BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026P13

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04914.1|  unnamed protein product                                189   6e-58   Coffea canephora [robusta coffee]
ref|XP_008461868.1|  PREDICTED: alanine--tRNA ligase-like               194   3e-57   Cucumis melo [Oriental melon]
ref|XP_009351710.1|  PREDICTED: alanine--tRNA ligase                    201   1e-56   
gb|EPS72880.1|  hypothetical protein M569_01869                         199   4e-56   Genlisea aurea
ref|XP_008340455.1|  PREDICTED: alanine--tRNA ligase                    199   6e-56   Malus domestica [apple tree]
ref|XP_003619276.1|  Alanyl-tRNA synthetase                             198   9e-56   
ref|XP_003607217.1|  Alanyl-tRNA synthetase                             198   1e-55   
ref|XP_011084638.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    198   1e-55   
ref|XP_002277341.1|  PREDICTED: alanine--tRNA ligase                    197   3e-55   Vitis vinifera
emb|CBI27126.3|  unnamed protein product                                197   4e-55   Vitis vinifera
ref|XP_008221037.1|  PREDICTED: alanine--tRNA ligase                    197   5e-55   Prunus mume [ume]
gb|KDO52985.1|  hypothetical protein CISIN_1g001826mg                   196   5e-55   Citrus sinensis [apfelsine]
gb|KDO52986.1|  hypothetical protein CISIN_1g001826mg                   195   6e-55   Citrus sinensis [apfelsine]
gb|KDO52982.1|  hypothetical protein CISIN_1g001826mg                   196   6e-55   Citrus sinensis [apfelsine]
gb|KDO52981.1|  hypothetical protein CISIN_1g001826mg                   196   7e-55   Citrus sinensis [apfelsine]
gb|KDO52984.1|  hypothetical protein CISIN_1g001826mg                   196   7e-55   Citrus sinensis [apfelsine]
gb|KDO52980.1|  hypothetical protein CISIN_1g001826mg                   196   7e-55   Citrus sinensis [apfelsine]
gb|KDO52987.1|  hypothetical protein CISIN_1g001826mg                   195   7e-55   Citrus sinensis [apfelsine]
ref|XP_002531134.1|  alanyl-tRNA synthetase, putative                   196   7e-55   
ref|XP_006437524.1|  hypothetical protein CICLE_v10030624mg             196   7e-55   Citrus clementina [clementine]
gb|KJB50034.1|  hypothetical protein B456_008G149700                    196   8e-55   Gossypium raimondii
emb|CDP16859.1|  unnamed protein product                                184   9e-55   Coffea canephora [robusta coffee]
gb|KDO52983.1|  hypothetical protein CISIN_1g001826mg                   196   9e-55   Citrus sinensis [apfelsine]
ref|XP_011022066.1|  PREDICTED: alanine--tRNA ligase                    196   9e-55   Populus euphratica
ref|XP_007225354.1|  hypothetical protein PRUPE_ppa000923mg             196   9e-55   
gb|KJB50035.1|  hypothetical protein B456_008G149700                    196   9e-55   Gossypium raimondii
ref|XP_004163302.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    196   9e-55   
ref|XP_004148575.1|  PREDICTED: alanine--tRNA ligase-like               196   1e-54   
gb|KJB50038.1|  hypothetical protein B456_008G149700                    195   1e-54   Gossypium raimondii
ref|XP_007043323.1|  Alanyl-tRNA synthetase, putative                   196   1e-54   
gb|KJB50041.1|  hypothetical protein B456_008G149700                    196   1e-54   Gossypium raimondii
gb|KJB50036.1|  hypothetical protein B456_008G149700                    196   1e-54   Gossypium raimondii
gb|KJB50039.1|  hypothetical protein B456_008G149700                    196   1e-54   Gossypium raimondii
ref|XP_009601820.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    196   1e-54   Nicotiana tomentosiformis
gb|KJB50037.1|  hypothetical protein B456_008G149700                    196   2e-54   Gossypium raimondii
gb|KGN58521.1|  hypothetical protein Csa_3G656490                       196   2e-54   Cucumis sativus [cucumbers]
ref|XP_002307181.2|  alanyl-tRNA synthetase family protein              195   2e-54   
ref|XP_010273668.1|  PREDICTED: alanine--tRNA ligase                    195   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009802310.1|  PREDICTED: alanine--tRNA ligase                    195   3e-54   Nicotiana sylvestris
gb|KDP43289.1|  hypothetical protein JCGZ_24210                         194   4e-54   Jatropha curcas
ref|XP_010523577.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    194   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_006347609.1|  PREDICTED: alanine--tRNA ligase-like               193   1e-53   Solanum tuberosum [potatoes]
emb|CBK21983.2|  unnamed protein product                                192   1e-53   Blastocystis hominis
gb|KJB31826.1|  hypothetical protein B456_005G210000                    192   1e-53   Gossypium raimondii
gb|KJB31825.1|  hypothetical protein B456_005G210000                    192   2e-53   Gossypium raimondii
ref|XP_010662077.1|  PREDICTED: alanine--tRNA ligase-like               192   2e-53   Vitis vinifera
emb|CBI26461.3|  unnamed protein product                                192   2e-53   Vitis vinifera
gb|AES89417.2|  alanyl-tRNA synthetase                                  189   2e-53   Medicago truncatula
ref|XP_003607220.1|  Alanyl-tRNA synthetase                             189   2e-53   
ref|XP_004235270.1|  PREDICTED: alanine--tRNA ligase                    192   3e-53   Solanum lycopersicum
ref|XP_003537781.2|  PREDICTED: alanine--tRNA ligase-like isoform X1    192   3e-53   Glycine max [soybeans]
ref|XP_006484669.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    192   3e-53   Citrus sinensis [apfelsine]
ref|XP_006484668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    192   4e-53   
ref|XP_004505726.1|  PREDICTED: alanine--tRNA ligase-like               191   5e-53   Cicer arietinum [garbanzo]
ref|XP_010683781.1|  PREDICTED: alanine--tRNA ligase                    191   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004297751.1|  PREDICTED: alanine--tRNA ligase                    191   7e-53   Fragaria vesca subsp. vesca
gb|AAK70626.1|AC091238_4  Putative cytosolic tRNA-Ala synthetase        182   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005849315.1|  hypothetical protein CHLNCDRAFT_143654             185   2e-52   Chlorella variabilis
ref|XP_010541854.1|  PREDICTED: alanine--tRNA ligase-like               189   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_008778009.1|  PREDICTED: alanine--tRNA ligase-like               189   3e-52   
ref|XP_007131657.1|  hypothetical protein PHAVU_011G031100g             189   5e-52   Phaseolus vulgaris [French bean]
emb|CDY45055.1|  BnaA08g02200D                                          188   7e-52   Brassica napus [oilseed rape]
ref|XP_009107233.1|  PREDICTED: alanine--tRNA ligase                    188   8e-52   Brassica rapa
ref|XP_009386816.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    188   8e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010031895.1|  PREDICTED: alanine--tRNA ligase                    188   1e-51   Eucalyptus grandis [rose gum]
ref|XP_006826671.1|  hypothetical protein AMTR_s00137p00047050          187   2e-51   Amborella trichopoda
gb|EEC66648.1|  hypothetical protein OsI_32912                          186   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010904628.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    186   3e-51   Elaeis guineensis
ref|NP_001185186.1|  Alanyl-tRNA synthetase                             185   5e-51   
ref|XP_006305941.1|  hypothetical protein CARUB_v10011180mg             186   6e-51   Capsella rubella
ref|XP_002894237.1|  cytosolic tRNA-Ala synthetase                      185   6e-51   
emb|CAA80381.1|  cytosolic tRNA-Ala synthetase                          185   6e-51   Arabidopsis thaliana [mouse-ear cress]
pir||S32671  alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali...    185   6e-51
gb|AAD50044.1|AC007980_9  cytosolic tRNA-Ala synthetase                 185   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175439.2|  Alanyl-tRNA synthetase                                185   7e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32273.1|  Alanine--tRNA ligase                                    185   7e-51   Glycine soja [wild soybean]
emb|CAA80380.1|  mitochondrial tRNA-Ala synthetase                      185   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001064254.1|  Os10g0182000                                       185   8e-51   
