Query  142  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP  321
            G MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GP
Sbjct  74   GNMPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGP  132

Query  322  VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL  501
            VWQV WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGL
Sbjct  133  VWQVVWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGL  192

Query  502  CLACGSSDGNISV  540
            CLACGSSDGNISV
Sbjct  193  CLACGSSDGNISV  205



>ref|XP_008380946.1| PREDICTED: protein transport protein SEC13-like [Malus domestica]
Length=335

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 1/132 (1%)
 Frame = +1

Query  145  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  324
            +MPAQK+ETGH DTVHDV MDYYGKR+ATASSD +IKIIGVSN S+SQHLATL GH GPV
Sbjct  34   EMPAQKVETGHQDTVHDVVMDYYGKRLATASSDNTIKIIGVSN-SSSQHLATLTGHQGPV  92

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            WQV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLC
Sbjct  93   WQVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLC  152

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  153  LACGSSDGNISV  164



>ref|XP_003551869.1| PREDICTED: protein SEC13 homolog [Glycine max]
 gb|KHN12525.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFGSLLASCSFDG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSFDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_011021702.1| PREDICTED: protein transport protein SEC13 homolog B-like [Populus 
euphratica]
Length=301

 Score =   241 bits (615),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKI+GV+NNS SQHLA L GHHGPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIVGVNNNS-SQHLANLTGHHGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+W QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWIQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>emb|CAN81348.1| hypothetical protein VITISV_021485 [Vitis vinifera]
Length=301

 Score =   241 bits (615),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_011085795.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH+D VHDVSMDYYGKRVATASSDA+IKIIGV NNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDVVHDVSMDYYGKRVATASSDATIKIIGVGNNSTSQHLATLSGHQGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS LASCS+DGKVI+WKEGNQNEW+Q  VF DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSALASCSYDGKVIIWKEGNQNEWSQFQVF-DHKSSVNSIAWAPHELGFCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KHN12541.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|ACU20139.1| unknown [Glycine max]
Length=301

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KHM99522.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_007145729.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
 gb|ESW17723.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
Length=301

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGV NN+ SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGV-NNTASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCSFDG+VI+WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSFDGRVIIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGN+SV
Sbjct  120  ACGSSDGNVSV  130



>ref|XP_006586096.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006586097.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KCW52832.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=310

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDV+MDYYGKRVATASSD +IKIIGVSN+S SQHLA+L+GH GPVW
Sbjct  1    MPSQKIETGHQDIVHDVAMDYYGKRVATASSDTTIKIIGVSNSSGSQHLASLSGHKGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+W QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGQVILWKEGNQNDWAQAHVFNDHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_011072420.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
 ref|XP_011072421.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
Length=301

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDVVHDVAMDYYGKRLATASSDNTIKIIGVSN-SGSQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DGKV++WKEGNQNEWTQAHVF+DHK+SVNSISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVVIWKEGNQNEWTQAHVFDDHKASVNSISWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_010094976.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB57735.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVH ++MDYYGKR+ATASSDA+IKIIGVSNNS SQHLATL+GH GPVW
Sbjct  1    MPPQKIETGHQDTVHGIAMDYYGKRLATASSDATIKIIGVSNNSGSQHLATLSGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V WAHPKFGS+LASCS+DG+VI+WKEGNQNEW QAHVFNDHKSSVNSI WAPHELGL L
Sbjct  61   EVVWAHPKFGSILASCSYDGQVIIWKEGNQNEWQQAHVFNDHKSSVNSIDWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_010267185.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
 ref|XP_010267187.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=301

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV MDYYGKR+ATASSD +IKIIGVS  S SQHLATL+GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVVMDYYGKRLATASSDTTIKIIGVST-SASQHLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF+DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGRVIIWKEGNQNEWTQAHVFDDHKASVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KHG11308.1| Protein SEC13 [Gossypium arboreum]
Length=314

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 1/134 (1%)
 Frame = +1

Query  139  EGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG  318
            +G+MP+QKIETGH DTVHDV+MD+YGKR+ATASSD++IKI GVSNN T QHLATL GH G
Sbjct  11   KGEMPSQKIETGHQDTVHDVAMDFYGKRIATASSDSTIKIAGVSNN-THQHLATLTGHQG  69

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVWQV+WAHPKFGSLLASC +DG+VI+WKEGNQNEW QAHVF+DHKSSVNSI+WAPHELG
Sbjct  70   PVWQVAWAHPKFGSLLASCCYDGRVILWKEGNQNEWAQAHVFDDHKSSVNSIAWAPHELG  129

Query  499  LCLACGSSDGNISV  540
            LCLACGSSDGNISV
Sbjct  130  LCLACGSSDGNISV  143



>ref|XP_003551800.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006602184.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++W PHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWVPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|AGV54445.1| protein transport SEC13-like protein [Phaseolus vulgaris]
Length=301

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGV NN+ SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGV-NNTASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVIIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_010099520.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB79400.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DT H ++MDYYGKR+ATASSDA+IKIIGVSNNS SQHLATL+GH GPVW
Sbjct  1    MPPQKIETGHQDTAHGIAMDYYGKRLATASSDATIKIIGVSNNSGSQHLATLSGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQNEW QAHVFNDHKSSVNSI WAPHELGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVIIWKEGNQNEWQQAHVFNDHKSSVNSIDWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_003532149.2| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
Length=375

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  75   MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  133

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  134  QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  193

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  194  ACGSSDGNISV  204



>gb|KJB45573.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
 gb|KJB45574.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
Length=301

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MD+YGKR+ATASSD++IKI+GVSNN T QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDFYGKRIATASSDSTIKIVGVSNN-THQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASC +DG+VI+WKEGNQNEW QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCCYDGRVIIWKEGNQNEWAQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_006586103.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=376

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  76   MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  134

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  135  QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  194

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  195  ACGSSDGNISV  205



>ref|XP_006410056.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51509.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=383

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +1

Query  109  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ  288
            D  F R S   G MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQ
Sbjct  70   DRAFSRES-HSGNMPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQ  128

Query  289  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN  468
            HLATL GH GPVW+V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVN
Sbjct  129  HLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVN  188

Query  469  SISWAPHELGLCLACGSSDGNISV  540
            SI+WAPHELGL LACGSSDGNISV
Sbjct  189  SIAWAPHELGLSLACGSSDGNISV  212



>ref|XP_010550097.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550098.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550099.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
Length=302

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH DTVHDV MDYYGKR+A+ASSD +IKIIGVSN+  SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVQMDYYGKRIASASSDCTIKIIGVSNSGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF +HKSSVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNEWTQAHVFTEHKSSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_002315836.1| transport protein SEC13 [Populus trichocarpa]
 gb|ABK92752.1| unknown [Populus trichocarpa]
 gb|ABK93029.1| unknown [Populus trichocarpa]
 gb|EEF02007.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKI+GV+NNS SQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIVGVNNNS-SQHLANLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+W QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWIQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_006410057.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51510.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=384

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  109  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ  288
            D  F       G MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQ
Sbjct  70   DRAFSSRESHSGNMPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQ  129

Query  289  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN  468
            HLATL GH GPVW+V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVN
Sbjct  130  HLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVN  189

Query  469  SISWAPHELGLCLACGSSDGNISV  540
            SI+WAPHELGL LACGSSDGNISV
Sbjct  190  SIAWAPHELGLSLACGSSDGNISV  213



>dbj|BAJ10727.1| SEC13 family protein [Lotus japonicus]
 gb|AFK45896.1| unknown [Lotus japonicus]
Length=301

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATLAGH GPVW
Sbjct  1    MPAQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLAGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS++ASCS+DG+VI+WKEGNQNEW QAHVF+DHKSSVNS+ WAPHELGLCL
Sbjct  60   QVAWAHPKFGSMIASCSYDGRVIIWKEGNQNEWIQAHVFDDHKSSVNSVVWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_008462440.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKI++GH DTVHDVSMDYYGKR+AT SSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKIDSGHQDTVHDVSMDYYGKRLATVSSDQTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q +WAHPKFGSLLASCS+DG+VI+WKEGNQNEW+QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QAAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWSQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>emb|CAN79974.1| hypothetical protein VITISV_009154 [Vitis vinifera]
Length=312

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHL+TL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLSTLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSHDGRVIIWKEGNQNDWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>emb|CAN80755.1| hypothetical protein VITISV_027966 [Vitis vinifera]
Length=301

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD+++KIIGVSNN+ S HLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTVKIIGVSNNA-SLHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSHDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|ACU18089.1| unknown [Glycine max]
Length=301

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+ IVWKEGNQNEWTQAHVF+DHKSSVNS++W PHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRAIVWKEGNQNEWTQAHVFDDHKSSVNSVAWVPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_004302867.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=300

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  120  ACGSSDGTISV  130



>ref|XP_002321555.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374503.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374504.1| transport protein SEC13 [Populus trichocarpa]
 gb|EEF05682.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52300.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52301.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV+NN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIIGVNNN-TSQHLANLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_006446433.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|ESR59673.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|KDO66291.1| hypothetical protein CISIN_1g022111mg [Citrus sinensis]
Length=302

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH DTVHDV+MD+YGKR+ATASSD+SIKIIG+SN S SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSN-SASQHLATLKGHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAH FNDHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_006470402.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=302

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH DTVHDV+MD+YGKR+ATASSD+SIKIIG+SN S SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSN-SASQHLATLKGHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAH FNDHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>emb|CAN63472.1| hypothetical protein VITISV_000787 [Vitis vinifera]
Length=313

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++ KIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTXKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNDWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_011466663.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=313

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  120  ACGSSDGTISV  130



>ref|XP_002266827.2| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CBI39765.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD+++KIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTVKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+D KSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNDWTQAHVFSDRKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_009603401.1| PREDICTED: protein transport protein SEC13-like [Nicotiana tomentosiformis]
Length=183

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M  QKIETGH+D VHDVSMDYYGKR+AT+SSD +IKI+GVSNNS SQHLATL+GH G VW
Sbjct  1    MHVQKIETGHNDIVHDVSMDYYGKRMATSSSDMTIKIVGVSNNSASQHLATLSGHTGHVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+W HPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWTHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFGDHKSSVNSISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
             CGSSDG+ISV
Sbjct  121  GCGSSDGSISV  131



>ref|XP_011466664.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=312

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  120  ACGSSDGTISV  130



>ref|XP_004141658.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004155955.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN45591.1| hypothetical protein Csa_7G452950 [Cucumis sativus]
Length=301

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPA KI++GH DTVHDVSMDYYGKR+AT SSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPALKIDSGHQDTVHDVSMDYYGKRLATVSSDQTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q +WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QAAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_011028666.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028667.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028668.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028669.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
Length=301

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV MDYYGKR+ATASSD SIKIIGV+NN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVVMDYYGKRIATASSDHSIKIIGVNNN-TSQHLANLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_011080528.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080536.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080543.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080551.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080561.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080569.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080578.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080587.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080595.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDIVHDVAMDYYGKRLATASSDNAIKIIGVSN-SRSQHLATLTGHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DGKV++WKEGNQNEW QAHVF+DHK+SVN ISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVVIWKEGNQNEWIQAHVFDDHKASVNCISWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGS+DGNISV
Sbjct  120  ACGSTDGNISV  130



>gb|AFK36737.1| unknown [Lotus japonicus]
Length=212

 Score =   233 bits (595),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVS  + SQHLATL GH GPVW
Sbjct  1    MPGQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSI-AASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_007144311.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
 gb|ESW16305.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
Length=301

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSNTA-SQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFGSLLASCS+DG+V +WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVTIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_007024275.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY26897.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=312

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV+MDYYGKR+A+ASSD +IKI GVSNN T QHLATL+ H GPVW
Sbjct  1    MPPQKIETGHQDTVHDVAMDYYGKRIASASSDTTIKIAGVSNN-THQHLATLSAHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW+QAHVF DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWSQAHVFEDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_004150601.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004171462.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN58046.1| hypothetical protein Csa_3G462670 [Cucumis sativus]
Length=301

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DT+HDV+MDYYGKRVA+ASSD +IKI GVSN++T QHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDTIHDVAMDYYGKRVASASSDQTIKITGVSNSAT-QHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFG LLASCS+DG+VI+WKEGNQNEW+QAH+F+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGPLLASCSYDGRVIIWKEGNQNEWSQAHIFDDHKSSVNSIAWAPHEVGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|AAM65185.1| transport protein SEC13, putative [Arabidopsis thaliana]
Length=301

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|NP_186783.1| transport protein SEC13B [Arabidopsis thaliana]
 ref|NP_001030616.1| transport protein SEC13B [Arabidopsis thaliana]
 sp|Q9SRI1.1|SC13A_ARATH RecName: Full=Protein transport protein SEC13 homolog A; AltName: 
Full=SEC13-like protein A [Arabidopsis thaliana]
 gb|AAF03492.1|AC010676_2 putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAK44077.1|AF370262_1 putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AAL34253.1| putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AEE73651.1| transport protein SEC13B [Arabidopsis thaliana]
 gb|AEE73652.1| transport protein SEC13B [Arabidopsis thaliana]
Length=302

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_010272104.1| PREDICTED: protein transport protein SEC13 homolog B [Nelumbo 
nucifera]
Length=301

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD++IKIIGV  +S SQ LATL+GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRLATASSDSTIKIIGV-GSSGSQDLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQA +F DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAQIFTDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_010551882.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551884.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551885.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551886.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=301

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D VHDV MDYYGKRVATASSD +IKI GV N++ SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVGNSAGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKE NQNEWTQAHVF +HKSSVNSISWAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVIIWKEDNQNEWTQAHVFTEHKSSVNSISWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>emb|CDP21792.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQ LATL+GH GPVW
Sbjct  1    MPGQKIETGHQDTVHDVAMDYYGKRLATASSDNTIKIIGVSN-SNSQPLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSL+ASCS+DGKVI+W+EGNQNEW+QAH+F DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLVASCSYDGKVIIWREGNQNEWSQAHLFGDHKASVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNIS+
Sbjct  120  ACGSSDGNISI  130



>ref|XP_002515980.1| protein transport protein sec13, putative [Ricinus communis]
 gb|EEF46400.1| protein transport protein sec13, putative [Ricinus communis]
Length=301

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DT+HDV MDYYGKR+ATASSD SIKIIGVSNN TSQ LA L GH GPVW
Sbjct  1    MPPQKIETGHEDTIHDVVMDYYGKRIATASSDHSIKIIGVSNN-TSQQLAKLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEG QN+WTQAHVF+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGVQNDWTQAHVFDDHKSSVNSIAWAPHEVGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_007215469.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
 gb|EMJ16668.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
Length=408

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +1

Query  145  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  324
            +MPAQK+ETGH DT+HDV MDYYGKR+AT S+D ++KIIGVSN S SQHLATL GH GPV
Sbjct  107  EMPAQKVETGHQDTIHDVVMDYYGKRLATGSADNTVKIIGVSN-SASQHLATLTGHQGPV  165

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            WQV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAH+F+DHKSSVNSI+WAPHELGLC
Sbjct  166  WQVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWIQAHIFDDHKSSVNSIAWAPHELGLC  225

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  226  LACGSSDGNISV  237



>ref|XP_010524317.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=302

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D VHDV MDYYGKRVATASSD +IKIIGV+++  SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKIIGVNSSGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+V +WKEGNQNEWTQAHVF +HKSSVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVTIWKEGNQNEWTQAHVFTEHKSSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>emb|CDY24035.1| BnaC03g16560D [Brassica napus]
Length=301

 Score =   233 bits (594),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSFLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>emb|CDX84863.1| BnaA03g13670D [Brassica napus]
Length=301

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSFLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>dbj|BAJ10728.1| SEC13 family protein [Lotus japonicus]
Length=301

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVS  + SQHLATL GH GPVW
Sbjct  1    MPGQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSI-AASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEG+QNEWTQAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGDQNEWTQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_008379297.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008379298.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008348048.1| PREDICTED: protein SEC13 homolog [Malus domestica]
Length=300

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 2/131 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH DTVHDV+MDYYGKR+ATASSDA+IKIIGV N   SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDTVHDVAMDYYGKRLATASSDATIKIIGVGN--ASQHLATLSAHSGPVW  58

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSISWAPHELGL L
Sbjct  59   EVAWAHPKFGSILASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLIL  118

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  119  ACGSSDGNISV  129



>gb|KEH33918.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=301

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH D +HDVSMDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDIIHDVSMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   EVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWIQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            AC SSDGNISV
Sbjct  120  ACASSDGNISV  130



>ref|XP_006294683.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
 gb|EOA27581.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
Length=302

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDTVHDVQMDYYGKRIATASSDCTIKITGVNNNGGSQPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_009335780.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
 ref|XP_009335781.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
Length=300

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 2/131 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH DTVHDV+MDYYGKR+ATASSDA+IKIIGV N   SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDTVHDVAMDYYGKRLATASSDATIKIIGVGN--ASQHLATLSVHSGPVW  58

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSISWAPHELGL L
Sbjct  59   EVAWAHPKFGSILASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLIL  118

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  119  ACGSSDGNISV  129



>ref|XP_004512728.1| PREDICTED: protein SEC13 homolog isoform X1 [Cicer arietinum]
 ref|XP_004512729.1| PREDICTED: protein SEC13 homolog isoform X2 [Cicer arietinum]
Length=301

 Score =   231 bits (589),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQ LATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQPLATLTGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   EVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWVQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            AC SSDGNIS+
Sbjct  120  ACASSDGNISI  130



>ref|XP_006408491.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
 gb|ESQ49944.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
Length=302

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSD VHDV MDYYGKRVATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQNEWT AHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIIIWKEGNQNEWTLAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_010687899.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687900.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IK++ VS+NS SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHSDVVHDVQMDYYGKRIATASSDTTIKVLAVSSNSGSQPLATLTGHQGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN W QAHVF++HKSSVN+ISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGRVIIWKEGNQNVWEQAHVFHEHKSSVNAISWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_007215747.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
 gb|EMJ16946.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
Length=300

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 120/131 (92%), Gaps = 2/131 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV   S SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDIVHDVAMDYYGKRLATASSDATIKIIGV--GSGSQHLATLSAHRGPVW  58

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGSLLASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSI+WAPHELGL L
Sbjct  59   EVAWAHPKFGSLLASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSIAWAPHELGLSL  118

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  119  ACGSSDGNISV  129



>ref|XP_008230683.1| PREDICTED: protein SEC13 homolog [Prunus mume]
Length=300

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 120/131 (92%), Gaps = 2/131 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV   S SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDIVHDVAMDYYGKRLATASSDATIKIIGV--GSGSQHLATLSAHRGPVW  58

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGSLLASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSI+WAPHELGL L
Sbjct  59   EVAWAHPKFGSLLASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSIAWAPHELGLSL  118

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  119  ACGSSDGNISV  129



>ref|XP_010510416.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=302

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVTNNGGSQPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_010414320.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=354

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 128/160 (80%), Gaps = 8/160 (5%)
 Frame = +1

Query  85   RLHSLFQGDH---TFIRSSDKEGK-----MPAQKIETGHSDTVHDVSMDYYGKRVATASS  240
            R+  L    H   +  RS+   GK     MP QKIETGH D VHDV MDYYGKR+ATASS
Sbjct  24   RVDPLLLRTHIASSLTRSAVISGKIILENMPGQKIETGHEDIVHDVQMDYYGKRIATASS  83

Query  241  DASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN  420
            D +IKI GV+NN  SQ LATL GH GPVW+V+WAHPKFGS+LASCS+DG+VI+WKEGNQN
Sbjct  84   DCTIKITGVTNNGGSQPLATLTGHRGPVWEVAWAHPKFGSILASCSYDGQVILWKEGNQN  143

Query  421  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            +WTQAHVF DHKSSVNSI+WAPH+LGL LACGSSDGNISV
Sbjct  144  QWTQAHVFTDHKSSVNSIAWAPHDLGLSLACGSSDGNISV  183



>ref|XP_010469902.1| PREDICTED: protein transport protein SEC13 homolog B [Camelina 
sativa]
Length=302

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVNNNGGSQPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>emb|CDY02025.1| BnaC04g14760D [Brassica napus]
Length=303

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN   SQHLATL GH GPV
Sbjct  1    MPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGGSQHLATLTGHRGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHK+SVNSI+WAP+ELGL 
Sbjct  61   WEVAWAHPKFGSMLASCSYDGQVILWKEGSQNQWTQAHVFTDHKTSVNSIAWAPYELGLS  120

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  121  LACGSSDGNISV  132


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 16/134 (12%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  327
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  165  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  215

Query  328  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
             V+WA P  G   S +AS S DGKV++W  G + E  +  V ND K+ V  +SW+    G
Sbjct  216  GVAWA-PNLGLPKSTIASGSQDGKVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWS--LTG  272

Query  499  LCLACGSSDGNISV  540
              LA    + N++V
Sbjct  273  NLLAVSDGNNNVTV  286



>gb|EYU21504.1| hypothetical protein MIMGU_mgv1a010808mg [Erythranthe guttata]
Length=301

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGV+  S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDIVHDVTMDYYGKRLATASSDNTIKIIGVTT-SNSQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DGKVI+WKEGN NEW+QAH+F DHK+SVNSISWAPHE+GL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVIIWKEGNPNEWSQAHIFEDHKASVNSISWAPHEVGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>dbj|BAO49716.1| nuclear pore complex protein Sec13b [Nicotiana benthamiana]
Length=301

 Score =   228 bits (581),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +I+I GVS+ S+SQ LATL+GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIRITGVSS-SSSQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ AHVF+DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLAHVFDDHKASVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_006298213.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
 gb|EOA31111.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
Length=302

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI  V+N+   QHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITEVNNSGGPQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_002879246.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55505.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+W+E NQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSMLASCSYDGQVILWEEANQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>gb|KDO51761.1| hypothetical protein CISIN_1g036510mg, partial [Citrus sinensis]
Length=288

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>emb|CDY37530.1| BnaA05g33950D [Brassica napus]
Length=302

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPK+ SLLASCS+DG++I+WKEGNQNEWTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNQNEWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_006426897.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
 gb|ESR40137.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
Length=301

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|AAM65095.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
Length=302

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct  61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_006465678.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=301

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|NP_180566.1| transport protein SEC13A [Arabidopsis thaliana]
 sp|O64740.1|SC13B_ARATH RecName: Full=Protein transport protein SEC13 homolog B; AltName: 
Full=SEC13-like protein B [Arabidopsis thaliana]
 gb|AAL06565.1|AF412112_1 At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AAC16967.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM14986.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM70557.1| At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AEC08339.1| transport protein SEC13A [Arabidopsis thaliana]
Length=302

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct  61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131



>ref|XP_010500953.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI GV+N+S SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSQPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+W QAH F DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWAQAHFFTDHKVSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 7/111 (6%)
 Frame = +1

Query  220  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  387
            ++A+   D+++K+   SN S        L+ H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDRVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  388  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            KVI+W  G + E  +  V  D +++V  +SW+    G  LA    + N++V
Sbjct  237  KVIIWTTGKEGEQWEGKVLKDFETTVWRVSWS--LTGNLLAVSYGNNNVTV  285



>gb|KJB40797.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
 gb|KJB40798.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
Length=301

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D +HDV+MDYYGKR+ATASSD +IKIIG++  S+SQ LA L GH GPVW
Sbjct  1    MPAQKIETGHEDALHDVAMDYYGKRLATASSDTTIKIIGITG-SSSQQLAVLHGHKGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
             V+WAHPKFGS+LASCS+DG+VI+WKE NQNEW QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   GVAWAHPKFGSILASCSYDGQVIIWKENNQNEWLQAHVFNDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|EPS72747.1| hypothetical protein M569_02010 [Genlisea aurea]
Length=301

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIET H D+VHDVSMDYYGKRVATASSD +IKIIG+  +S+SQHLATL+ H GPVW
Sbjct  1    MPGQKIETDHRDSVHDVSMDYYGKRVATASSDTTIKIIGI-GSSSSQHLATLSAHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVIVWKEGNQNEW+Q  VF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSVLASCSYDGKVIVWKEGNQNEWSQFQVFDNHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG IS+
Sbjct  120  ACGSSDGTISI  130



>ref|XP_004235651.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
 ref|XP_010318533.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
Length=301

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +IKI GVSN S+SQ LAT++GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIKITGVSN-SSSQLLATISGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ A VF+DHK+SVN+ISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLARVFDDHKASVNAISWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNIS+
Sbjct  120  ACGSSDGNISI  130



>ref|XP_010485502.1| PREDICTED: protein transport protein SEC13 homolog A [Camelina 
sativa]
Length=302

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI GV+N+S SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSQSLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+W QAH F DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWAQAHFFTDHKVSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_010929133.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEGN+ +EW QAH+F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGNKPDEWAQAHIFTEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>emb|CDY49046.1| BnaC05g48740D [Brassica napus]
Length=302

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPK+ SLLASCS+DG++I+WKEGNQN+WTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNQNQWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>emb|CDY10705.1| BnaA05g12310D [Brassica napus]
Length=365

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M   KIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MAGHKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGASQHLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHK+SV+SI+WAP+ELGL L
Sbjct  61   EVAWAHPKFGSMLASCSYDGQVILWKEGSQNQWTQAHVFTDHKTSVSSIAWAPYELGLSL  120

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  121  ACGSSDGNISV  131


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 16/134 (12%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  327
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHSDWVR  214

Query  328  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
             V+WA P  G   S +AS S DGKV++W  G + E  +  V ND K+ V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWSL--TG  271

Query  499  LCLACGSSDGNISV  540
              LA    + N++V
Sbjct  272  NLLAVSDGNNNVTV  285



>ref|XP_008790006.1| PREDICTED: protein SEC13 homolog [Phoenix dactylifera]
Length=302

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 124/132 (94%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EWTQAH+F++HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWTQAHIFSEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_007032314.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY03240.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=301

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQ+IETGH DTVHDV+MDYYGKR+ATASSD ++KIIG+++ S SQ LA L GH GP+W
Sbjct  1    MPAQRIETGHEDTVHDVAMDYYGKRLATASSDTTVKIIGITS-SGSQQLAILHGHKGPIW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QA VFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   EVAWAHPKFGSVLASCSYDGQVIIWKEGNPNEWVQAQVFNDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KCW84259.1| hypothetical protein EUGRSUZ_B01116 [Eucalyptus grandis]
Length=301

 Score =   226 bits (575),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIE+GH DTVHD++MDYYGKR+ATASSD +I ++GVS+ S SQHLATL GH GPVW
Sbjct  1    MPPQKIESGHKDTVHDLAMDYYGKRLATASSDHTINVVGVSS-SGSQHLATLIGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            Q+SWAHPKFGSLLASCS+DG+VI+W+EGN NEWTQA VF +HKSSVNS++WAPHELGLCL
Sbjct  60   QISWAHPKFGSLLASCSYDGRVIIWREGNPNEWTQAQVFEEHKSSVNSVAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_010463534.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH+DTVHDV MDYYGKRVATASSD +IKI GV+N+S S  LATL GH GPVW
Sbjct  1    MPPQKIETGHNDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSHPLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+WTQAHVF DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWTQAHVFTDHKVSVNSIAWAPHDLGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_011466267.1| PREDICTED: protein transport protein SEC13 homolog B-like [Fragaria 
vesca subsp. vesca]
Length=302

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV+MDYYGKR+A+ASSD +IKIIGV +N++SQHLATL+GH GPVW
Sbjct  1    MPGQKIETGHQDVVHDVAMDYYGKRLASASSDTTIKIIGVGSNASSQHLATLSGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV WAHPKFG +LASCS+DG+VI+WKEGN NEW QAHVFN+H +SVNSI WAPHELGL L
Sbjct  61   QVGWAHPKFGPILASCSYDGQVIIWKEGNPNEWYQAHVFNEHSASVNSICWAPHELGLIL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  121  ACGSSDGTISV  131



>gb|AFX66988.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=326

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +IKI GVSN S+SQ LAT++GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIKITGVSN-SSSQQLATISGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ A VF+DHK+SVN+I+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLARVFDDHKASVNAIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNIS+
Sbjct  120  ACGSSDGNISI  130



>ref|XP_009147418.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147419.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147420.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147421.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=302

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPK+ SLLASCS+DG++I+WKEGN NEWTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNNNEWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  508  ACGSSDGNISV  540
            ACG+SDGNISV
Sbjct  121  ACGASDGNISV  131



>ref|XP_009408052.1| PREDICTED: protein SEC13 homolog [Musa acuminata subsp. malaccensis]
Length=302