ref|XP_010927937.1|  PREDICTED: alanine--tRNA ligase-like               185   9e-51   Elaeis guineensis
ref|XP_010479473.1|  PREDICTED: alanine--tRNA ligase                    185   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_001773539.1|  predicted protein                                  184   1e-50   
ref|XP_010463338.1|  PREDICTED: alanine--tRNA ligase-like               185   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010500574.1|  PREDICTED: alanine--tRNA ligase-like               184   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006393173.1|  hypothetical protein EUTSA_v10011205mg             184   1e-50   
ref|XP_006393171.1|  hypothetical protein EUTSA_v10011205mg             184   1e-50   
ref|XP_006393172.1|  hypothetical protein EUTSA_v10011205mg             184   2e-50   Eutrema salsugineum [saltwater cress]
gb|KHN05437.1|  Alanine--tRNA ligase                                    176   2e-50   Glycine soja [wild soybean]
emb|CEG77795.1|  Putative Alanyl-tRNA synthetase                        177   2e-50   Rhizopus microsporus
ref|XP_011396133.1|  Alanine-tRNA ligase                                183   2e-50   Auxenochlorella protothecoides
ref|XP_009147848.1|  PREDICTED: alanine--tRNA ligase-like               184   3e-50   Brassica rapa
emb|CDY22784.1|  BnaA06g02930D                                          184   3e-50   Brassica napus [oilseed rape]
ref|XP_003571715.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    184   3e-50   
emb|CDY42520.1|  BnaC06g03380D                                          183   3e-50   Brassica napus [oilseed rape]
ref|XP_008720639.1|  alanyl-tRNA synthetase                             183   4e-50   Cyphellophora europaea CBS 101466
gb|KDD75735.1|  class II (A) tRNA synthetase                            181   5e-50   Helicosporidium sp. ATCC 50920
emb|CDY29328.1|  BnaA05g15950D                                          182   7e-50   Brassica napus [oilseed rape]
ref|XP_008810673.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    182   7e-50   
ref|XP_008810668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    182   8e-50   Phoenix dactylifera
gb|KIY74247.1|  hypothetical protein CYLTODRAFT_427840                  181   1e-49   Cylindrobasidium torrendii FP15055 ss-10
gb|KIW83490.1|  alanine-tRNA ligase                                     182   1e-49   Fonsecaea pedrosoi CBS 271.37
ref|XP_005537171.1|  alanine--tRNA ligase cytoplasmic                   182   2e-49   Cyanidioschyzon merolae strain 10D
gb|EFW22234.1|  alanyl-tRNA synthetase                                  181   2e-49   Coccidioides posadasii str. Silveira
ref|XP_004983350.1|  PREDICTED: alanine--tRNA ligase-like isoform X3    181   2e-49   
ref|XP_004983349.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    181   3e-49   Setaria italica
gb|EPY51753.1|  cytoplasmic alanine-tRNA ligase Ala1                    181   3e-49   Schizosaccharomyces cryophilus OY26
ref|XP_005645178.1|  hypothetical protein COCSUDRAFT_67160              181   4e-49   Coccomyxa subellipsoidea C-169
ref|XP_004983348.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    181   4e-49   
ref|XP_003079014.1|  SYA_ARATH Alanyl-tRNA synthetase, mitochondr...    181   4e-49   
emb|CEF97732.1|  Thioredoxin-like fold                                  181   4e-49   Ostreococcus tauri
emb|CEG71324.1|  Putative Alanyl-tRNA synthetase                        180   4e-49   Rhizopus microsporus
gb|KGK39868.1|  hypothetical protein JL09_g980                          181   5e-49   Pichia kudriavzevii
ref|XP_001248510.1|  alanyl-tRNA synthetase, cytoplasmic                180   5e-49   Coccidioides immitis RS
emb|CEI92968.1|  Putative Alanyl-tRNA synthetase                        180   5e-49   Rhizopus microsporus
ref|XP_003070819.1|  Alanyl-tRNA synthetase, cytoplasmic , putative     180   5e-49   Coccidioides posadasii C735 delta SOWgp
gb|AFR32145.1|  alanyl-tRNA synthetase                                  180   5e-49   Geotrichum candidum
ref|XP_007759596.1|  alanyl-tRNA synthetase                             180   6e-49   Cladophialophora yegresii CBS 114405
gb|AFR32153.1|  alanyl-tRNA synthetase                                  180   6e-49   Geotrichum candidum
gb|KIX98796.1|  alanine-tRNA ligase                                     180   6e-49   Fonsecaea multimorphosa CBS 102226
gb|EPX70595.1|  cytoplasmic alanine-tRNA ligase Ala1                    180   6e-49   Schizosaccharomyces octosporus yFS286
ref|XP_002504833.1|  alanyl-tRNA synthetase                             179   7e-49   Micromonas commoda
ref|XP_008725247.1|  alanyl-tRNA synthetase                             179   9e-49   Cladophialophora carrionii CBS 160.54
gb|KIX01548.1|  alanine-tRNA ligase                                     179   9e-49   Rhinocladiella mackenziei CBS 650.93
gb|AFW56405.1|  hypothetical protein ZEAMMB73_266824                    173   1e-48   
emb|CDK27200.1|  unnamed protein product                                179   1e-48   Kuraishia capsulata CBS 1993
ref|XP_007724363.1|  alanyl-tRNA synthetase                             179   1e-48   Capronia coronata CBS 617.96
gb|EJK71470.1|  hypothetical protein THAOC_07085                        179   2e-48   Thalassiosira oceanica
ref|XP_011111424.1|  hypothetical protein H072_5555                     179   2e-48   
gb|EGE01186.1|  alanyl-tRNA synthetase                                  178   2e-48   Trichophyton equinum CBS 127.97
ref|XP_002843973.1|  alanyl-tRNA synthetase                             178   2e-48   Microsporum canis CBS 113480
ref|XP_006687556.1|  hypothetical protein CANTEDRAFT_109802             178   2e-48   Yamadazyma tenuis ATCC 10573
gb|EGD95966.1|  alanyl-tRNA synthetase                                  178   2e-48   Trichophyton tonsurans CBS 112818
gb|EZF33517.1|  alanyl-tRNA synthetase                                  178   2e-48   Trichophyton interdigitale H6
emb|CEP13586.1|  hypothetical protein                                   178   2e-48   Parasitella parasitica
gb|EIE82853.1|  alanyl-tRNA synthetase                                  178   3e-48   Rhizopus delemar RA 99-880
gb|AFR32146.1|  alanyl-tRNA synthetase                                  178   3e-48   Geotrichum candidum
gb|KIZ04229.1|  alanyl-tRNA synthetase                                  178   3e-48   Monoraphidium neglectum
ref|XP_007741222.1|  alanyl-tRNA synthetase                             177   3e-48   Cladophialophora psammophila CBS 110553
dbj|BAJ96541.1|  predicted protein                                      177   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIW91962.1|  alanine-tRNA ligase                                     177   4e-48   Cladophialophora bantiana CBS 173.52
ref|XP_001731546.1|  hypothetical protein MGL_1729                      177   4e-48   Malassezia globosa CBS 7966
dbj|GAN03494.1|  alanyl-tRNA synthetase                                 177   5e-48   Mucor ambiguus
ref|XP_002839828.1|  hypothetical protein                               177   5e-48   Tuber melanosporum Mel28
gb|EPB88726.1|  alanyl-tRNA synthetase                                  177   5e-48   Mucor circinelloides f. circinelloides 1006PhL
emb|CDO95315.1|  unnamed protein product                                177   6e-48   Kluyveromyces dobzhanskii CBS 2104
gb|KDN38724.1|  hypothetical protein RSAG8_09274                        176   6e-48   Rhizoctonia solani AG-8 WAC10335
ref|XP_007737759.1|  alanyl-tRNA synthetase                             177   6e-48   Capronia epimyces CBS 606.96
gb|KIW23162.1|  alanine-tRNA ligase                                     177   6e-48   Cladophialophora immunda
gb|EMT18589.1|  Alanyl-tRNA synthetase, mitochondrial                   177   7e-48   
ref|XP_009159895.1|  alanyl-tRNA synthetase                             177   8e-48   Exophiala dermatitidis NIH/UT8656
ref|XP_007582290.1|  putative alanyl-trna synthetase protein            176   8e-48   
emb|CEJ88871.1|  Putative Alanyl-tRNA synthetase                        176   9e-48   Torrubiella hemipterigena
dbj|BAO40758.1|  alanyl-tRNA synthetase                                 176   9e-48   Kluyveromyces marxianus DMKU3-1042