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 123/132 (93%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDV+MDYYGKR+ATASSD +IKI+GVS  S+ QHLATL+GHHGPVW
Sbjct  1    MPSQKIETGHQDVVHDVAMDYYGKRLATASSDMTIKIVGVSG-SSHQHLATLSGHHGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS++ASCS+DG+VI+WKEG++ +EW QAHVF +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMIASCSYDGRVIIWKEGSKPDEWIQAHVFTEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_010665916.1| PREDICTED: protein transport protein SEC13 homolog B-like [Beta 
vulgaris subsp. vulgaris]
Length=301

 Score =   223 bits (569),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M  QKIETGH DTVHD  MDYYGKR+ATASSD +IKIIGVSNNS  Q LATL+ H GPVW
Sbjct  1    MGIQKIETGHQDTVHDFQMDYYGKRIATASSDHTIKIIGVSNNS-HQQLATLSAHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEW+QA+VF+DHKSSVNSISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWSQANVFDDHKSSVNSISWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            A GSSDGNI V
Sbjct  120  ASGSSDGNIMV  130



>ref|XP_009141033.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=301

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NGGGSQHLATLTGHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELGL L
Sbjct  60   QVAWAHPKFGSVLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELGLSL  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>gb|KDP40875.1| hypothetical protein JCGZ_24874 [Jatropha curcas]
Length=301

 Score =   223 bits (568),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M  QKIE+GH DTVH+V+MDYYGKRVATA SD SI IIGV NN TS  LA L+GH GPVW
Sbjct  1    MLPQKIESGHEDTVHEVAMDYYGKRVATALSDNSINIIGVGNN-TSLPLAKLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFG+LLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHE+GLCL
Sbjct  60   QVAWAHPKFGALLASCSYDGRVIIWKEGNQNEWTQAHVFDDHKSSVNSISWAPHEVGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  120  ACGSSDGSISV  130



>gb|KHG02181.1| Protein SEC13 [Gossypium arboreum]
Length=301

 Score =   223 bits (567),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MPAQKIETGH D +HDV+MDYYGKR+ATASSD +IKIIG++  S+SQ LA L GH GPVW
Sbjct  1    MPAQKIETGHEDALHDVAMDYYGKRLATASSDTTIKIIGITG-SSSQQLAVLHGHKGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
             V+WAHPKFGS+LASCS+D +VI+WKE NQNEW QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   GVAWAHPKFGSILASCSYDAQVIIWKENNQNEWLQAHVFNDHKSSVNSIAWAPHELGLCL  119

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  120  ACGSSDGDISV  130



>emb|CDX97854.1| BnaC04g40850D [Brassica napus]
Length=301

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NAGGSQHLATLTGHRGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELGL  
Sbjct  60   QVAWAHPKFGSILASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELGLSF  119

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  120  ACGSSDGNISV  130



>ref|XP_004169158.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
Length=301

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+GVS +S SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVGVSKDSGSQILATLNGHKGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_004147452.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN59617.1| hypothetical protein Csa_3G829070 [Cucumis sativus]
Length=301

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+GVS +S SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVGVSKDSGSQILATLNGHKGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_008443459.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+ VS NS SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVSVSKNSGSQILATLNGHKGPVW  60

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  508  ACGSSDGNISV  540
            ACGSSDG+ISV
Sbjct  121  ACGSSDGSISV  131



>ref|XP_010942123.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
             V+WAHPKFGS+LASCS+D +VI+WKEG++ +EWTQAH+F +HKSSVNSI+WAPHELGLC
Sbjct  60   LVAWAHPKFGSMLASCSYDSRVIIWKEGSKPDEWTQAHIFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_006836221.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
 gb|ERM99074.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
Length=302

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+ KIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV+  S+ QHLATL+GH GPVW
Sbjct  1    MPSLKIETGHQDVVHDVAMDYYGKRLATASSDATIKIIGVAA-SSQQHLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DGKVI+WKEG  N+W+Q +VF+DHK+SVNSI+WAPHE+GLC+
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVIIWKEGTSNDWSQFYVFSDHKASVNSIAWAPHEIGLCI  119

Query  508  ACGSSDGNISV  540
            ACGSSDG IS+
Sbjct  120  ACGSSDGTISI  130



>emb|CDY29706.1| BnaA04g17210D [Brassica napus]
Length=690

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = +1

Query  139  EGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG  318
            E  MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH G
Sbjct  387  ESNMPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NGGGSQHLATLTGHRG  445

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVWQV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELG
Sbjct  446  PVWQVAWAHPKFGSILASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELG  505

Query  499  LCLACGSSDGNISV  540
            L LACGSSDGNISV
Sbjct  506  LSLACGSSDGNISV  519



>ref|XP_010249546.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=300

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 2/128 (2%)
 Frame = +1

Query  160  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  339
            KIETGH DTVHDV+MDYYGKR+ATA SD +IKIIGV N S SQHLATL+GH GPVWQV+W
Sbjct  2    KIETGHQDTVHDVTMDYYGKRLATACSDNTIKIIGVCN-SASQHLATLSGHQGPVWQVAW  60

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF-NDHKSSVNSISWAPHELGLCLACG  516
            AHPKFGS+LASCS+DG VI+WKEGNQNEW+QAHVF +DHKSS++SI+WAPHELGL LACG
Sbjct  61   AHPKFGSILASCSYDGLVIIWKEGNQNEWSQAHVFSDDHKSSMDSIAWAPHELGLYLACG  120

Query  517  SSDGNISV  540
            SSDGNISV
Sbjct  121  SSDGNISV  128



>ref|NP_001045820.1| Os02g0135800 [Oryza sativa Japonica Group]
 dbj|BAB83081.1| Sec13p [Oryza sativa]
 dbj|BAD10362.1| Sec13p [Oryza sativa Japonica Group]
 dbj|BAF07734.1| Os02g0135800 [Oryza sativa Japonica Group]
 gb|EAY84386.1| hypothetical protein OsI_05762 [Oryza sativa Indica Group]
 gb|EAZ21659.1| hypothetical protein OsJ_05292 [Oryza sativa Japonica Group]
 dbj|BAG99387.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQAHTFIEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|EMT07862.1| hypothetical protein F775_17938 [Aegilops tauschii]
Length=305

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGTS-HQQLATLSGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            Q++WAHPK+GS+LASCS+DG+VI+WKEG++ +EW QAH FN+HKSSVNSI+WAPHELGLC
Sbjct  60   QIAWAHPKYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFNEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|EMT13956.1| hypothetical protein F775_31904 [Aegilops tauschii]
Length=320

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-QQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKE-GNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GS+LASCS+DG+VI+WKE G  +EWTQAH F +HKSSVNSI+WAPHELG+C
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEEGKPDEWTQAHTFTEHKSSVNSIAWAPHELGIC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_006646853.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRMATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW Q H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQVHTFIEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|EMS54340.1| Protein SEC13-like protein [Triticum urartu]
Length=305

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-QQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GS+LASCS+DG+VI+WKEG + +EWTQ H F +HKSSVNSI+WAPHELG+C
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWTQFHTFTEHKSSVNSIAWAPHELGIC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_003565584.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010230618.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=305

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GS+LASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVTWAHPKYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|ACN59487.1| SEC13 [Triticum aestivum]
Length=306

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S+ Q LATL+GH GPVWQ
Sbjct  3    PPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSG-SSQQQLATLSGHQGPVWQ  61

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            V+WAHPK+GS+LASCS+DG+VI+WKEG + +EWTQAH F +HKSSVNSI+WAPHELG+CL
Sbjct  62   VAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWTQAHTFTEHKSSVNSIAWAPHELGICL  121

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  122  ACGSSDGNISV  132



>dbj|BAJ89756.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIG+S  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGISGTS-QQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GS+LASCS+DG+VI+WKEG + +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWAQAHTFVEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_010098129.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB74566.1| Protein SEC13-like protein [Morus notabilis]
Length=355

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 7/155 (5%)
 Frame = +1

Query  76   ADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIK  255
            ADP   SLF    +F +  ++  KMPAQ+IE  H D VHD  MDY+G R+ATASSD +I 
Sbjct  38   ADP--FSLFT---SFPK--ERSRKMPAQEIEINHQDLVHDAVMDYFGDRLATASSDHTIN  90

Query  256  IIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA  435
            +I V  NS S+H+ATL GH GPVWQ+ WAHPKFGSLLASCS+DGKVI+W+E  +++W QA
Sbjct  91   VIRVKKNSKSEHVATLRGHIGPVWQLDWAHPKFGSLLASCSYDGKVIIWEEATKDQWIQA  150

Query  436  HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            HVF+DHKSSVNSI+WAPHELGLCLACGSSDGNISV
Sbjct  151  HVFDDHKSSVNSIAWAPHELGLCLACGSSDGNISV  185



>ref|XP_006854548.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
 gb|ERN16015.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
Length=306

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 118/135 (87%), Gaps = 5/135 (4%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+ KIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV+  S+ QHLATL+GH GPVW
Sbjct  1    MPSLKIETGHQDVVHDVAMDYYGKRLATASSDATIKIIGVAA-SSQQHLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ----NEWTQAHVFNDHKSSVNSISWAPHEL  495
            QV+WAHPKFGSLLASCS+D KV++WKEG +    N W Q +VF+DHK+SVNSI+WAPHEL
Sbjct  60   QVAWAHPKFGSLLASCSYDSKVVIWKEGTKEGTSNGWLQFYVFSDHKASVNSIAWAPHEL  119

Query  496  GLCLACGSSDGNISV  540
            GLCLACGSSDG ISV
Sbjct  120  GLCLACGSSDGTISV  134



>ref|NP_001149004.1| SEC13-related protein [Zea mays]
 gb|ACG33776.1| SEC13-related protein [Zea mays]
Length=305

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDITMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW  AH F +HKSS NSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALAHTFAEHKSSANSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|AGT16309.1| SEC13-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16328.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   213 bits (542),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_002454939.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
 gb|EES00059.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
Length=305

 Score =   213 bits (542),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_006646846.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHKDVVHDIAMDYYGKRMATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WA HELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQAHTFIEHKSSVNSIAWAAHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|ACG46695.1| SEC13-related protein [Zea mays]
 gb|ACL54360.1| unknown [Zea mays]
 gb|AFW61900.1| SEC13 protein [Zea mays]
 gb|AFW69101.1| SEC13 protein [Zea mays]
 tpg|DAA52845.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW  AH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALAHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|AGT17401.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLCGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_004968630.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGAS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGL 
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFVEHKSSVNSIAWAPHELGLS  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_004956945.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHDV+MDYYGKR+ATASSD +IKI+GVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDVAMDYYGKRIATASSDNTIKIVGVSGTS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            Q +WAHPKFGS+LASC +DG+VI+WKEG + +EW QAH F +HKSSV+SI+WAPHELGLC
Sbjct  60   QAAWAHPKFGSMLASCGYDGRVIIWKEGGKPDEWVQAHTFTEHKSSVSSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>ref|XP_010914535.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSN-NSTSQHLATLAGHHGPV  324
            MP+QKIETGH D VHDV+MDYYGK +ATASSD++IK+I V N +S SQ LATL+GH GPV
Sbjct  1    MPSQKIETGHQDMVHDVAMDYYGKCLATASSDSTIKVITVGNASSPSQLLATLSGHQGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGL  501
            WQV WAHPKFGS+LASCS+D +VI+WKEG   N+W QAHVF DHKSSVNSI+WAP+ELGL
Sbjct  61   WQVVWAHPKFGSILASCSYDSRVIIWKEGTTPNQWVQAHVFTDHKSSVNSIAWAPYELGL  120

Query  502  CLACGSSDGNISV  540
            CLACGSSDG+ISV
Sbjct  121  CLACGSSDGSISV  133



>ref|NP_001150249.1| SEC13-related protein [Zea mays]
 gb|ACG38366.1| SEC13-related protein [Zea mays]
 gb|AFW80398.1| SEC13 protein isoform 1 [Zea mays]
 gb|AFW80399.1| SEC13 protein isoform 2 [Zea mays]
Length=305

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHDV+MDYYGKR+AT+SSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDVAMDYYGKRLATSSSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGNISV  540
            LACGSSDGNISV
Sbjct  120  LACGSSDGNISV  131



>gb|EPS72324.1| hypothetical protein M569_02435, partial [Genlisea aurea]
Length=284

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 3/131 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP ++IETGH D +HDV MDYYGKR+ATASSD +I+IIG+ N   SQHLA L GH GPVW
Sbjct  1    MPGKRIETGHQDVLHDVQMDYYGKRIATASSDNTIRIIGIGN---SQHLANLIGHRGPVW  57

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+DGKVI+WKE  + EW Q  VF+DHK+SVNSI WAPHE GL L
Sbjct  58   QVAWAHPKFGSMLASCSYDGKVIIWKEEKETEWIQLSVFDDHKASVNSICWAPHESGLSL  117

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  118  ACGSSDGNISV  128



>gb|EMT33754.1| hypothetical protein F775_27473 [Aegilops tauschii]
Length=280

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGTS-HQQLATLSGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            Q++WAHP +GS+LASCS+DG+VI+WKEG++ +EW QAH FN+HKSSVNSI+WAPHELGLC
Sbjct  60   QIAWAHPNYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFNEHKSSVNSIAWAPHELGLC  119

Query  505  LACGSSDGN  531
            LACG+S G 
Sbjct  120  LACGTSSGR  128



>ref|XP_003563373.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010240532.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=316

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI+ +   S  SQ LATL GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKIVNIGGASAPSQLLATLTGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V WAHPK+GS+LASCS+DG+VIVWKEG   +W+QAHVF++HKSSVNSI+WAP+ELGLC
Sbjct  61   WRVGWAHPKYGSILASCSYDGRVIVWKEGATGQWSQAHVFSNHKSSVNSIAWAPYELGLC  120

Query  505  LACGSSDGNISV  540
            LACGSSDG+ISV
Sbjct  121  LACGSSDGSISV  132



>ref|XP_002979018.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
 gb|EFJ19975.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
Length=317

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = +1

Query  145  KMPA-QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHG  318
            K+P+   IE+GH+D VHD  MDYYGKR+AT SSD SI++  V   S  +HL ATL+GH G
Sbjct  14   KLPSSHSIESGHTDIVHDAQMDYYGKRLATCSSDRSIRVFSVPQGSQGEHLLATLSGHDG  73