ref|XP_007291338.1|  tRNA synthetase class II                           176   9e-48   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
dbj|BAJ98134.1|  predicted protein                                      177   9e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAP72231.1|  alanyl-tRNA synthetase                                 176   9e-48   Kluyveromyces marxianus
ref|NP_593640.1|  mitochondrial and cytoplasmic alanine-tRNA liga...    176   9e-48   Schizosaccharomyces pombe
ref|XP_011121665.1|  hypothetical protein AOL_s00078g100                176   1e-47   Arthrobotrys oligospora ATCC 24927
ref|XP_455190.1|  hypothetical protein                                  176   1e-47   Kluyveromyces lactis
gb|EIF48501.1|  cytoplasmic alanyl-trna synthetase                      176   1e-47   Brettanomyces bruxellensis AWRI1499
gb|KIW20001.1|  alanine-tRNA ligase                                     176   1e-47   Exophiala spinifera
gb|KIW00804.1|  alanine-tRNA ligase                                     176   1e-47   Verruconis gallopava
ref|XP_001830532.2|  tRNA synthetase class II                           176   1e-47   Coprinopsis cinerea okayama7#130
gb|EPS99866.1|  hypothetical protein FOMPIDRAFT_1024013                 176   1e-47   Fomitopsis pinicola FP-58527 SS1
ref|XP_004199688.1|  Piso0_002228                                       176   2e-47   
gb|KIH58709.1|  alanine--tRNA ligase                                    166   2e-47   Ancylostoma duodenale
ref|XP_004198838.1|  Piso0_002228                                       176   2e-47   
emb|CCX13711.1|  Similar to Alanine--tRNA ligase; acc. no. Q5AQL1       176   2e-47   Pyronema omphalodes CBS 100304
emb|CDH15032.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         176   2e-47   Zygosaccharomyces bailii ISA1307
emb|CDF90599.1|  ZYBA0S07-04786g1_1                                     176   2e-47   Zygosaccharomyces bailii CLIB 213
ref|XP_008662576.1|  PREDICTED: alanine--tRNA ligase                    176   2e-47   Zea mays [maize]
gb|KIV86028.1|  alanine-tRNA ligase                                     176   2e-47   Exophiala sideris
emb|CCA39700.1|  alanyl-tRNA synthetase                                 175   2e-47   Komagataella phaffii CBS 7435
emb|CEL61027.1|  alanyl-tRNA synthetase                                 175   3e-47   Rhizoctonia solani AG-1 IB
ref|XP_002492690.1|  Cytoplasmic alanyl-tRNA synthetase                 175   3e-47   Komagataella phaffii GS115
ref|XP_002173036.1|  cytoplasmic alanine-tRNA ligase Ala1               175   3e-47   Schizosaccharomyces japonicus yFS275
emb|CDH13133.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         175   3e-47   Zygosaccharomyces bailii ISA1307
gb|KIW56168.1|  alanine-tRNA ligase                                     175   3e-47   Exophiala xenobiotica
emb|CCV00729.1|  unnamed protein product                                175   3e-47   Malassezia sympodialis ATCC 42132
ref|XP_002615762.1|  hypothetical protein CLUG_04644                    175   3e-47   Clavispora lusitaniae ATCC 42720
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  176   3e-47   Triticum urartu
ref|XP_002796769.1|  alanyl-tRNA synthetase                             175   3e-47   
gb|KEP53395.1|  alanyl-tRNA synthetase                                  175   4e-47   Rhizoctonia solani 123E
gb|EKG22385.1|  Alanyl-tRNA synthetase class IIc                        175   4e-47   Macrophomina phaseolina MS6
ref|XP_003060777.1|  alanyl-tRNA synthetase                             175   4e-47   Micromonas pusilla CCMP1545
sp|Q5AQL1.2|SYA_EMENI  RecName: Full=Alanine--tRNA ligase; AltNam...    174   4e-47   Aspergillus nidulans FGSC A4
gb|EUC64360.1|  alanyl-tRNA synthetase                                  174   4e-47   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_005710836.1|  Alanine--tRNA ligase                               174   4e-47   Chondrus crispus [carageen]
ref|XP_007779583.1|  alanyl-tRNA synthetase                             174   4e-47   Coniosporium apollinis CBS 100218
gb|EMG50125.1|  Alanyl-tRNA synthetase, putative                        174   4e-47   Candida maltosa Xu316
ref|XP_003957527.1|  hypothetical protein KAFR_0E02390                  174   5e-47   Kazachstania africana CBS 2517
ref|XP_007397053.1|  hypothetical protein PHACADRAFT_258158             174   6e-47   Phanerochaete carnosa HHB-10118-sp
emb|CCJ30352.1|  unnamed protein product                                174   7e-47   Pneumocystis jirovecii
ref|XP_001417607.1|  predicted protein                                  174   7e-47   Ostreococcus lucimarinus CCE9901
gb|KIW65631.1|  alanine-tRNA ligase                                     174   7e-47   Phialophora americana
gb|KHN71931.1|  Alanine--tRNA ligase, cytoplasmic                       164   7e-47   Toxocara canis
ref|XP_003676658.1|  hypothetical protein NCAS_0E02290                  174   9e-47   Naumovozyma castellii CBS 4309
gb|KIW48370.1|  alanine-tRNA ligase                                     174   9e-47   Exophiala oligosperma
ref|XP_002552804.1|  KLTH0D01848p                                       174   9e-47   Lachancea thermotolerans CBS 6340
gb|EHN00072.1|  Ala1p                                                   174   9e-47   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EGA60508.1|  Ala1p                                                   172   1e-46   Saccharomyces cerevisiae FostersO
gb|EJT44225.1|  ALA1-like protein                                       173   1e-46   Saccharomyces kudriavzevii IFO 1802
emb|CCF32573.1|  alanyl-tRNA synthetase                                 173   1e-46   Colletotrichum higginsianum
ref|XP_001643652.1|  hypothetical protein Kpol_1040p7                   173   1e-46   Vanderwaltozyma polyspora DSM 70294
ref|XP_003172403.1|  alanyl-tRNA synthetase                             173   1e-46   Nannizzia gypsea CBS 118893
dbj|GAD98516.1|  alanyl-tRNA synthetase, cytoplasmic                    173   1e-46   Byssochlamys spectabilis No. 5
ref|XP_007872286.1|  alanyl-tRNA synthetase                             173   1e-46   Pneumocystis murina B123
ref|XP_500483.1|  YALI0B04180p                                          173   1e-46   Yarrowia lipolytica CLIB122
gb|KDN64543.1|  putative tRNA synthetase class II                       173   1e-46   Colletotrichum sublineola
gb|KIL94735.1|  hypothetical protein FAVG1_01666                        173   1e-46   Fusarium avenaceum
gb|AAC49007.1|  cytoplasmic alanyl-tRNA synthetase                      173   1e-46   Saccharomyces cerevisiae [brewer's yeast]
gb|EEU07514.1|  Ala1p                                                   173   1e-46   Saccharomyces cerevisiae JAY291
gb|EGA76661.1|  Ala1p                                                   173   2e-46   Saccharomyces cerevisiae Vin13
ref|XP_007377582.1|  alanyl-tRNA synthetase, cytoplasmic                173   2e-46   Spathaspora passalidarum NRRL Y-27907
gb|EDV10897.1|  alanyl-tRNA synthetase                                  173   2e-46   Saccharomyces cerevisiae RM11-1a
ref|NP_014980.3|  alanine--tRNA ligase                                  173   2e-46   Saccharomyces cerevisiae S288C
gb|EDN63655.1|  alanyl-tRNA synthetase                                  173   2e-46   Saccharomyces cerevisiae YJM789
dbj|GAA26640.1|  K7_Ala1p                                               173   2e-46   Saccharomyces cerevisiae Kyokai no. 7
gb|AJP41837.1|  Ala1p                                                   173   2e-46   Saccharomyces cerevisiae YJM1078
ref|XP_002565032.1|  Pc22g10240                                         173   2e-46   Penicillium rubens Wisconsin 54-1255
gb|KGO43717.1|  Translation elongation/initiation factor/Ribosoma...    173   2e-46   Penicillium expansum
gb|EWH16115.1|  Ala1p                                                   173   2e-46   Saccharomyces cerevisiae P283
gb|EKV04967.1|  Alanyl-tRNA synthetase, putative                        173   2e-46   Penicillium digitatum Pd1
gb|KIL68962.1|  hypothetical protein M378DRAFT_71103                    173   2e-46   Amanita muscaria Koide BX008
gb|KDQ21195.1|  hypothetical protein BOTBODRAFT_25615                   172   2e-46   Botryobasidium botryosum FD-172 SS1
sp|P40825.3|SYA_YEAST  RecName: Full=Alanine--tRNA ligase, mitoch...    173   2e-46   Saccharomyces cerevisiae S288C