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVWQ+ W HPKFGS+LASCS+D KVI+WKEG +N+W QAHVF +H++SVNSI+WAPHE G
Sbjct  74   PVWQICWGHPKFGSILASCSYDAKVIIWKEGAENQWIQAHVFKEHEASVNSIAWAPHEFG  133

Query  499  LCLACGSSDGNISV  540
            LCLACGSSDG ISV
Sbjct  134  LCLACGSSDGTISV  147



>gb|ABK22893.1| unknown [Picea sitchensis]
Length=322

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  145  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  324
            +M +QK E+GH D VHDV+MDYYGKR+AT S+D +IK+ G++ + T   LA+L GH GPV
Sbjct  7    QMGSQKFESGHQDVVHDVTMDYYGKRIATCSADRTIKLFGLNASDTPTLLASLTGHEGPV  66

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGL  501
            WQV+WAHPKFGS+LASCS+D +VI+W+EG Q N W+Q  VF +H++SVNS+SWAPHELGL
Sbjct  67   WQVAWAHPKFGSILASCSYDRRVIIWQEGQQENAWSQLQVFKEHEASVNSVSWAPHELGL  126

Query  502  CLACGSSDGNISV  540
            CLACGSSDG+I+V
Sbjct  127  CLACGSSDGSITV  139



>ref|NP_001059284.1| Os07g0246300 [Oryza sativa Japonica Group]
 dbj|BAC82934.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAD31963.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAF21198.1| Os07g0246300 [Oryza sativa Japonica Group]
 gb|EAZ03370.1| hypothetical protein OsI_25509 [Oryza sativa Indica Group]
 gb|EAZ39271.1| hypothetical protein OsJ_23698 [Oryza sativa Japonica Group]
 dbj|BAG99420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   195 bits (495),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKISSIGGKSAPSQLLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGTILASCSYDGRVIIWKEGAGGHWSQAHVFTDHKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LACGSSDG ISV
Sbjct  121  LACGSSDGTISV  132



>ref|XP_002988399.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
 gb|EFJ10489.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
Length=317

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = +1

Query  145  KMPA-QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHG  318
            K+P+   IE+GH+D VHD  MDYYGKR+AT SSD S+++  V   S  +HL ATL+GH G
Sbjct  14   KLPSSHSIESGHTDIVHDAQMDYYGKRLATCSSDRSVRVFSVPQGSQGEHLLATLSGHDG  73

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVWQ+ W HPKFGS+LASCS+D KVI+WKEG +N+W QAHVF +H++SVNSI+WAPHE G
Sbjct  74   PVWQICWGHPKFGSILASCSYDAKVIIWKEGAENQWIQAHVFKEHEASVNSIAWAPHEFG  133

Query  499  LCLACGSSDGNISV  540
            LCLACGSSDG ISV
Sbjct  134  LCLACGSSDGTISV  147



>ref|XP_006650845.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=301

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++ IE  H D VHD + DYYGKR+ATASSD+++K+I +   ST SQ LATL+GH+GPV
Sbjct  1    MSSKNIELDHKDMVHDSAFDYYGKRLATASSDSTVKVINIGGASTPSQLLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPKFGSLLASC +DG+VIVWKEG   +W+QAHVF++HKSSVNSI+WAP++LGL 
Sbjct  61   WRVAWAHPKFGSLLASCGYDGRVIVWKEGAAGQWSQAHVFDNHKSSVNSIAWAPYDLGLS  120

Query  505  LACGSSDGNISV  540
            LACGSSDG+IS+
Sbjct  121  LACGSSDGSISM  132



>ref|NP_001146460.1| SEC13 protein [Zea mays]
 gb|ACL54052.1| unknown [Zea mays]
 tpg|DAA39762.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = +1

Query  142  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHG  318
            G M ++KIE  H D VHD ++DYYGKR+ATASSD+++KII + + N+ SQ LATL+GH+G
Sbjct  5    GNMSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKIINIGAANAPSQVLATLSGHYG  64

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVW+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+G
Sbjct  65   PVWRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVG  124

Query  499  LCLACGSSDGNISV  540
            LCLAC SS G IS+
Sbjct  125  LCLACASSGGRISI  138



>ref|NP_001051797.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|AAO39855.1| putative coat protein complex II (COPII) component [Oryza sativa 
Japonica Group]
 gb|AAP46251.1| putative protein-transport protein [Oryza sativa Japonica Group]
 gb|ABF99713.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99714.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13711.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|EAY92452.1| hypothetical protein OsI_14185 [Oryza sativa Indica Group]
 gb|EAZ29179.1| hypothetical protein OsJ_13238 [Oryza sativa Japonica Group]
 dbj|BAG96146.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M + KIE  H D VHD ++DYYGK +ATASSD++++I  +   S  SQ LATL+GH+GPV
Sbjct  1    MSSNKIELDHKDMVHDSAIDYYGKSLATASSDSTVQISSIGGASAPSQLLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPKFGS+LASC +DG+V+VWKEG   +W+QAHVF++HKSS+NSI+WAP+ELGLC
Sbjct  61   WRVAWAHPKFGSILASCGYDGRVVVWKEGAAGQWSQAHVFDNHKSSLNSIAWAPYELGLC  120

Query  505  LACGSSDGNISV  540
            LACGSSDG+ISV
Sbjct  121  LACGSSDGSISV  132



>gb|EMS55260.1| Protein SEC13-like protein [Triticum urartu]
Length=327

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  11   MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITSIGGASAPSQLVATLTGHYGPV  70

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q HVF++HK+SVNSI+WAP+ELGLC
Sbjct  71   WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLHVFDNHKASVNSIAWAPYELGLC  130

Query  505  LACGSSDGNISV  540
            LACGSSDG ISV
Sbjct  131  LACGSSDGTISV  142



>ref|XP_006657588.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=315

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S   HL ATL+GH+GPV
Sbjct  1    MLSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKISTIGGKSAPSHLLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WCVAWAHPKYGTILASCSYDGRVIIWKEGAGGHWSQAHVFADHKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LAC SSDG ISV
Sbjct  121  LACASSDGTISV  132



>ref|XP_010228200.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=301

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D +HD ++DYYGKR+ATASSD ++K++ +   S  S+ LATL+GH+GPV
Sbjct  1    MLSKKIELDHKDMIHDSAIDYYGKRLATASSDYTVKVVSIGGASAPSKLLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEGTGGHWSQAHVFADHKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LAC  SDGNI +
Sbjct  121  LACACSDGNIYI  132



>dbj|BAJ95085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=317

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITNIGGASAPSQLVATLTGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q +VF++HK+SVNSI+WAP+ELGLC
Sbjct  61   WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLYVFDNHKASVNSIAWAPYELGLC  120

Query  505  LACGSSDGNISV  540
            LACGSSDG ISV
Sbjct  121  LACGSSDGTISV  132



>gb|EMT21065.1| hypothetical protein F775_28222 [Aegilops tauschii]
Length=387

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  71   MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITNIGGASAPSQLVATLTGHYGPV  130

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q HVF++HK+SVNSI+WAP+ELGLC
Sbjct  131  WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLHVFDNHKASVNSIAWAPYELGLC  190

Query  505  LACGSSDGNISV  540
            LACGSSDG ISV
Sbjct  191  LACGSSDGTISV  202



>ref|XP_001781370.1| predicted protein [Physcomitrella patens]
 gb|EDQ53817.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS---NNSTSQHLATLAGHHGPVW  327
            Q +E+GH D VHDV++DYYGKR+AT SSD  IK+  +    + + +  L TLAGH GPVW
Sbjct  8    QFVESGHQDVVHDVAVDYYGKRLATCSSDRLIKVFALGPAGDAAVATALVTLAGHDGPVW  67

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGS+LASCS+D KVI+W+EG +NEW QA VF +H+SSVNSI WAP E GLCL
Sbjct  68   QVAWAHPKFGSILASCSYDRKVIIWREGAENEWQQAQVFQEHESSVNSICWAPQEFGLCL  127

Query  508  ACGSSDGNISV  540
            ACGSSDG ISV
Sbjct  128  ACGSSDGTISV  138



>ref|NP_001149986.1| SEC13-related protein [Zea mays]
 ref|XP_008651487.1| PREDICTED: SEC13-related protein isoform X1 [Zea mays]
 gb|ACF84405.1| unknown [Zea mays]
 gb|ACG37410.1| SEC13-related protein [Zea mays]
Length=299

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LAC SS G IS+
Sbjct  121  LACASSGGRISI  132



>gb|ACN31668.1| unknown [Zea mays]
Length=299

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF D+KSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFTDNKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LAC SS G IS+
Sbjct  121  LACASSGGRISI  132



>ref|XP_004955890.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=301

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  324
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI+ + +  + SQ LATL GH+GPV
Sbjct  1    MASKKIELDHKDMVHDSAVDYYGKRLATASSDSTVKIVSIGAATAPSQVLATLTGHYGPV  60

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            W+V+WAHPK+G++LASC +DG+V++WKE  +  W+Q H F DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGTILASCGYDGRVVIWKEDARGNWSQVHAFMDHKSSVNSIAWAPYEVGLC  120

Query  505  LACGSSDGNISV  540
            LAC SSDG IS+
Sbjct  121  LACASSDGRISI  132



>ref|XP_008651486.1| PREDICTED: SEC13-related protein isoform X2 [Zea mays]
Length=421

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  142  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHG  318
            G M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+G
Sbjct  121  GNMSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYG  180

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVW+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+G
Sbjct  181  PVWRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVG  240

Query  499  LCLACGSSDGNISV  540
            LCLAC SS G IS+
Sbjct  241  LCLACASSGGRISI  254



>ref|XP_002460282.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
 gb|EER96803.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
Length=276

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +1

Query  202  MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSF  381
            MDYYGKR+ATASSD +IKI+GVS  S  Q LATL+GH GPVWQV WAHPKFGS+LASC +
Sbjct  1    MDYYGKRIATASSDNTIKIVGVSGTS-HQQLATLSGHQGPVWQVVWAHPKFGSMLASCGY  59

Query  382  DGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            DG VI+WKEG + +EW QAH F +HKSSVNSI+WAPHELGLCLACGSSDGNISV
Sbjct  60   DGCVIIWKEGGRPDEWVQAHTFTEHKSSVNSIAWAPHELGLCLACGSSDGNISV  113



>ref|XP_001767345.1| predicted protein [Physcomitrella patens]
 gb|EDQ67836.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPVWQVSW  339
            +E+GH D VHDVS+DYYGKR+A+ SSD  IK+  +S+       LATLAGH GPVWQV+W
Sbjct  1    MESGHQDVVHDVSVDYYGKRLASCSSDRLIKVFAISSEDVLPNSLATLAGHEGPVWQVAW  60

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            AHPKFGS+LASCS+D KVI+W+EG +NEW Q  VF +H+SSVNSISW+PHE GL LACGS
Sbjct  61   AHPKFGSILASCSYDRKVIIWREGAENEWHQDQVFQEHESSVNSISWSPHEFGLGLACGS  120

Query  520  SDGNISV  540
            SDG ISV
Sbjct  121  SDGTISV  127



>ref|XP_001768123.1| predicted protein [Physcomitrella patens]
 gb|EDQ66996.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 103/129 (80%), Gaps = 3/129 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS---NNSTSQHLATLAGHHGPVWQV  333
            +E+GH D VHDV++DYYGKR+AT SSD  +K+  +    +   S  LATL+GH GP+WQV
Sbjct  2    LESGHQDVVHDVAVDYYGKRLATCSSDRLVKVFALGASGSTPPSSALATLSGHEGPIWQV  61

Query  334  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC  513
            +WAHPKFG++LASCS+D KVI+W+EG +NEW QA VF +H+SSVNSISWAP   GLCLAC
Sbjct  62   AWAHPKFGNILASCSYDRKVIIWREGAENEWHQAQVFQEHESSVNSISWAPEVFGLCLAC  121

Query  514  GSSDGNISV  540
            GS+DG ISV
Sbjct  122  GSADGTISV  130



>ref|XP_001774339.1| predicted protein [Physcomitrella patens]
 gb|EDQ60841.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPVWQV  333
            Q +E+GH D VHDV++DYYGKR+A+ SSD  IK+  V S +  +  LA+L+GH GPVWQV
Sbjct  14   QVVESGHQDVVHDVAVDYYGKRMASCSSDRLIKVFAVGSGDVPTMPLASLSGHEGPVWQV  73

Query  334  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAH-VFNDHKSSVNSISWAPHELGLCLA  510
            +WAHPKFGS+LASCS+D KVIVW+EG +NEW +   VF +H+SSVNSI WAP E GLCLA
Sbjct  74   AWAHPKFGSILASCSYDRKVIVWREGAENEWQKDQVVFQEHESSVNSICWAPSEFGLCLA  133

Query  511  CGSSDGNISV  540
            CGSSDG ISV
Sbjct  134  CGSSDGTISV  143



>ref|XP_005834017.1| secretory protein Sec13 [Guillardia theta CCMP2712]
 gb|EKX47037.1| secretory protein Sec13 [Guillardia theta CCMP2712]
Length=320

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  118  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-  294
             +     +G MP   I+T H D +HDV +DYYGKR+AT SSD  IKI  VS + TS  L 
Sbjct  1    MVAQPQSQGPMPDSSIDTQHEDMIHDVQLDYYGKRLATCSSDRFIKIFDVSPDQTSHQLS  60

Query  295  ATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSI  474
            AT+A H GP+WQV+WAHPKFGS+LASCS+D KV VWKE    +WT+ + + DH+SSVNSI
Sbjct  61   ATIAAHEGPIWQVAWAHPKFGSILASCSYDRKVCVWKEVQLQQWTKIYEYADHQSSVNSI  120

Query  475  SWAPHELGLCLACGSSDGNISV  540
            ++APHELGL LA  S+DG IS+
Sbjct  121  AFAPHELGLKLAAASADGTISI  142



>gb|ABK26393.1| unknown [Picea sitchensis]
Length=283

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  202  MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSF  381
            MDYYGKR+AT S+D +IK+ G++ + T   LA+L GH GPVWQV+WAHPKFGS+LASCS+
Sbjct  1    MDYYGKRIATCSADRTIKLFGLNASDTPTLLASLTGHEGPVWQVAWAHPKFGSILASCSY  60

Query  382  DGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            D +VI+W+EG Q N W+Q  VF +H++SVNS+SWAPHELGLCLACGSSDG+I+V
Sbjct  61   DRRVIIWQEGQQENAWSQLQVFKEHEASVNSVSWAPHELGLCLACGSSDGSITV  114