dbj|GAA89407.1|  alanyl-tRNA synthetase                                 172   2e-46   Aspergillus kawachii IFO 4308
ref|XP_001642960.1|  hypothetical protein Kpol_1071p9                   172   2e-46   Vanderwaltozyma polyspora DSM 70294
ref|XP_002443089.1|  hypothetical protein SORBIDRAFT_08g008230          173   2e-46   Sorghum bicolor [broomcorn]
ref|XP_006966474.1|  predicted protein                                  172   2e-46   Trichoderma reesei QM6a
ref|XP_009262152.1|  hypothetical protein FPSE_10760                    172   2e-46   Fusarium pseudograminearum CS3096
ref|XP_011316641.1|  alanyl-tRNA synthetase                             172   2e-46   Fusarium graminearum PH-1
ref|XP_003053770.1|  predicted protein                                  172   2e-46   [Nectria] haematococca mpVI 77-13-4
gb|KHJ35999.1|  putative alanyl-trna synthetase                         172   2e-46   Erysiphe necator
gb|KGQ88605.1|  alanyl-tRNA synthetase                                  172   2e-46   Candida albicans GC75
gb|EEQ46641.1|  alanyl-tRNA synthetase                                  172   2e-46   Candida albicans WO-1
ref|XP_007833565.1|  Alanine--tRNA ligase                               172   2e-46   Pestalotiopsis fici W106-1
gb|KGR08732.1|  alanyl-tRNA synthetase                                  172   2e-46   Candida albicans P57072
ref|XP_718082.1|  hypothetical protein CaO19.5746                       172   2e-46   Candida albicans SC5314
gb|KHC63511.1|  alanyl-tRNA synthetase                                  172   3e-46   Candida albicans P75016
gb|KHC33201.1|  alanyl-tRNA synthetase                                  172   3e-46   Candida albicans Ca6
gb|KGU04317.1|  alanyl-tRNA synthetase                                  172   3e-46   Candida albicans P87
gb|KGQ84359.1|  alanyl-tRNA synthetase                                  172   3e-46   Candida albicans P94015
gb|KIV89764.1|  alanine-tRNA ligase                                     173   3e-46   Exophiala mesophila
gb|EST08427.1|  alanyl-tRNA synthetase                                  172   3e-46   Kalmanozyma brasiliensis GHG001
gb|EMT61526.1|  Alanyl-tRNA synthetase                                  172   3e-46   Fusarium oxysporum f. sp. cubense race 4
gb|EGU79625.1|  hypothetical protein FOXB_09908                         172   3e-46   Fusarium oxysporum Fo5176
emb|CCT62693.1|  probable alanine--tRNA ligase, cytosolic               172   3e-46   Fusarium fujikuroi IMI 58289
gb|EME44029.1|  hypothetical protein DOTSEDRAFT_44310                   172   3e-46   Dothistroma septosporum NZE10
ref|XP_002421135.1|  alanyl-tRNA synthetase, putative                   172   3e-46   Candida dubliniensis CD36
gb|KIV89765.1|  alanine-tRNA ligase, variant 1                          172   3e-46   Exophiala mesophila
gb|ENH77318.1|  alanyl-trna synthetase                                  172   3e-46   
ref|XP_004335848.1|  alanine-tRNA ligase                                172   3e-46   Acanthamoeba castellanii str. Neff
gb|ESW96567.1|  Alanine--tRNA ligase                                    172   3e-46   Ogataea parapolymorpha DL-1
ref|XP_005830058.1|  hypothetical protein GUITHDRAFT_163919             172   3e-46   Guillardia theta CCMP2712
ref|XP_007286070.1|  alanyl-trna synthetase                             172   3e-46   
emb|CBQ72435.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        172   4e-46   Sporisorium reilianum SRZ2
ref|XP_009493046.1|  alanyl-tRNA synthetase                             172   4e-46   Fonticula alba
gb|KIP06586.1|  hypothetical protein PHLGIDRAFT_128168                  172   4e-46   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_456501.2|  DEHA2A03652p                                          172   5e-46   Debaryomyces hansenii CBS767
gb|EFQ25498.1|  tRNA synthetase class II                                172   5e-46   Colletotrichum graminicola M1.001
gb|EWY93089.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium oxysporum FOSC 3-a
ref|XP_003852188.1|  alanine--tRNA ligase                               171   5e-46   Zymoseptoria tritici IPO323
gb|EXM30177.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXM11972.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXA52140.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium oxysporum f. sp. pisi HDV247
gb|EWZ90926.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium oxysporum f. sp. lycopersici MN25
gb|EWG36790.1|  alanyl-tRNA synthetase                                  172   5e-46   Fusarium verticillioides 7600
gb|EWZ51596.1|  alanyl-tRNA synthetase                                  172   6e-46   Fusarium oxysporum Fo47
ref|XP_001524092.1|  alanyl-tRNA synthetase                             166   6e-46   Lodderomyces elongisporus NRRL YB-4239
ref|XP_007847723.1|  alanyl-trna synthetase                             171   6e-46   
gb|AAA84420.1|  AlaRS A                                                 162   6e-46   Caenorhabditis elegans [roundworm]
gb|KII92325.1|  hypothetical protein PLICRDRAFT_37088                   171   6e-46   Plicaturopsis crispa FD-325 SS-3
ref|XP_007511747.1|  alanyl-tRNA synthetase                             172   6e-46   Bathycoccus prasinos
ref|XP_003030369.1|  hypothetical protein SCHCODRAFT_82606              171   7e-46   Schizophyllum commune H4-8
ref|XP_002296928.1|  alanine-trna ligase                                171   7e-46   Thalassiosira pseudonana CCMP1335
emb|CDR44690.1|  CYFA0S15e01530g1_1                                     171   7e-46   Cyberlindnera fabianii
ref|XP_006676752.1|  hypothetical protein BATDEDRAFT_32863              171   7e-46   Batrachochytrium dendrobatidis JAM81
ref|XP_006670682.1|  alanyl-tRNA synthetase                             171   7e-46   Cordyceps militaris CM01
gb|KGQ12010.1|  Alanine--tRNA ligase                                    171   7e-46   Beauveria bassiana D1-5
ref|XP_008593589.1|  tRNA synthetase class II                           171   7e-46   
gb|KEQ98971.1|  hypothetical protein AUEXF2481DRAFT_62459               171   7e-46   
emb|CAK47129.1|  unnamed protein product                                171   7e-46   
ref|XP_002496623.1|  ZYRO0D04378p                                       171   7e-46   
gb|ERZ95099.1|  hypothetical protein GLOINDRAFT_341419                  171   8e-46   
ref|XP_001486846.1|  hypothetical protein PGUG_00223                    171   8e-46   
ref|XP_011105656.1|  ala1p                                              171   8e-46   
gb|EGA72819.1|  Ala1p                                                   169   9e-46   
ref|XP_003870578.1|  Ala1 alanyl-tRNA synthetase                        171   1e-45   
dbj|GAC93028.1|  alanyl-tRNA synthetase                                 171   1e-45   
ref|XP_005709097.1|  alanyl-tRNA synthetase                             171   1e-45   
ref|XP_003670443.1|  hypothetical protein NDAI_0E03830                  171   1e-45   
gb|EHK40392.1|  hypothetical protein TRIATDRAFT_153342                  171   1e-45   
ref|XP_001398230.2|  alanyl-tRNA synthetase, cytoplasmic                171   1e-45   
ref|XP_007409403.1|  hypothetical protein MELLADRAFT_48072              171   1e-45   
ref|XP_445923.1|  hypothetical protein                                  171   1e-45   
ref|XP_007797550.1|  putative alanyl-trna synthetase protein            171   1e-45   
emb|CDO74931.1|  hypothetical protein BN946_scf184945.g3                171   1e-45   
ref|XP_011388270.1|  putative alanine--tRNA ligase                      171   1e-45   
ref|XP_001877691.1|  predicted protein                                  171   1e-45   
ref|XP_004177771.1|  hypothetical protein TBLA_0A04580                  170   1e-45   
gb|EWC45240.1|  alanine--tRNA ligase                                    170   1e-45   
gb|EGA56826.1|  Ala1p                                                   169   2e-45   
gb|EJU04465.1|  hypothetical protein DACRYDRAFT_20988                   170   2e-45   
gb|EMD37438.1|  hypothetical protein CERSUDRAFT_83193                   170   2e-45   
ref|XP_009547440.1|  hypothetical protein HETIRDRAFT_476425             170   2e-45   
ref|XP_003652306.1|  hypothetical protein THITE_2113640                 170   2e-45   
gb|EKF39507.1|  alanyl-tRNA synthetase, putative                        170   2e-45   
gb|KIM31429.1|  hypothetical protein M408DRAFT_327641                   170   2e-45   