>gb|ABM55656.1| putative SEC13-like protein 1 [Maconellicoccus hirsutus]
Length=308

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            +ETGH D +HD  MDYYG R+AT SSD SIKI  + N + S  +A L GH+GPVWQV+WA
Sbjct  8    VETGHEDVIHDAEMDYYGLRLATCSSDQSIKIYNLKNGTQSL-VADLKGHYGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+ LASCS+D KVI+WKE N NEW + H + +H SSVNS++WAPHE GL LACGS 
Sbjct  67   HPKFGNFLASCSYDRKVIIWKETN-NEWVKFHEYTNHDSSVNSVAWAPHEYGLILACGSL  125

Query  523  DGNISV  540
            DG IS+
Sbjct  126  DGTISI  131



>ref|XP_006379798.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
 gb|ERP57595.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
Length=285

 Score =   168 bits (426),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 97/131 (74%), Gaps = 17/131 (13%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QKIET   + +                   S       NN+TSQHLA L GH GPVW
Sbjct  1    MPSQKIETADCNCLI-----------------GSFNQNNWVNNNTSQHLANLTGHQGPVW  43

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGL L
Sbjct  44   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFDDHKSSVNSIAWAPHELGLSL  103

Query  508  ACGSSDGNISV  540
            ACGSSDGNISV
Sbjct  104  ACGSSDGNISV  114



>ref|XP_011407281.1| PREDICTED: protein SEC13 homolog [Amphimedon queenslandica]
Length=313

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG+R+AT SSD ++KI  VS   T   LATL GH GPVWQ+SWA
Sbjct  11   VDTGHEDMIHDSQMDYYGRRLATCSSDRTVKIFDVSGQQTVL-LATLTGHEGPVWQLSWA  69

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVI+WKE    +W++ H F +HKSSVNSI WAPHELGL LACGSS
Sbjct  70   HPKFGNILASCSYDRKVIIWKE-TSGKWSKLHEFCEHKSSVNSIQWAPHELGLVLACGSS  128

Query  523  DGNISV  540
            D + S+
Sbjct  129  DESFSI  134



>ref|XP_003384987.1| PREDICTED: protein SEC13 homolog [Amphimedon queenslandica]
Length=313

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG+R+AT SSD ++KI  VS   T   LATL GH GPVWQ+SWA
Sbjct  11   VDTGHEDMIHDSQMDYYGQRLATCSSDRTVKIFDVSGQQTVL-LATLTGHEGPVWQLSWA  69

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVI+WKE    +W++ H F +HKSSVNSI WAPHELGL LACGSS
Sbjct  70   HPKFGNILASCSYDRKVIIWKE-TSGKWSKLHEFCEHKSSVNSIQWAPHELGLVLACGSS  128

Query  523  DGNISV  540
            D + S+
Sbjct  129  DESFSI  134



>ref|XP_009824525.1| hypothetical protein H257_02541 [Aphanomyces astaci]
 gb|ETV86053.1| hypothetical protein H257_02541 [Aphanomyces astaci]
Length=306

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD ++K+  V+++S   +   L GH GPVWQ
Sbjct  4    PVLTIDTQHDDMIHDAQLDYYGKRLATCSSDRTVKVYDVTHDSQHSNEQVLTGHEGPVWQ  63

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            VSWAHPKFG+LLASCS+DGKVI++KE    +W+Q HV + H++SVNSI+WAP+E GL LA
Sbjct  64   VSWAHPKFGTLLASCSYDGKVIIYKEAQLGKWSQVHVHSFHQASVNSIAWAPYEYGLTLA  123

Query  511  CGSSDGNISV  540
            C S+DG +S+
Sbjct  124  CASADGKVSI  133



>ref|XP_008863897.1| hypothetical protein H310_02232 [Aphanomyces invadans]
 gb|ETW07804.1| hypothetical protein H310_02232 [Aphanomyces invadans]
Length=306

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD ++K+  V+++S   +   L GH GPVWQ
Sbjct  4    PVVTIDTQHDDMIHDAQLDYYGKRLATCSSDRTVKVYDVTHDSQHTNEQVLTGHEGPVWQ  63

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            VSWAHPKFG+LLA+CS+DGKVI++KE    +W+Q HV   H++SVNSI+WAP+E GL LA
Sbjct  64   VSWAHPKFGTLLATCSYDGKVIIYKEAQLGKWSQVHVHAFHQASVNSIAWAPYEYGLTLA  123

Query  511  CGSSDGNISV  540
            C S+DG +S+
Sbjct  124  CASADGKVSI  133



>ref|XP_008615576.1| hypothetical protein SDRG_11321 [Saprolegnia diclina VS20]
 gb|EQC31137.1| hypothetical protein SDRG_11321 [Saprolegnia diclina VS20]
Length=311

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            PA  I+T H D +HD  +DYYGKR+AT SSD +IK+  V+ ++   +   LAGH GPVWQ
Sbjct  4    PALSIDTQHDDMIHDAQLDYYGKRLATCSSDRTIKVYDVTADAQHTNERVLAGHEGPVWQ  63

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            +SWAHPKFG+LLASCS+DGKVI+ KE    +W+Q H    H+SSVNSI+WAP+E GL LA
Sbjct  64   ISWAHPKFGTLLASCSYDGKVIIHKEAQHGQWSQIHTHAFHQSSVNSIAWAPYEYGLSLA  123

Query  511  CGSSDGNISV  540
            C S+DG +S+
Sbjct  124  CASADGKVSI  133



>ref|XP_004358973.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG21123.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=301

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +1

Query  142  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP  321
             ++ +  I+T H D VHD   DYYGK +AT SSD SIKI  VS  +   HL  L GH GP
Sbjct  2    AQVASNPIDTAHEDMVHDAQFDYYGKYLATCSSDRSIKIFDVSGENHV-HLTDLKGHEGP  60

Query  322  VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL  501
            VWQV+WAHPKFG +LAS S+D KVI+WKE + N+W+  + F+ H+ SVNSISWAPHE GL
Sbjct  61   VWQVAWAHPKFGKILASASYDRKVIIWKETSNNQWSNIYQFSGHELSVNSISWAPHEFGL  120

Query  502  CLACGSSDGNISV  540
            CLAC SSDG +S+
Sbjct  121  CLACASSDGTVSI  133



>ref|XP_005650517.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25973.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=305

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +1

Query  160  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  339
            +I+TGHSDTVHDV  DYYG+R+AT SSD +IK+   + +  ++ ++ L GH GPVWQV+W
Sbjct  10   QIDTGHSDTVHDVQFDYYGRRLATCSSDRTIKVFETAGDQMAE-VSQLVGHEGPVWQVTW  68

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            AHPKFGSLLASC FD KVIVWKE  +++W QA+    H +SVNS+++APHELGL LA  S
Sbjct  69   AHPKFGSLLASCGFDHKVIVWKEAQESQWVQAYSAPVHSASVNSVAFAPHELGLILAAAS  128

Query  520  SDGNISV  540
            SDG+IS+
Sbjct  129  SDGSISI  135



>dbj|GAM20430.1| hypothetical protein SAMD00019534_036050 [Acytostelium subglobosum 
LB1]
Length=308

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D VHD   DYYGK +AT SSD  IKI  V+ ++   HLA L GH GPVWQV+WA
Sbjct  13   LDTAHEDMVHDAQFDYYGKYLATCSSDRIIKIFDVAGDN-HVHLADLRGHEGPVWQVAWA  71

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG +LAS S+D KVI+W+E N N+W+  H F+ H+ SVNSISWAPHE GLCLAC SS
Sbjct  72   HPKFGKILASASYDRKVIIWRETNNNQWSILHQFSGHELSVNSISWAPHEFGLCLACASS  131

Query  523  DGNISV  540
            DG +S+
Sbjct  132  DGTVSI  137



>gb|KDO31944.1| hypothetical protein SPRG_03160 [Saprolegnia parasitica CBS 223.65]
Length=311

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            PA  I+T H D +HD  +DYYGKR+AT SSD +IK+  V+ ++   +   LAGH GPVWQ
Sbjct  4    PALSIDTQHDDMIHDAQLDYYGKRLATCSSDRTIKVYDVTADAQHTNERVLAGHEGPVWQ  63

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            +SWAHPKFG+LLASCS+DGKVI+ KE    +W+Q H    H+SSVNSI+WAP+E GL LA
Sbjct  64   ISWAHPKFGTLLASCSYDGKVIIHKEAQHGQWSQIHTHAFHQSSVNSIAWAPYEYGLSLA  123

Query  511  CGSSDGNISV  540
            C S+DG +S+
Sbjct  124  CASADGKVSI  133



>gb|ETI55052.1| hypothetical protein F443_02234 [Phytophthora parasitica P1569]
 gb|ETI55053.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK94877.1| hypothetical protein L915_02142 [Phytophthora parasitica]
 gb|ETK94878.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL48271.1| hypothetical protein L916_02107 [Phytophthora parasitica]
 gb|ETL48272.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM01365.1| hypothetical protein L917_02040 [Phytophthora parasitica]
 gb|ETM01366.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM54560.1| hypothetical protein L914_02123 [Phytophthora parasitica]
 gb|ETM54561.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETO83794.1| hypothetical protein F444_02238 [Phytophthora parasitica P1976]
 gb|ETP24863.1| hypothetical protein F441_02206 [Phytophthora parasitica CJ01A1]
 gb|ETP24864.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP52850.1| hypothetical protein F442_02189 [Phytophthora parasitica P10297]
 gb|ETP52851.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=309

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD +IK+  V+ +    +   L GH GPVWQ
Sbjct  4    PILSIDTQHEDMIHDAQLDYYGKRLATCSSDRTIKVYDVTGD-VQNNEQILTGHEGPVWQ  62

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            VSWAHPKFG LLA+CS+DGKVI+++E + N+WTQA+V   H+SSVNSI+WAPHE GL LA
Sbjct  63   VSWAHPKFGVLLAACSYDGKVIIYREQSLNQWTQAYVHAFHESSVNSIAWAPHEYGLALA  122

Query  511  CGSSDGNISV  540
            C S+DG +SV
Sbjct  123  CASADGTVSV  132



>gb|EMD31608.1| hypothetical protein CERSUDRAFT_119652 [Ceriporiopsis subvermispora 
B]
Length=323

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            +ET H D +HD  +DYYGKR+AT SSD ++K+  + +  T +  ATL GH GPVWQV+WA
Sbjct  13   VETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDIVDGETQRTGATLKGHTGPVWQVAWA  72

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+GS+LASCS+DGKV++WKE     W +      HK+SVNS+SWAPHELG  LAC SS
Sbjct  73   HPKYGSILASCSYDGKVLIWKEQQPGAWARIKEHTLHKASVNSVSWAPHELGAILACASS  132

Query  523  DGNISV  540
            DG ISV
Sbjct  133  DGTISV  138



>ref|XP_002900105.1| protein transport protein SEC13 [Phytophthora infestans T30-4]
 gb|EEY60309.1| protein transport protein SEC13 [Phytophthora infestans T30-4]
Length=309

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD +IK+  V+ +    +   L GH GPVWQ
Sbjct  4    PILSIDTQHEDMIHDAQLDYYGKRLATCSSDRTIKVYDVAGD-VQNNEQILTGHEGPVWQ  62

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            VSWAHPKFG LLA+CS+DGKVI+++E + N+WTQA+V   H SSVNSI+WAPHE GL LA
Sbjct  63   VSWAHPKFGVLLAACSYDGKVIIYREQSLNQWTQAYVHAFHDSSVNSIAWAPHEYGLALA  122

Query  511  CGSSDGNISV  540
            C S+DG +SV
Sbjct  123  CASADGTVSV  132



>ref|XP_008899868.1| hypothetical protein PPTG_22013 [Phytophthora parasitica INRA-310]
 gb|ETN14800.1| hypothetical protein PPTG_22013 [Phytophthora parasitica INRA-310]
Length=506

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD +IK+  V+ +  +     L GH GPVWQ
Sbjct  4    PILSIDTQHEDMIHDAQLDYYGKRLATCSSDRTIKVYDVTGDVQNNE-QILTGHEGPVWQ  62

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            VSWAHPKFG LLA+CS+DGKVI+++E + N+WTQA+V   H+SSVNSI+WAPHE GL LA
Sbjct  63   VSWAHPKFGVLLAACSYDGKVIIYREQSLNQWTQAYVHAFHESSVNSIAWAPHEYGLALA  122

Query  511  CGSSDGNISV  540
            C S+DG +SV
Sbjct  123  CASADGTVSV  132



>ref|XP_001700438.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO98127.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=299

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M     E+GH D VHD  +DYYG+R+AT SSD ++K+  +  +  + HLA L GH GPVW
Sbjct  1    MTLANFESGHQDMVHDAQLDYYGRRLATCSSDRTVKVFDIVGDHHT-HLADLRGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF--NDHKSSVNSISWAPHELGL  501
            QVSW HPKFGS+LASCSFD +VIVWKE   N+W QA++   N H +SVNSI WAP+ELGL
Sbjct  60   QVSWGHPKFGSILASCSFDHRVIVWKEAQGNQWQQAYITPGNLHTASVNSICWAPYELGL  119

Query  502  CLACGSSDGNISV  540
             LAC SSDG +S+
Sbjct  120  ILACASSDGTVSL  132



>ref|XP_003287675.1| hypothetical protein DICPUDRAFT_151816 [Dictyostelium purpureum]
 gb|EGC35781.1| hypothetical protein DICPUDRAFT_151816 [Dictyostelium purpureum]
Length=300

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  160  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  339
            ++++GH D +HD   DYYGK +AT SSD  IKI  V    T QHL  L GH GPVWQV+W
Sbjct  4    QVDSGHEDMIHDAQFDYYGKFLATCSSDRLIKIFDVGG-ETHQHLVDLRGHEGPVWQVAW  62

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            AHPKFG +LAS S+D KVI+WKE   N+W   H F  H+ SVNSISWAPHE GLCLAC S
Sbjct  63   AHPKFGKMLASASYDRKVIIWKEIALNQWQMVHQFAGHELSVNSISWAPHEFGLCLACAS  122

Query  520  SDGNISV  540
            SDG +++
Sbjct  123  SDGTVTI  129



>ref|XP_003395453.1| PREDICTED: protein SEC13 homolog [Bombus terrestris]
 ref|XP_003488802.1| PREDICTED: protein SEC13 homolog [Bombus impatiens]
Length=311

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGSQSL-VADLKGHVGPVWQVTWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +  N H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHNGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSVSI  130



>ref|XP_006957939.1| WD40 repeat-like protein [Wallemia sebi CBS 633.66]
 gb|EIM22139.1| WD40 repeat-like protein [Wallemia sebi CBS 633.66]
Length=313

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV----SNNSTSQHLATLAGHHG  318
            P Q IETGH D +HD  +DYYGKR+ATASSD +IKI  +    S+  T+ +   L GH G
Sbjct  8    PPQSIETGHQDVIHDAQLDYYGKRLATASSDRTIKITDITDAPSSTYTNSNAVILQGHQG  67

Query  319  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  498
            PVWQV+WAHPK+GS+LAS S+DGKV +WK+   N WT+      H SSVNSISWAPHELG
Sbjct  68   PVWQVAWAHPKYGSILASSSYDGKVFIWKQEGAN-WTRIKDHTLHTSSVNSISWAPHELG  126

Query  499  LCLACGSSDGNISV  540
              LAC SSDGN+SV
Sbjct  127  PTLACASSDGNVSV  140



>ref|XP_393516.3| PREDICTED: protein SEC13 homolog isoform X2 [Apis mellifera]
 ref|XP_003696225.1| PREDICTED: protein SEC13 homolog [Apis florea]
 ref|XP_006564241.1| PREDICTED: protein SEC13 homolog isoform X1 [Apis mellifera]
 ref|XP_006611385.1| PREDICTED: protein SEC13 homolog isoform X1 [Apis dorsata]
 ref|XP_006611386.1| PREDICTED: protein SEC13 homolog isoform X2 [Apis dorsata]
Length=311

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD SIKI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSIKIFDLKNGTQSL-VADLKGHVGPVWQVTWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +  N H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHNGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSVSI  130



>gb|EFA85457.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=301

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M    ++T H D VHD   DYYGK +AT SSD  IKI  V  ++   HLA L GH GPVW
Sbjct  1    MAQVNLDTHHEDMVHDAQFDYYGKYLATCSSDRLIKIFDVGGDNHV-HLADLRGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFG +LAS S+D KVI+WKE N N+W+  H ++ H+ SVNSISWAPHE GLCL
Sbjct  60   QVAWAHPKFGKILASASYDRKVIIWKETNNNQWSIIHQYSGHELSVNSISWAPHEFGLCL  119

Query  508  ACGSSDGNISV  540
            AC SSDG +S+
Sbjct  120  ACASSDGTVSI  130



>ref|XP_002949031.1| hypothetical protein VOLCADRAFT_80440 [Volvox carteri f. nagariensis]
 gb|EFJ49966.1| hypothetical protein VOLCADRAFT_80440 [Volvox carteri f. nagariensis]
Length=301

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
             E+GH+D VHD  +DYYG+R+AT SSD ++K+  +  +  + HLA L GH GPVWQV W 
Sbjct  7    FESGHADMVHDAQLDYYGRRLATCSSDRTVKVFDIVGDRHT-HLADLRGHEGPVWQVCWG  65

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF--NDHKSSVNSISWAPHELGLCLACG  516
            HPKFGS+LASCSFD +VI+WKEG  N+W QA++   N H +SVNSI WAP+ELGL LAC 
Sbjct  66   HPKFGSILASCSFDHRVIIWKEGQGNQWQQAYISPGNLHTASVNSICWAPYELGLILACA  125

Query  517  SSDGNIS  537
            SSDG++S
Sbjct  126  SSDGSVS  132



>ref|XP_011211710.1| PREDICTED: protein SEC13 homolog [Bactrocera dorsalis]
Length=316

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +H+  +DYYG  +AT SSD S+K+  V N +    +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHNAVLDYYGLHLATCSSDGSVKVFDVKNGNQIL-IADLKGHQGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVIVWKEG  NEWT+ + +N+H SSVNS+++AP E GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIVWKEGAANEWTKFYEYNNHDSSVNSVAFAPAEYGLILACGSS  126

Query  523  DGNISV  540
            DG+IS+
Sbjct  127  DGSISI  132


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 68/144 (47%), Gaps = 11/144 (8%)
 Frame = +1

Query  52   QRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDV----SMDYYGK  219
            QR     +A  RL S    +   I   D +  +   ++E GHSD V DV    S+     
Sbjct  172  QRSSTRNTAVKRLASAGCDNCVKIWREDADRWVEENRLE-GHSDWVRDVAWAPSIGLARS  230

Query  220  RVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIV  399
            ++A+AS D  + II  S + T+     L      VW VSW+    G++LA    D KV +
Sbjct  231  QIASASQDRHV-IIWNSTDLTTWSSTILHTFDDVVWSVSWSMT--GNILAVTGGDNKVTL  287

Query  400  WKEGNQNEWTQAHVFNDHKSSVNS  471
            WKE N+N+W      ND  ++ N+
Sbjct  288  WKENNENQWM---CINDDAAATNA  308



>ref|XP_004345908.1| SEC13, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR21364.1| SEC13, putative [Acanthamoeba castellanii str. Neff]
Length=310

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  160  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  339
            ++ T H+D VHD   DYYGKRVAT SSD +IKI   SN S    +A L GH GPVWQV W
Sbjct  6    QVNTEHTDMVHDAQPDYYGKRVATCSSDRTIKIFEGSNESNYTQVAELKGHEGPVWQVCW  65

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
             HPKFG +LASC +D KVIVWKE  +N W + HV+  H+ SVNS+++APHE GL LAC S
Sbjct  66   GHPKFGVILASCGYDRKVIVWKEAAKNIWEKIHVYEGHELSVNSLAFAPHEFGLALACAS  125

Query  520  SDGNISV  540
            SDG++SV
Sbjct  126  SDGHVSV  132



>gb|AGM32573.1| WD40 domain containing protein, partial [Coptotermes formosanus]
Length=276

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  +  N T    A L GH+GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDHSVKIYDI-KNGTQTLTADLKGHYGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+G+LLASCS+D KVI+WKE    EW + + ++ H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKYGNLLASCSYDRKVIIWKEA--GEWVKLYEYSSHDSSVNSVAWAPHEFGLMLACGSS  124

Query  523  DGNISV  540
            DG++SV
Sbjct  125  DGSLSV  130



>ref|XP_011188336.1| PREDICTED: protein SEC13 homolog [Bactrocera cucurbitae]
Length=316

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +H+  +DYYG  +AT SSD S+K+  V N +    +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHNAVLDYYGLHLATCSSDGSVKVFDVKNGNQIL-VADLKGHQGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVIVWKEG  NEWT+ + +N+H SSVNS+++AP E GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIVWKEGASNEWTKFYEYNNHDSSVNSVAFAPAEYGLILACGSS  126

Query  523  DGNISV  540
            DG+IS+
Sbjct  127  DGSISI  132



>ref|XP_001599879.1| PREDICTED: protein SEC13 homolog [Nasonia vitripennis]
 ref|XP_008207722.1| PREDICTED: protein SEC13 homolog [Nasonia vitripennis]
Length=311

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S S  +A L GH GPVWQ++WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDHSVKIFDLKNGSPSL-VAELKGHQGPVWQIAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+G+LLASCS+D KVI+WKE   +EWT+ +    H SSVNSI+WAPHE+GL LACGSS
Sbjct  67   HPKYGNLLASCSYDRKVIIWKE--LSEWTKIYEHTVHDSSVNSIAWAPHEIGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_011258903.1| PREDICTED: protein SEC13 homolog [Camponotus floridanus]
 gb|EFN66576.1| Protein SEC13-like protein [Camponotus floridanus]
Length=313

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGTQSL-VAVLKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_011160175.1| PREDICTED: protein SEC13 homolog [Solenopsis invicta]
Length=312

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGTQSL-VAVLKGHMGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGDLLASCSYDRKVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSVSI  130



>emb|CCA17819.1| protein transport protein SEC13 putative [Albugo laibachii Nc14]
Length=400

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = +1

Query  88   LHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV  267
            +++  Q  H  IRS       P   I+T H D +HD  +DYYGKR+AT SSD +IKI  V
Sbjct  76   INNFVQSRH--IRSYQSMTAPPVLSIDTQHEDMIHDAQLDYYGKRLATCSSDRTIKIYDV  133

Query  268  SNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFN  447
            +      +   LAGH  PVWQV+WAHPKFG+LLASC++DGKVI+++E + N+W Q +V +
Sbjct  134  TGQ-VQHNEQILAGHQSPVWQVAWAHPKFGALLASCAYDGKVILFREQSLNQWVQIYVSS  192

Query  448  DHKSSVNSISWAPHELGLCLACGSSDGNISV  540
             H SSVN+I+WAPHE GL LAC S+DG IS+
Sbjct  193  FHHSSVNAIAWAPHEYGLVLACASADGTISI  223



>ref|XP_011144386.1| PREDICTED: protein SEC13 homolog [Harpegnathos saltator]
 gb|EFN81265.1| Protein SEC13-like protein [Harpegnathos saltator]
Length=313

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGNQSL-VAELKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKVYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_011053770.1| PREDICTED: protein SEC13 homolog [Acromyrmex echinatior]
 gb|EGI65847.1| Protein SEC13-like protein [Acromyrmex echinatior]
Length=310

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD ++KI  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNTVKIFDLKNGSQSL-VAVLKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSVSI  130



>ref|XP_629794.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54DS8.1|SEC13_DICDI RecName: Full=Protein transport protein SEC13 [Dictyostelium 
discoideum]
 gb|EAL61382.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=301

 Score =   160 bits (406),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            M  Q +++GH D VHD   DYYGK +AT SSD  IKI  V   +  QHL  L GH GPVW
Sbjct  1    MATQNVDSGHEDMVHDAQFDYYGKFLATCSSDKMIKIFDVGGENP-QHLVDLRGHEGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            QV+WAHPKFG +LAS S+D KVIVWKE   N W+  H +  H+ SVNSISWAPHE GL L
Sbjct  60   QVAWAHPKFGKILASASYDRKVIVWKEVGNNSWSIIHQYAGHELSVNSISWAPHEFGLSL  119

Query  508  ACGSSDGNISV  540
            AC SSDG++++
Sbjct  120  ACASSDGSVTI  130



>ref|XP_002127937.1| PREDICTED: protein SEC13 homolog [Ciona intestinalis]
Length=312

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 97/126 (77%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D +HD  MDYYG ++AT SSD +I+I  V  N T + L+TL GH GPVWQ++W+
Sbjct  8    VDTLHEDMIHDAQMDYYGLQLATCSSDRTIRIFEV-KNGTQRLLSTLQGHDGPVWQIAWS  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+  +LASCS+D KVI+WKE +  +W + H +NDH SSVNS+ WAPHELGL LACGSS
Sbjct  67   HPKYDKMLASCSYDRKVIIWKEQD-GQWNKLHEYNDHDSSVNSVCWAPHELGLMLACGSS  125

Query  523  DGNISV  540
            DG++SV
Sbjct  126  DGSVSV  131



>ref|XP_011343632.1| PREDICTED: protein SEC13 homolog [Cerapachys biroi]
Length=311

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG ++AT SSD S+KI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLKLATCSSDNSVKIFDLKNGTQSL-IAVLKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>emb|CCI42360.1| unnamed protein product [Albugo candida]
Length=310

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  151  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  330
            P   I+T H D +HD  +DYYGKR+AT SSD +IKI  V+      +   LAGH  PVWQ
Sbjct  5    PVLSIDTQHEDMIHDAQLDYYGKRLATCSSDRTIKIYDVTGQ-VQHNEQILAGHQSPVWQ  63

Query  331  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA  510
            V+WAHPKFG+LLASC++DGKVI+++E + N+W Q +V + H SSVN+I+WAPHE GL LA
Sbjct  64   VAWAHPKFGALLASCAYDGKVILFREQSLNQWVQIYVSSFHHSSVNAIAWAPHEYGLVLA  123

Query  511  CGSSDGNISV  540
            C S+DG IS+
Sbjct  124  CASADGTISI  133



>ref|XP_007145724.1| hypothetical protein PHAVU_007G2627001g, partial [Phaseolus vulgaris]
 gb|ESW17718.1| hypothetical protein PHAVU_007G2627001g, partial [Phaseolus vulgaris]
Length=86

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 1/87 (1%)
 Frame = +1

Query  148  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  327
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGV NN+ SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGV-NNTASQHLATLTGHQGPVW  59

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKE  408
            QV WAHPKFGSLLASCS+DG+VI+WKE
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVIIWKE  86



>gb|KDR17793.1| SEC13-like protein [Zootermopsis nevadensis]
Length=316

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  +  N T    A L GH+GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDHSVKIYDI-KNGTQTLTADLKGHYGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+G+LLASCS+D +VIVWKE    EW + + ++ H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKYGNLLASCSYDRRVIVWKE--VGEWVKLYEYSSHDSSVNSVAWAPHEFGLMLACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSLSI  130



>ref|XP_008558049.1| PREDICTED: protein SEC13 homolog [Microplitis demolitor]
Length=311

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+K+  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKVFDLKNGSQSL-VADLKGHDGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KV++WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNILASCSYDRKVMIWKE--LGEWTKIYEHTSHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_005186970.1| PREDICTED: protein SEC13 homolog [Musca domestica]
Length=316

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I+TGH D +H+  +DYYG  +AT SSD S+KI  V N +    +A L GH GPVWQV+WA
Sbjct  8    IDTGHEDMIHNAVLDYYGMHLATCSSDGSVKIFDVKNRNQVL-VADLKGHQGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVIVWKEG  N+WT+ + +++H SSVNS+++AP E GL LACGSS
Sbjct  67   HPKFGNILASCSYDRKVIVWKEGGANDWTKLYEYSNHDSSVNSVAFAPSEYGLMLACGSS  126

Query  523  DGNISV  540
            DG+IS+
Sbjct  127  DGSISI  132



>emb|CDS08364.1| hypothetical protein LRAMOSA02312 [Absidia idahoensis var. thermophila]
Length=310

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  336
            Q +ET H D +HD  +DYY +R+ATASSD +IKI  +  +S  + + TL GH  PVWQV+
Sbjct  7    QTVETHHEDMIHDAQLDYYSRRLATASSDHTIKIFDIDGDS-QRLVETLTGHEAPVWQVA  65