emb|CDI53029.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        170   2e-45   
emb|CDS09810.1|  hypothetical protein LRAMOSA02487                      158   2e-45   
ref|XP_665905.1|  cytosolic tRNA-Ala synthetase                         170   2e-45   
ref|XP_627438.1|  alanyl-tRNA synthetase (with HxxxH domain)            170   2e-45   
gb|EHK25247.1|  hypothetical protein TRIVIDRAFT_72371                   169   2e-45   
dbj|GAK63909.1|  alanyl-tRNA synthetase                                 170   2e-45   
gb|EEH39315.2|  alanyl-tRNA synthetase                                  170   3e-45   
emb|CCE39704.1|  hypothetical protein CPAR2_601240                      169   3e-45   
gb|KHJ91121.1|  alanine--tRNA ligase                                    166   3e-45   
ref|XP_007317881.1|  hypothetical protein SERLADRAFT_361256             169   3e-45   
ref|XP_010755650.1|  alanyl-tRNA synthetase                             170   3e-45   
gb|EEH21600.2|  alanyl-tRNA synthetase                                  169   3e-45   
gb|EMS24060.1|  alanine-tRNA synthetase                                 169   3e-45   
gb|ETS61722.1|  hypothetical protein PaG_04227                          169   3e-45   
dbj|GAC71363.1|  alanyl-trna synthetase                                 169   3e-45   
gb|EGU11988.1|  hypothetical protein RTG_01868                          169   3e-45   
ref|XP_816499.1|  alanyl-tRNA synthetase                                169   4e-45   
ref|XP_810193.1|  alanyl-tRNA synthetase                                169   4e-45   
gb|AGO12026.1|  AaceriADR363Cp                                          169   4e-45   
gb|KDE06114.1|  alanyl-tRNA synthetase                                  169   4e-45   
gb|EKG06983.1|  alanyl-tRNA synthetase, putative                        169   4e-45   
ref|XP_007006963.1|  hypothetical protein TREMEDRAFT_34057              169   4e-45   
emb|CBJ30506.1|  Alanyl-tRNA Synthetase                                 169   4e-45   
ref|XP_001937987.1|  alanyl-tRNA synthetase                             169   5e-45   
gb|ESS63542.1|  alanyl-tRNA synthetase                                  168   5e-45   
ref|XP_002182439.1|  predicted protein                                  169   5e-45   
ref|XP_007266315.1|  hypothetical protein FOMMEDRAFT_167809             169   5e-45   
ref|XP_003304705.1|  hypothetical protein PTT_17354                     169   5e-45   
ref|XP_007929747.1|  hypothetical protein MYCFIDRAFT_57749              169   5e-45   
ref|XP_001261933.1|  alanyl-tRNA synthetase, putative                   169   5e-45   
emb|CCF49697.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        169   5e-45   
ref|XP_009856724.1|  hypothetical protein NEUTE1DRAFT_126487            169   6e-45   
gb|EGZ77942.1|  cytosolic probable alanine--tRNA ligase                 169   6e-45   
gb|AAW24516.1|  SJCHGC03396 protein                                     155   6e-45   
ref|XP_003686912.1|  hypothetical protein TPHA_0H02750                  169   6e-45   
gb|KIM70344.1|  hypothetical protein SCLCIDRAFT_19240                   168   6e-45   
gb|KFH15707.1|  cytosolic tRNA-Ala synthetase                           156   6e-45   
gb|KGO65716.1|  Translation elongation/initiation factor/Ribosoma...    168   7e-45   
ref|XP_001383420.2|  Alanyl-tRNA synthetase, cytoplasmic (Alanine...    168   7e-45   
gb|KDQ57564.1|  hypothetical protein JAAARDRAFT_35260                   168   7e-45   
emb|CCK70315.1|  hypothetical protein KNAG_0E00470                      168   8e-45   
ref|NP_984459.1|  ADR363Cp                                              168   8e-45   
ref|XP_003346257.1|  hypothetical protein SMAC_05794                    168   8e-45   
ref|XP_007914442.1|  putative alanyl-trna synthetase protein            168   8e-45   
ref|XP_747195.1|  alanyl-tRNA synthetase                                168   8e-45   
gb|EFX00948.1|  alanyl-tRNA synthetase                                  169   8e-45   
gb|EDP48921.1|  alanyl-tRNA synthetase, putative                        168   8e-45   
ref|XP_003683463.1|  hypothetical protein TDEL_0H03930                  168   9e-45   
emb|CEP64837.1|  LALA0S14e00408g1_1                                     168   9e-45   
gb|EYE95897.1|  alanyl-tRNA synthetase, cytoplasmic                     168   1e-44   
ref|XP_007803265.1|  Alanine--tRNA ligase                               168   1e-44   
ref|XP_001276490.1|  alanyl-tRNA synthetase, putative                   168   1e-44   
gb|KDO26418.1|  alanyl-tRNA synthetase                                  168   1e-44   
gb|KFH69574.1|  alanyl-tRNA synthetase                                  167   1e-44   
ref|XP_008608777.1|  alanyl-tRNA synthetase                             167   1e-44   
emb|CCE35146.1|  probable alanine--tRNA ligase, cytosolic               167   1e-44   
gb|EXX57273.1|  alanine--tRNA ligase                                    166   1e-44   
gb|ERG86277.1|  alanine--trna cytoplasmic                               167   1e-44   
ref|XP_007590082.1|  tRNA synthetase class II                           168   1e-44   
gb|EMF10929.1|  alanyl-tRNA synthetase                                  167   1e-44   
gb|EPE10223.1|  alanyl-trna synthetase                                  167   2e-44   
dbj|GAM82706.1|  hypothetical protein ANO11243_006900                   167   2e-44   
ref|XP_001826622.2|  alanyl-tRNA synthetase, cytoplasmic                167   2e-44   
emb|CEF67938.1|  Alanine--tRNA ligase, mitochondrial                    167   2e-44   
gb|KIK68832.1|  hypothetical protein GYMLUDRAFT_152556                  167   2e-44   
emb|CDM36177.1|  Alanyl-tRNA synthetase                                 167   2e-44   
gb|ERT02170.1|  alanine-tRNA ligase                                     167   2e-44   
emb|CDJ84213.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    167   2e-44   
ref|XP_003137715.1|  alanyl-tRNA synthetase                             167   2e-44   
gb|KIH88462.1|  alanyl-tRNA synthetase                                  167   2e-44   
ref|XP_003285278.1|  alanyl-tRNA synthetase                             167   2e-44   
ref|XP_001544824.1|  hypothetical protein HCAG_01871                    167   2e-44   
ref|XP_007308256.1|  hypothetical protein STEHIDRAFT_149395             167   2e-44   
ref|XP_008915192.1|  alanine-tRNA ligase                                167   2e-44   
gb|ETI30952.1|  alanine-tRNA ligase                                     167   2e-44   
gb|ETP28900.1|  alanine-tRNA ligase                                     167   2e-44   
gb|ETL78004.1|  alanine-tRNA ligase                                     167   2e-44   
gb|ETK71337.1|  alanine-tRNA ligase                                     167   2e-44   
gb|EGC43441.1|  alanyl-tRNA synthetase                                  167   2e-44   
emb|CCA14233.1|  unnamed protein product                                167   2e-44   
gb|EYB99703.1|  hypothetical protein Y032_0120g894                      167   2e-44   
gb|EER42379.1|  alanyl-tRNA synthetase                                  167   2e-44   
gb|KIK03536.1|  hypothetical protein K443DRAFT_676709                   167   2e-44   
emb|CDJ87289.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    167   2e-44   
ref|XP_002548433.1|  alanyl-tRNA synthetase                             165   3e-44   
ref|XP_007864521.1|  hypothetical protein GLOTRDRAFT_110560             167   3e-44   
ref|NP_491281.1|  Protein AARS-2                                        167   3e-44   
ref|XP_003104792.1|  CRE-AARS-2 protein                                 167   3e-44   
ref|XP_002646367.1|  C. briggsae CBR-ARS-2 protein                      167   3e-44   
gb|EGT32559.1|  hypothetical protein CAEBREN_22812                      167   3e-44   
gb|EGT52396.1|  hypothetical protein CAEBREN_18885                      166   3e-44   
gb|KIJ65049.1|  hypothetical protein HYDPIDRAFT_27780                   166   3e-44   
ref|XP_008023565.1|  hypothetical protein SETTUDRAFT_128760             166   3e-44   
gb|EWM22315.1|  alanyl-trna synthetase                                  165   3e-44   
ref|XP_003328904.2|  alanyl-tRNA synthetase                             166   4e-44   
gb|EUN26754.1|  hypothetical protein COCVIDRAFT_99918                   166   4e-44   
ref|XP_007708998.1|  hypothetical protein COCCADRAFT_2304               166   4e-44   
ref|XP_007696730.1|  hypothetical protein COCSADRAFT_83417              166   4e-44   
gb|KFH45464.1|  Alanine--tRNA ligase-like protein                       166   4e-44   
gb|EJW87808.1|  alanyl-tRNA synthetase                                  166   4e-44   
gb|EQL02007.1|  alanyl-tRNA synthetase                                  166   4e-44   
gb|KFX85693.1|  hypothetical protein V490_09480                         166   4e-44   
ref|XP_007878798.1|  hypothetical protein PFL1_03091                    166   4e-44   
emb|CBN75498.1|  Alanyl-tRNA Synthetase                                 167   4e-44   
gb|KFY78954.1|  hypothetical protein V499_01993                         166   4e-44   
gb|KFZ01012.1|  hypothetical protein V501_10282                         166   4e-44   
gb|ELQ36554.1|  alanyl-tRNA synthetase                                  166   4e-44   
ref|XP_009033626.1|  hypothetical protein AURANDRAFT_52432              166   5e-44   
gb|KEQ82195.1|  alanyl-tRNA synthetase                                  166   5e-44   
gb|KIK48384.1|  hypothetical protein CY34DRAFT_71989                    166   5e-44   
ref|XP_001899825.1|  Alanyl-tRNA synthetase                             166   5e-44   
gb|KID97622.1|  alanyl-tRNA synthetase                                  166   6e-44   
gb|KID89744.1|  alanyl-tRNA synthetase                                  166   6e-44   
gb|KFG77953.1|  alanyl-tRNA synthetase                                  166   6e-44   
ref|XP_007816858.1|  alanyl-tRNA synthetase                             166   6e-44   
ref|XP_009843450.1|  alanine-tRNA ligase                                166   6e-44   
ref|XP_008088300.1|  Class II aaRS and biotin synthetase                166   6e-44   
gb|EMD94462.1|  hypothetical protein COCHEDRAFT_1131083                 166   6e-44   
ref|XP_007813739.1|  alanyl-tRNA synthetase                             166   6e-44   
emb|CCI40732.1|  unnamed protein product                                167   6e-44   
ref|XP_002290312.1|  alanine-trna ligase                                166   6e-44   
ref|XP_007763572.1|  hypothetical protein CONPUDRAFT_115791             166   6e-44   
gb|KDQ33558.1|  hypothetical protein PLEOSDRAFT_1091537                 166   6e-44   
ref|XP_009021139.1|  hypothetical protein HELRODRAFT_100946             166   7e-44   
gb|KIJ21967.1|  hypothetical protein PAXINDRAFT_165291                  166   7e-44   
emb|CCC48230.1|  putative alanyl-tRNA synthetase                        166   7e-44   
gb|ELR05884.1|  alanyl-tRNA synthetase                                  166   8e-44   
ref|XP_642382.1|  alanyl-tRNA synthetase                                165   8e-44   
gb|KEQ76924.1|  alanyl-tRNA synthetase                                  165   9e-44   
ref|XP_007684762.1|  hypothetical protein COCMIDRAFT_86343              165   9e-44   
gb|EHK97392.1|  putative Alanyl-tRNA synthetase                         165   9e-44   
ref|XP_002018701.1|  GL25810                                            165   9e-44   
ref|XP_001795116.1|  hypothetical protein SNOG_04704                    165   9e-44   
gb|AAF05592.1|AF188717_1  alanyl-tRNA synthetase                        165   1e-43   
gb|KFY84188.1|  hypothetical protein V500_09520                         165   1e-43   
gb|KIY44323.1|  hypothetical protein FISHEDRAFT_77527                   165   1e-43   
ref|XP_845193.1|  alanyl-tRNA synthetase                                165   1e-43   
emb|CCW66342.1|  unnamed protein product                                165   1e-43   
ref|XP_003361352.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    155   1e-43   
gb|KIK96545.1|  hypothetical protein PAXRUDRAFT_825820                  165   1e-43   
gb|EEQ85258.1|  alanyl-tRNA synthetase                                  165   1e-43   
ref|XP_009516106.1|  hypothetical protein PHYSODRAFT_473521             165   1e-43   
ref|XP_002628910.1|  alanyl-tRNA synthetase                             165   1e-43   
gb|EPS26059.1|  hypothetical protein PDE_00995                          165   1e-43   
gb|EZF12729.1|  alanyl-tRNA synthetase                                  152   1e-43   
gb|KDR75441.1|  hypothetical protein GALMADRAFT_249500                  165   1e-43   
ref|XP_002183027.1|  predicted protein                                  165   1e-43   
ref|XP_001694980.1|  predicted protein                                  163   1e-43   
ref|XP_008866966.1|  alanine-tRNA ligase                                165   1e-43   
ref|XP_003397717.1|  PREDICTED: alanyl-tRNA synthetase, cytoplasm...    165   1e-43   
ref|XP_003488850.1|  PREDICTED: alanyl-tRNA synthetase, cytoplasm...    165   1e-43   
ref|XP_002900511.1|  alanyl-tRNA synthetase, mitochondrial precursor    164   2e-43   
emb|CCW61998.1|  unnamed protein product                                164   2e-43   
ref|XP_002057564.1|  GJ18196                                            164   2e-43   
ref|XP_001357433.1|  GA12250                                            164   2e-43   
ref|XP_007353910.1|  hypothetical protein AURDEDRAFT_116636             164   2e-43   
ref|XP_003838816.1|  similar to alanyl-tRNA synthetase                  164   2e-43   
gb|EQL37596.1|  alanyl-tRNA synthetase                                  164   2e-43   
ref|XP_002675895.1|  alanyl-tRNA synthetase                             164   2e-43   
gb|EGE78320.1|  alanyl-tRNA synthetase                                  164   2e-43   
ref|XP_009901919.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    161   2e-43   
ref|XP_011270692.1|  alanyl-tRNA synthetase                             164   3e-43   
dbj|GAM38798.1|  alanine-tRNA ligase                                    164   3e-43   
gb|KEZ41504.1|  Alanyl-tRNA synthetase                                  164   3e-43   
ref|XP_965697.3|  alanyl-tRNA synthetase                                164   3e-43   
gb|KHE90003.1|  hypothetical protein GE21DRAFT_743                      164   3e-43   
ref|XP_001683305.1|  putative alanyl-tRNA synthetase                    164   3e-43   
ref|XP_006956391.1|  hypothetical protein WALSEDRAFT_31222              164   3e-43   
ref|XP_001465654.1|  putative alanyl-tRNA synthetase                    164   3e-43   
ref|XP_318757.4|  AGAP009701-PA                                         163   4e-43   
ref|XP_009216994.1|  alanyl-tRNA synthetase                             164   4e-43   
ref|XP_005102630.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    163   4e-43   
gb|KDN40606.1|  hypothetical protein K437DRAFT_258595                   163   4e-43   
gb|ESL08568.1|  alanyl-tRNA synthetase                                  163   4e-43   
gb|KFA63023.1|  hypothetical protein S40285_07244                       163   5e-43   
gb|KIO08494.1|  hypothetical protein M404DRAFT_14520                    163   5e-43   
gb|KFM75814.1|  Alanine--tRNA ligase, cytoplasmic                       154   5e-43   
ref|XP_679250.1|  alanine--tRNA ligase                                  163   5e-43   
ref|XP_001950431.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       163   5e-43   
ref|XP_007362527.1|  hypothetical protein DICSQDRAFT_51965              163   5e-43   
emb|CCD81172.1|  putative alanyl-tRNA synthetase                        163   5e-43   
ref|XP_731046.1|  alanyl-tRNA synthetase                                164   5e-43   
ref|XP_006461020.1|  hypothetical protein AGABI2DRAFT_192563            163   5e-43   
ref|XP_007328463.1|  hypothetical protein AGABI1DRAFT_112599            163   5e-43   
gb|ETB61123.1|  alanine-tRNA ligase                                     164   6e-43   
emb|CDR14283.1|  alanine--tRNA ligase, putative                         163   6e-43   
ref|XP_004533955.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    163   7e-43   
ref|XP_395392.3|  PREDICTED: alanine--tRNA ligase, cytoplasmic-li...    163   7e-43   
gb|ENN77299.1|  hypothetical protein YQE_06125                          162   7e-43   
ref|XP_002433758.1|  alanyl-tRNA synthetase, putative                   154   7e-43   
gb|EUD73548.1|  alanyl-tRNA synthetase                                  163   7e-43   
ref|XP_008624155.1|  alanyl-tRNA synthetase                             163   7e-43   