Query  337  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  516
            WAHPKFGS+LASCS+DG+V +WKE N N WT+    N H +SVNS++WAPHELG  LAC 
Sbjct  66   WAHPKFGSILASCSYDGRVFIWKEQN-NVWTRIKEHNVHTASVNSVAWAPHELGAMLACA  124

Query  517  SSDGNISV  540
            SSDG ISV
Sbjct  125  SSDGKISV  132



>emb|CDH60247.1| wd40 repeat-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=310

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  336
            Q +ET H D +HD  +DYY +R+ATASSD +IKI  +  +S  + + TL GH  PVWQV+
Sbjct  7    QTVETHHEDMIHDAQLDYYSRRLATASSDHTIKIFDIDGDS-QRLVETLTGHEAPVWQVA  65

Query  337  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  516
            WAHPKFGS+LASCS+DG+V +WKE N N WT+    N H +SVNS++WAPHELG  LAC 
Sbjct  66   WAHPKFGSILASCSYDGRVFIWKEQN-NVWTRIKEHNVHTASVNSVAWAPHELGAMLACA  124

Query  517  SSDGNISV  540
            SSDG ISV
Sbjct  125  SSDGKISV  132



>gb|KIN98473.1| hypothetical protein M404DRAFT_1005321 [Pisolithus tinctorius 
Marx 270]
Length=327

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = +1

Query  148  MPAQ-----KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAG  309
            MPA       +ET H D +HD  +DYYGKR+AT SSD ++K+  + N S S+  + TL G
Sbjct  1    MPAPSSGVVPVETAHDDMIHDAQLDYYGKRLATCSSDRTVKVFDIVNGSPSKAASHTLKG  60

Query  310  HHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ----NEWTQAHVFNDHKSSVNSIS  477
            H GPVWQV+WAHPKFG++LASCS+DGKV +WKE  Q     EWT+      H +SVNSIS
Sbjct  61   HTGPVWQVAWAHPKFGNMLASCSYDGKVFIWKEQAQGTTSGEWTKIEEHALHTASVNSIS  120

Query  478  WAPHELGLCLACGSSDGNISV  540
            WAPHELG  LAC SSDG ISV
Sbjct  121  WAPHELGAILACASSDGKISV  141



>dbj|BAN21266.1| protein transport protein sec13 [Riptortus pedestris]
Length=309

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I+TGH D +HD  +DYYG ++AT SSD S+KI  V N  T   +A L GH+GPVWQVSWA
Sbjct  8    IDTGHEDIIHDAEIDYYGLQLATCSSDNSVKIFSVKN-GTQALIAELKGHYGPVWQVSWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVIVWKEG + EW + H +N+H +SVNS+ + P E GL  ACGSS
Sbjct  67   HPKFGNILASCSYDRKVIVWKEGGK-EWNKIHEYNNHDASVNSVRFGPQEYGLIFACGSS  125

Query  523  DGNISV  540
            DG ISV
Sbjct  126  DGAISV  131



>ref|XP_011306080.1| PREDICTED: protein SEC13 homolog [Fopius arisanus]
Length=310

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGSQSL-VADLKGHVGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+++ASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNIIASCSYDRKVIIWKE--LGEWTKIYEHIGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_011500941.1| PREDICTED: protein SEC13 homolog [Ceratosolen solmsi marchali]
Length=310

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGSQSL-VAELKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVI+WKE   NEWT+ +    H SSVNS +WAPH+ GL LACGSS
Sbjct  67   HPKFGNVLASCSYDRKVIIWKE--LNEWTKIYEHTCHDSSVNSTAWAPHDFGLVLACGSS  124

Query  523  DGNIS  537
            DG+IS
Sbjct  125  DGSIS  129



>ref|XP_003705427.1| PREDICTED: protein SEC13 homolog [Megachile rotundata]
Length=311

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S +  +A L  H GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGSQTL-VANLKEHVGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG++S+
Sbjct  125  DGSVSI  130



>gb|EZA51201.1| SEC13-like protein [Cerapachys biroi]
Length=311

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG ++AT SSD S+KI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLKLATCSSDNSVKIFDLKNGTQSL-IAVLKGHIGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D  VI+WKE    EWT+ +    H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRYVIIWKE--LGEWTKIYEHTGHDSSVNSVAWAPHEFGLILACGSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_002406173.1| vesicle coat complex COPII, subunit SEC13, putative [Ixodes scapularis]
 gb|EEC10267.1| vesicle coat complex COPII, subunit SEC13, putative [Ixodes scapularis]
Length=321

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = +1

Query  145  KMPAQ-----KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAG  309
            ++P Q      ++T HSD VHD   DYYG R+AT SSD S+K+  +  N T + L+ L+G
Sbjct  2    RLPLQASLIHTVDTAHSDMVHDAQTDYYGTRLATCSSDKSVKVFDI-KNGTHKLLSVLSG  60

Query  310  HHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPH  489
            H GPVWQV+WAHP FGS+LASCS+D KV+VW E     W + + + DH SSVNSI WAPH
Sbjct  61   HEGPVWQVAWAHPMFGSVLASCSYDRKVVVWAE-TDGRWDKFYEYADHDSSVNSICWAPH  119

Query  490  ELGLCLACGSSDGNISV  540
            E GL LACGSSDG +SV
Sbjct  120  EFGLVLACGSSDGAVSV  136



>ref|XP_002429091.1| protein transport protein sec13, putative [Pediculus humanus 
corporis]
 gb|EEB16353.1| protein transport protein sec13, putative [Pediculus humanus 
corporis]
Length=361

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
             +TGH D +HD  +DYYG R+AT SSD S+KI  V N + +  LA L GH+GPVWQ+SWA
Sbjct  55   FDTGHEDMIHDAELDYYGLRLATCSSDHSVKIYDVKNGAQTL-LADLKGHYGPVWQISWA  113

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WK+    EW + + +  H SSVNS+ WAP+E GL LACGSS
Sbjct  114  HPKFGNLLASCSYDRKVIIWKD--MGEWKKLYEYPGHDSSVNSVQWAPYEFGLILACGSS  171

Query  523  DGNISV  540
            DG+IS+
Sbjct  172  DGSISI  177



>gb|EFX87077.1| hypothetical protein DAPPUDRAFT_221812 [Daphnia pulex]
Length=311

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  MDYYG R+AT SSD S++I  V  N T    A L GH GPVWQ++WA
Sbjct  8    VDTGHEDMIHDAQMDYYGCRLATCSSDRSVRIYDV-KNGTQTLAADLRGHEGPVWQIAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+D KVI+WKE N  +W + + + +H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPKFGNILASCSYDHKVIIWKEMN-GQWVKFYEYANHDSSVNSVCWAPHDYGLILACGSS  125

Query  523  DGNISV  540
            DG+IS+
Sbjct  126  DGSISI  131



>ref|XP_009269186.1| Protein transport protein SEC13 [Wallemia ichthyophaga EXF-994]
 gb|EOQ99958.1| Protein transport protein SEC13 [Wallemia ichthyophaga EXF-994]
Length=677

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH----LATLAGHHGPV  324
            Q IET H D +HD  +DYYGKR+ATASSD +IKI  +S  + S +     A+L GH GPV
Sbjct  268  QSIETCHQDAIHDAQLDYYGKRLATASSDGTIKITDISQAAESTYGNSNAASLRGHQGPV  327

Query  325  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            WQV+WAHP +GS+LAS S+DGKV +WK+   N WT+      H SSVNSISWAPHELG  
Sbjct  328  WQVAWAHPNYGSILASSSYDGKVFIWKQEQGNSWTRIKDHTLHTSSVNSISWAPHELGPT  387

Query  505  LACGSSDGNISV  540
            LAC SSDGN+SV
Sbjct  388  LACASSDGNVSV  399



>ref|XP_003031195.1| hypothetical protein SCHCODRAFT_76913 [Schizophyllum commune 
H4-8]
 gb|EFI96292.1| hypothetical protein SCHCODRAFT_76913 [Schizophyllum commune 
H4-8]
Length=314

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +1

Query  154  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV  333
            A  IET H D +HD  +DYYGKR+AT SSD ++K+  V+ N  +   +TL GH GPVWQV
Sbjct  9    AVPIETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVTENGATGPGSTLKGHTGPVWQV  68

Query  334  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC  513
            +WAHPKFG +LASCS+DGKV++WKE    +W +      H +SVNS++WAPHELG  LAC
Sbjct  69   AWAHPKFGHILASCSYDGKVLIWKE-TGGQWAKVKEHTLHTASVNSVAWAPHELGAILAC  127

Query  514  GSSDGNISV  540
             SSDG +SV
Sbjct  128  ASSDGKLSV  136



>emb|CCG81563.1| Protein transport protein sec13 [Taphrina deformans PYCC 5710]
Length=306

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  336
            Q IET H++T+HD  +DYYGKR+AT SSD +IKI  VS++ T   + TL GH GPVWQ+S
Sbjct  6    QTIETQHTETLHDAILDYYGKRLATCSSDQTIKIFDVSSSGTQTLIETLRGHEGPVWQLS  65

Query  337  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  516
            WAHPKFG++LAS  +DGKVIVW+E N ++W++      H +SVNS+SWAPHE G  LAC 
Sbjct  66   WAHPKFGNILASAGYDGKVIVWREQN-HQWSKLTEHAIHSASVNSVSWAPHESGAVLACA  124

Query  517  SSDGNISV  540
            S+DG +S+
Sbjct  125  SADGKVSI  132



>gb|EDK99501.1| SEC13-like 1 (S. cerevisiae), isoform CRA_a [Mus musculus]
Length=169

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  4    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  62

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  63   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  121

Query  523  DGNISV  540
            DG IS+
Sbjct  122  DGAISL  127



>ref|XP_002470576.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED84228.1| predicted protein, partial [Postia placenta Mad-698-R]
Length=236

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            IET H D +HD  MDYYGKR+AT SSD ++++  V +  T +   TL GH GPVWQV+WA
Sbjct  10   IETSHEDMIHDAQMDYYGKRIATCSSDRTVRVFDVVDGETPKG-QTLRGHTGPVWQVAWA  68

Query  343  HPKFGSLLASCSFDGKVIVWKE-----GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            HPKFG +LASCS+DGKVI+WKE      +   W +      HK+SVNS+SWAPHELG  L
Sbjct  69   HPKFGHILASCSYDGKVIIWKEQPAQGPSPGGWAKIKEHTLHKASVNSVSWAPHELGAIL  128

Query  508  ACGSSDGNISV  540
            AC SSDG ISV
Sbjct  129  ACASSDGTISV  139



>sp|A5DHD9.2|SEC13_PICGU RecName: Full=Protein transport protein SEC13 [Meyerozyma guilliermondii 
ATCC 6260]
 gb|EDK38592.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=290

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I   H + +HD  +DYYGKR+AT SSD +IKI  V      Q   TL GH GPVWQV+WA
Sbjct  4    IANAHDELIHDAVLDYYGKRLATCSSDKTIKIFEVEGTENYQLTETLVGHEGPVWQVAWA  63

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFGS+LASCS+DGKV+VWKE     W+       H++SVNS+SWAPHELG  L C SS
Sbjct  64   HPKFGSILASCSYDGKVLVWKESPDRSWSIISEHKVHQASVNSVSWAPHELGAVLLCTSS  123

Query  523  DGNISV  540
            DG +SV
Sbjct  124  DGRVSV  129



>gb|EDL91559.1| SEC13-like 1 (S. cerevisiae), isoform CRA_a [Rattus norvegicus]
Length=173

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  523  DGNISV  540
            DG IS+
Sbjct  126  DGAISL  131



>ref|XP_006173389.1| PREDICTED: protein SEC13 homolog [Camelus ferus]
Length=368

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 108/177 (61%), Gaps = 7/177 (4%)
 Frame = +1

Query  16   FPGSDCFSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPA--QKIETGHSDTV  189
             P    F L CS   P++     ++  L  G    +   D+ G+M +    ++T H D +
Sbjct  6    LPSYIPFELLCSHPLPVSTFLKSQVLFLPAG---LVLGKDEMGEMVSVINTVDTSHEDMI  62

Query  190  HDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLA  369
            HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WAHP +G++LA
Sbjct  63   HDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWAHPMYGNILA  121

Query  370  SCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            SCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSSDG IS+
Sbjct  122  SCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSSDGAISL  177



>ref|XP_007848859.1| vesicle budding-related protein [Moniliophthora roreri MCA 2997]
 gb|ESK91794.1| vesicle budding-related protein [Moniliophthora roreri MCA 2997]
Length=343

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA--TLAGHHGPVWQVS  336
            IET H D +HD  +DYYGKR+AT SSD ++K+  V    +S+  A  TL GH GPVWQ++
Sbjct  13   IETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVEGDSSKLSAGQTLKGHTGPVWQIA  72

Query  337  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  516
            W HPKFG +LASCS+DGKV++WKE  Q  WT+      H +SVNSISWAPHELG  LAC 
Sbjct  73   WGHPKFGQILASCSYDGKVLIWKEQPQG-WTKVREHALHTASVNSISWAPHELGPMLACA  131

Query  517  SSDGNISV  540
            SSDG ISV
Sbjct  132  SSDGKISV  139



>ref|XP_005669827.1| PREDICTED: protein SEC13 homolog [Sus scrofa]
Length=158

 Score =   151 bits (382),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  523  DGNISV  540
            DG IS+
Sbjct  126  DGAISL  131



>gb|KIJ19381.1| hypothetical protein PAXINDRAFT_174886 [Paxillus involutus ATCC 
200175]
Length=333

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +1

Query  154  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA--TLAGHHGPVW  327
            A  IET H D +HD  +DYYGKR+AT SSD ++K+  V +   S+     TL GH GPVW
Sbjct  9    AVPIETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVDGEPSKSTMGQTLKGHTGPVW  68

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNE----WTQAHVFNDHKSSVNSISWAPHEL  495
            QV+WAHPKFG++LASCS+DGKV+VW+E  Q      WT+      H +SVNSISWAPHEL
Sbjct  69   QVAWAHPKFGNILASCSYDGKVLVWREQTQGPSAGGWTKVKEHTMHTASVNSISWAPHEL  128

Query  496  GLCLACGSSDGNISV  540
            G  LAC SSDG +SV
Sbjct  129  GAILACASSDGKLSV  143



>gb|ERL92416.1| hypothetical protein D910_09730 [Dendroctonus ponderosae]
Length=331