>emb|CDP04914.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   189 bits (479),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+S+VR+TF+ FFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  1    MDWPASRVRETFVNFFEGKGHFNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTP  60

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  61   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  102



>ref|XP_008461868.1| PREDICTED: alanine--tRNA ligase-like [Cucumis melo]
Length=364

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G+EWP+ +VRDTF +FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPAERVRDTFFRFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  184



>ref|XP_009351710.1| PREDICTED: alanine--tRNA ligase [Pyrus x bretschneideri]
Length=952

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E  GLEWP+ +VRDTF+KFFE KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  5    ESQGLEWPAKRVRDTFVKFFEEKAHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>gb|EPS72880.1| hypothetical protein M569_01869, partial [Genlisea aurea]
Length=950

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  10   EWPANRVRDTFIKFFEGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTEL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_008340455.1| PREDICTED: alanine--tRNA ligase [Malus domestica]
Length=1015

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E  GLEWP+ +VRDTF+KFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  68   ESQGLEWPAKRVRDTFVKFFEEKGHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  127

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  128  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  173



>ref|XP_003619276.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=900

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_003607217.1| Alanyl-tRNA synthetase [Medicago truncatula]
 gb|AES89414.1| alanine-tRNA ligase [Medicago truncatula]
Length=950

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_011084638.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Sesamum 
indicum]
Length=1012

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VR+TFIKFF+ KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  84   EWPATRVRETFIKFFQDKAHVNWKSSPVVPYNDPTLLFANAGMNQFKPIFLGTADPNTEL  143

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  144  SKLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  184



>ref|XP_002277341.1| PREDICTED: alanine--tRNA ligase [Vitis vinifera]
Length=1002

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTFI FFESK H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  56   VEWPANKVRDTFINFFESKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>emb|CBI27126.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTFI FFESK H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  9    VEWPANKVRDTFINFFESKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  68

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  69   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_008221037.1| PREDICTED: alanine--tRNA ligase [Prunus mume]
Length=1025

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  78   ESMGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  137

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  138  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  183



>gb|KDO52985.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=936

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52986.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=844

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52982.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=995

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52981.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=972

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52984.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=957

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52980.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1002

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KDO52987.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=787

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis]
Length=1025

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  79   MEWPAKKVRDTFISFFEDKKHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  138

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  139  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  180



>ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
 gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
Length=1001

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|KJB50034.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=927

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>emb|CDP16859.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   184 bits (466),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+S+VR+TF  FFE K H   KSS VVP+NDPTLLF NAGMNQFKPIFLGTVDPNT L
Sbjct  81   DWPASRVRETFFNFFEGKNHVNWKSSAVVPLNDPTLLFVNAGMNQFKPIFLGTVDPNTPL  140