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++TGH D +HD  +DYYG R+AT SSD S+K+  + N + S  L  L GH GPVWQ++W+
Sbjct  8    VDTGHEDMIHDAEVDYYGLRLATCSSDNSVKVYNIRNGA-SALLDDLKGHFGPVWQIAWS  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D +VI+WKE N+ +W + + + +H SSVNS+ +AP E GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRRVIIWKETNR-KWAKYYEYTNHDSSVNSVQFAPAEFGLILACGSS  125

Query  523  DGNISV  540
            DG+ISV
Sbjct  126  DGSISV  131



>gb|KIY47815.1| protein transporter SEC13 [Fistulina hepatica ATCC 64428]
Length=353

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 103/158 (65%), Gaps = 12/158 (8%)
 Frame = +1

Query  82   PRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKII  261
            PRL +L   D     +SD      A  IET H D +HD  +DYYGKR+AT SSD ++K+ 
Sbjct  10   PRLPNL-SSDSPTATTSD------AVPIETSHEDMIHDAQLDYYGKRLATCSSDRTVKVF  62

Query  262  GVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-----NEW  426
             V + +T+    TL GH GPVWQV+WAHPK+G +LASCS+DGKV++WK+  Q       W
Sbjct  63   DVVDGATTGPGQTLKGHTGPVWQVAWAHPKYGHILASCSYDGKVLIWKQQLQPGTSAGPW  122

Query  427  TQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV  540
            T+      H +SVNS+SWAPHELG  LAC SSDG +SV
Sbjct  123  TKIKEHTLHSASVNSVSWAPHELGAMLACASSDGKLSV  160



>gb|KIK86600.1| hypothetical protein PAXRUDRAFT_831899 [Paxillus rubicundulus 
Ve08.2h10]
Length=333

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +1

Query  154  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL--ATLAGHHGPVW  327
            A  IET H D +HD  +DYYGKR+AT SSD ++K+  V +   S+     TL GH GPVW
Sbjct  9    AVPIETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVDGEASKSTIGQTLKGHTGPVW  68

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNE----WTQAHVFNDHKSSVNSISWAPHEL  495
            QV+WAHPKFG++LASCS+DGKV+VW+E  Q      WT+      H +SVNSISWAPHEL
Sbjct  69   QVAWAHPKFGNILASCSYDGKVLVWREQTQGPSAGGWTKVKEHAMHTASVNSISWAPHEL  128

Query  496  GLCLACGSSDGNISV  540
            G  LAC SSDG +SV
Sbjct  129  GAILACASSDGKLSV  143



>emb|CCM02720.1| predicted protein [Fibroporia radiculosa]
Length=436

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = +1

Query  118  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA  297
             ++ S      PA  IET H D +HD  +DYYGKR+AT SSD ++++  V +    + + 
Sbjct  1    MVKPSTTNAADPA-PIETCHEDMIHDAQLDYYGKRLATCSSDRTVRVFDVVDGEPPKAVQ  59

Query  298  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE-----GNQNEWTQAHVFNDHKSS  462
            TL GH GPVWQV+WAHPKFG +LASCS+DGKVI+WKE      +   W +      HK+S
Sbjct  60   TLKGHTGPVWQVAWAHPKFGHILASCSYDGKVIIWKEQPAQGPSAGGWAKIKEHTLHKAS  119

Query  463  VNSISWAPHELGLCLACGSSDGNISV  540
            VNS+SWAPHELG  LAC SSDG ISV
Sbjct  120  VNSVSWAPHELGAILACASSDGTISV  145



>gb|KIJ67346.1| hypothetical protein HYDPIDRAFT_127263 [Hydnomerulius pinastri 
MD-312]
Length=333

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = +1

Query  154  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA--TLAGHHGPVW  327
            A  IET H D +HD  +DYYGKR+AT SSD ++K+  V +   S+     TL GH GPVW
Sbjct  9    AVPIETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVDGEPSKSTGGQTLKGHTGPVW  68

Query  328  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNE----WTQAHVFNDHKSSVNSISWAPHEL  495
            QV+WAHPKFG++LASCS+DGKV++W+E +Q      WT+      H +SVNS+SWAPHEL
Sbjct  69   QVAWAHPKFGNILASCSYDGKVLIWREQSQGPATGGWTKVKEHTLHTASVNSVSWAPHEL  128

Query  496  GLCLACGSSDGNISV  540
            G  LAC SSDG +SV
Sbjct  129  GAILACASSDGKLSV  143



>ref|XP_004923349.1| PREDICTED: protein SEC13 homolog [Bombyx mori]
Length=313

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I+TGH D +HD  +DYYG ++AT SSD S+KI  +  N T    A L GH GPVWQV+WA
Sbjct  8    IDTGHEDMIHDAELDYYGLKLATCSSDNSVKIYDI-KNGTQTLAADLKGHFGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPK+G+LLASCS+D KVI+WKE    EWT+ + +  H+SSVNS++WAP E GL LAC SS
Sbjct  67   HPKYGNLLASCSYDRKVIIWKE--SGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSS  124

Query  523  DGNISV  540
            DG+IS+
Sbjct  125  DGSISI  130



>ref|XP_002616529.1| hypothetical protein CLUG_03770 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ39642.1| hypothetical protein CLUG_03770 [Clavispora lusitaniae ATCC 42720]
Length=295

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I   H D +HD  +DYYGKR+AT+SSD +IKI  V      + + TL GHHGPVWQV+WA
Sbjct  4    ITDAHEDLIHDAVLDYYGKRLATSSSDKTIKIFDVDGADNYRLVETLVGHHGPVWQVAWA  63

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            HPKFGS+LASCS+DGK I+WKE  +  +W+       H++SVNS+SWAPHELG  L C S
Sbjct  64   HPKFGSILASCSYDGKAIIWKESPETQQWSIIAEHAIHQASVNSVSWAPHELGALLLCTS  123

Query  520  SDGNISV  540
            SDG +SV
Sbjct  124  SDGKVSV  130



>gb|KFM60497.1| Protein SEC13-like protein, partial [Stegodyphus mimosarum]
Length=320

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = +1

Query  157  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  336
            Q ++TGHSD +HD  MDYYG R+AT SSD ++KI  V + S  + +ATL  H  PVWQV+
Sbjct  8    QDVDTGHSDMIHDAQMDYYGIRLATCSSDKTVKIFDVRSGS-QKIVATLKEHDAPVWQVA  66

Query  337  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  516
            WAHP FG +LASCS+D KVI+WKE +  +W   + +  H SSVNS+SWAP+E GL LACG
Sbjct  67   WAHPMFGVILASCSYDRKVIIWKETD-GKWENIYEYTKHDSSVNSLSWAPNEFGLILACG  125

Query  517  SSDGNISV  540
            SSDG++SV
Sbjct  126  SSDGSVSV  133



>gb|EHJ78717.1| putative protein transport protein sec13 [Danaus plexippus]
Length=313

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I+TGH D +HD  +DYYG R+AT SSD S+KI  +  + T    A L GH GPVWQV+WA
Sbjct  8    IDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDI-KSGTQTLAADLKGHFGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG+LLASCS+D KVI+WKE    EWT+ + ++ H+SSVNS++WAP E GL LAC SS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--SGEWTKLYEYSGHESSVNSVAWAPEEYGLILACCSS  124

Query  523  DGNIS  537
            DG+IS
Sbjct  125  DGSIS  129



>gb|EMG50389.1| likely COPII vesicle coat component [Candida maltosa Xu316]
Length=227

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I   H D +HD  +DYYGKR+AT SSD +IKI  +      +   TLAGH GPVWQVSWA
Sbjct  4    IGNAHDDLIHDAVLDYYGKRLATCSSDKTIKIFDLEGTENYKLTTTLAGHEGPVWQVSWA  63

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            HPKFGS+LASCS+DGK ++WKE  +  +W+       H++SVNS+SWAPHELG  L C S
Sbjct  64   HPKFGSILASCSYDGKALIWKEQPETQQWSIIAEHTVHQASVNSVSWAPHELGAVLLCTS  123

Query  520  SDGNISV  540
            SDG +SV
Sbjct  124  SDGKVSV  130



>gb|KFH71651.1| protein transporter SEC13 [Mortierella verticillata NRRL 6337]
Length=314

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQVSW  339
            +ET H D +HD   DYYGKR+AT SSD SI+I  V  +     LA TL GH GPVWQ+SW
Sbjct  8    LETQHEDMIHDAQYDYYGKRLATCSSDRSIRIFNV--DGEDHRLANTLKGHEGPVWQISW  65

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            AHPKFG +LASCS+DGKV +W+E N  +W++      H +SVNS+SWAPHELG  LAC S
Sbjct  66   AHPKFGCILASCSYDGKVFIWREQN-GQWSRIKEHTSHTASVNSVSWAPHELGAMLACAS  124

Query  520  SDGNISV  540
            SDG +SV
Sbjct  125  SDGRVSV  131



>gb|KIK69017.1| hypothetical protein GYMLUDRAFT_188436 [Gymnopus luxurians FD-317 
M1]
Length=342

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA--TLAGHHGPVWQVS  336
            IET H D +HD  +DYYGKR+AT SSD ++K+  V +   S+  A  TL GH GPVWQV+
Sbjct  12   IETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVDGDASKTTAGHTLKGHTGPVWQVA  71

Query  337  WAHPKFGSLLASCSFDGKVIVWKE---GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  507
            WAHPKFG +LASCS+DGKV++WKE   G+   W++      H +SVNS+SWAPHELG  L
Sbjct  72   WAHPKFGHILASCSYDGKVLIWKEQGQGSAGGWSKVGEHTLHTASVNSVSWAPHELGAML  131

Query  508  ACGSSDGNISV  540
            AC SSDG ISV
Sbjct  132  ACASSDGKISV  142



>ref|XP_001845022.1| transport protein SEC13 [Culex quinquefasciatus]
 gb|EDS39038.1| transport protein SEC13 [Culex quinquefasciatus]
Length=326

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSW  339
            I+TGH D +H   +DYYG R+AT SSD S+KI  +   S +Q LA  L GH GPVWQV+W
Sbjct  8    IDTGHEDMIHGAEVDYYGLRLATCSSDNSVKIFDIK--SGAQTLAADLKGHGGPVWQVAW  65

Query  340  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  519
            AHP++G++LASCS+D KVI+WKE    +W++++ +N+H SSVNS++WAP E GL LACGS
Sbjct  66   AHPRYGNILASCSYDRKVIIWKEVGPGDWSKSYEYNNHDSSVNSVAWAPAEYGLILACGS  125

Query  520  SDGNISV  540
            SDG++SV
Sbjct  126  SDGSVSV  132



>gb|KIP02372.1| hypothetical protein PHLGIDRAFT_32221 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=340

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            IET H D +HD  +DYYGKR+AT SSD ++K+  V +  T +   TL GH GPVWQVSWA
Sbjct  16   IETSHEDMIHDAQLDYYGKRLATCSSDRTVKVFDVVDGETQRSGHTLKGHTGPVWQVSWA  75

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNE---WTQAHVFNDHKSSVNSISWAPHELGLCLAC  513
            HPK+G +LASCS+DGKVI+WKE        W +      H +SVNS+SWAPHELG  LAC
Sbjct  76   HPKYGHILASCSYDGKVIIWKEQTGQPGAGWAKVKEHTLHVASVNSVSWAPHELGAILAC  135

Query  514  GSSDGNISV  540
             SSDG ISV
Sbjct  136  ASSDGKISV  144



>ref|XP_003959888.1| hypothetical protein KAFR_0L01440 [Kazachstania africana CBS 
2517]
 emb|CCF60753.1| hypothetical protein KAFR_0L01440 [Kazachstania africana CBS 
2517]
Length=304

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            I   H+D +HD  +DYYGKR+AT SSD +IKI  V   S  + ++TL GH GPVW+V WA
Sbjct  4    ITNAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVEGES-QKLVSTLTGHEGPVWRVDWA  62

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HPKFG++LASCS+DGKVI+WKE N   W+Q  V   H +SVNSI WAPHE G+ L  GSS
Sbjct  63   HPKFGTILASCSYDGKVIIWKEEN-GRWSQIAVHAVHSASVNSIQWAPHEYGVVLLVGSS  121

Query  523  DGNISV  540
            DG ISV
Sbjct  122  DGKISV  127



>gb|KIO17537.1| hypothetical protein M407DRAFT_246718 [Tulasnella calospora MUT 
4182]
Length=345

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            +ET H D +HD  +DYYGKR+AT SSD +IKI  V +        TL GH GPVWQV+W 
Sbjct  13   VETAHEDMIHDAQLDYYGKRLATCSSDRTIKIFDVIDGEKKGAGVTLRGHSGPVWQVAWG  72

Query  343  HPKFGSLLASCSFDGKVIVWKE------GNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  504
            HPK+G++LASCS+DGKV +WKE           WT+   +  H +SVNS+SWAPHELG  
Sbjct  73   HPKYGNILASCSYDGKVFIWKEQAPPSGAASGNWTKIKEYAAHSASVNSVSWAPHELGAI  132

Query  505  LACGSSDGNISV  540
            +ACGSSDG ISV
Sbjct  133  VACGSSDGKISV  144



>ref|XP_001631519.1| predicted protein [Nematostella vectensis]
 gb|EDO39456.1| predicted protein [Nematostella vectensis]
Length=312

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D VHD  MDYYGK++AT SSD +I+I   +    +  +ATL GH GPVWQVSW+
Sbjct  8    VDTSHEDMVHDAQMDYYGKKLATCSSDKTIRIFETTGQQQTL-VATLRGHDGPVWQVSWS  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HP FG+LLASCS+D KVI+WKE +   W +   F +H SSVNSI WAPHE GL LACG+S
Sbjct  67   HPMFGNLLASCSYDRKVIIWKESSSG-WVKLQEFCNHDSSVNSICWAPHEYGLMLACGAS  125

Query  523  DGNISV  540
            DG++S+
Sbjct  126  DGSVSI  131



>ref|NP_988967.1| SEC13 homolog [Xenopus (Silurana) tropicalis]
 gb|AAH61419.1| hypothetical protein MGC76017 [Xenopus (Silurana) tropicalis]
 emb|CAJ82574.1| SEC13-like 1 (S. cerevisiae) [Xenopus (Silurana) tropicalis]
Length=320

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  163  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  342
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA  66

Query  343  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  522
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+LGL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDLGLVLACGSS  125

Query  523  DGNISV  540
            DG IS+
Sbjct  126  DGAISI  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645