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  141  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  181



>gb|KDO52983.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1009

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_011022066.1| PREDICTED: alanine--tRNA ligase [Populus euphratica]
Length=1008

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  62   VDWPANRVRDTFIKFFEEKKHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  121

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  122  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  163



>ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
 gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
Length=960

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLG  D
Sbjct  5    ESKGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGAAD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>gb|KJB50035.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=930

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Cucumis 
sativus]
Length=956

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  8    GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  67

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  68   SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumis sativus]
Length=956

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  8    GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  67

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  68   SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>gb|KJB50038.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
 gb|KJB50040.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=941

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
 gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
Length=1015

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTF KFFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  65   MEWPAKKVRDTFFKFFEGKNHVNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTA  124

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  125  MSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  166



>gb|KJB50041.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=997

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>gb|KJB50036.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1010

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>gb|KJB50039.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1001

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_009601820.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Nicotiana tomentosiformis]
Length=1027

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            + A LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VD
Sbjct  77   QSAELEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVD  136

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PN+ LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  137  PNSPLSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  182



>gb|KJB50037.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1070

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>gb|KGN58521.1| hypothetical protein Csa_3G656490 [Cucumis sativus]
Length=1030

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  184



>ref|XP_002307181.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE94177.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
Length=967

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  12   VDWPANRVRDTFIKFFEEKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  71

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  72   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  113



>ref|XP_010273668.1| PREDICTED: alanine--tRNA ligase [Nelumbo nucifera]
Length=1038

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+S+VRDTF+ FFE K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  89   VEWPASRVRDTFLSFFEGKGHVNWNSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTS  148

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  149  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  190



>ref|XP_009802310.1| PREDICTED: alanine--tRNA ligase [Nicotiana sylvestris]
Length=1014

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  81   LEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  140

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  141  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  182



>gb|KDP43289.1| hypothetical protein JCGZ_24210 [Jatropha curcas]
Length=1019

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  73   VEWPAKKVRDTFISFFEDKNHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  132

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  133  LSKLIRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  174



>ref|XP_010523577.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523578.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523579.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Tarenaya hassleriana]
Length=1003

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDTFIKFFE K H   KSSPVVP +DPTLLFANAGMNQFKPIFLGTVD
Sbjct  56   ESSEIQWPARRVRDTFIKFFEGKGHVNWKSSPVVPHSDPTLLFANAGMNQFKPIFLGTVD  115

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  PNTALSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum]
Length=1009

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP++KVR+TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  63   LDWPANKVRETFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  122

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  123  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  164



>emb|CBK21983.2| unnamed protein product [Blastocystis hominis]
Length=935

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            LEWPS+KVR TFI+FFE + HT VKSSPVVP++DPTLLFANAGMNQ+KPIFLG VDP++ 
Sbjct  7    LEWPSAKVRQTFIEFFEERGHTFVKSSPVVPLDDPTLLFANAGMNQYKPIFLGQVDPSSP  66

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L+KLKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  67   LAKLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  108



>gb|KJB31826.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=974

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  166



>gb|KJB31825.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=1015

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  166



>ref|XP_010662077.1| PREDICTED: alanine--tRNA ligase-like [Vitis vinifera]
Length=955

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>emb|CBI26461.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>gb|AES89417.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_003607220.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase [Solanum lycopersicum]
Length=1010

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  64   LDWPANKVRQTFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  123

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  124  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  165



>ref|XP_003537781.2| PREDICTED: alanine--tRNA ligase-like isoform X1 [Glycine max]
Length=999

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E   +EWP+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  54   ETHDVEWPAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  113

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  114  PNTALSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  159



>ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis]
Length=1002

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis]
Length=1009

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_004505726.1| PREDICTED: alanine--tRNA ligase-like [Cicer arietinum]
Length=990

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT+IKFF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  50   DWPAKRVRDTYIKFFQEKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTSL  109

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  110  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  150



>ref|XP_010683781.1| PREDICTED: alanine--tRNA ligase [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++W ++KVRDTFIKFFE K+HT  KSSPVVP NDPTLLFANAGMNQ+KPIFLGT+DPN+ 
Sbjct  61   VDWSATKVRDTFIKFFEGKSHTFWKSSPVVPHNDPTLLFANAGMNQYKPIFLGTIDPNSP  120

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LS +KRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  121  LSVMKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  162



>ref|XP_004297751.1| PREDICTED: alanine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=1002

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  93   VPPLDTLLRRRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKS  272
            +PP   L R R  S   +TS    +   + +  G+EWP+++VRDTF  +F  K H   KS
Sbjct  25   LPPPSHLTRNRSLSAIATTSFHPKMPGLESQAVGVEWPANRVRDTFFSYFMEKEHKNYKS  84

Query  273  SPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDV  452
            SPVVP NDPTLLFANAGMNQFKPIFLGT DPNT+LSKL RAC+TQKCIRAGGKHNDL+DV
Sbjct  85   SPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTDLSKLTRACNTQKCIRAGGKHNDLEDV  144

Query  453  GKDTYHHTFFEMLGNW  500
            GKDTYHHTFFEMLGNW
Sbjct  145  GKDTYHHTFFEMLGNW  160



>gb|AAK70626.1|AC091238_4 Putative cytosolic tRNA-Ala synthetase [Oryza sativa Japonica 
Group]
Length=351

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_005849315.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
 gb|EFN57213.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
Length=524

 Score =   185 bits (470),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            LEWP ++VR TF++FF  K HT V SSPVVPVNDPTLL  NAGMNQFKPIFLGTVDPN++
Sbjct  11   LEWPVARVRSTFVEFFVGKQHTAVSSSPVVPVNDPTLL--NAGMNQFKPIFLGTVDPNSD  68

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +KLKRA ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  69   FAKLKRAANSQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNW  110



>ref|XP_010541854.1| PREDICTED: alanine--tRNA ligase-like [Tarenaya hassleriana]
Length=1003

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDTFI+FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  61   QWPARRVRDTFIEFFQGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTAL  120

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  121  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_008778009.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778010.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778012.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778013.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778014.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
Length=991

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A +EWP+SKVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  45   AAMEWPASKVRETFIRFFEGKGHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  104

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  105  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  148



>ref|XP_007131657.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
 gb|ESW03651.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
Length=996

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + +EWP+ +VRDTF+ FFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  51   ETSDVEWPAKRVRDTFMSFFEGKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  110

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  PNTGLSKLSRAYNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  156



>emb|CDY45055.1| BnaA08g02200D [Brassica napus]
Length=993

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  120  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  299
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  300  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  479
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  480  FEMLGNW  500
            FEMLGNW
Sbjct  146  FEMLGNW  152



>ref|XP_009107233.1| PREDICTED: alanine--tRNA ligase [Brassica rapa]
Length=997

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  120  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  299
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  300  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  479
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  480  FEMLGNW  500
            FEMLGNW
Sbjct  146  FEMLGNW  152



>ref|XP_009386816.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Musa acuminata subsp. malaccensis]
Length=990

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E   +EWP++KVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+
Sbjct  41   EATPVEWPATKVRETFIRFFEGKEHVDWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVN  100

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            P T L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  101  PTTPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  146



>ref|XP_010031895.1| PREDICTED: alanine--tRNA ligase [Eucalyptus grandis]
 gb|KCW51291.1| hypothetical protein EUGRSUZ_J00856 [Eucalyptus grandis]
Length=1046

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+S+VRDTFIKFFE K H    SSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDP+  L
Sbjct  101  KWPASRVRDTFIKFFEGKRHVNWPSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPSNPL  160

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  161  GKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  201



>ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
 gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
Length=996

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A ++WP+++VR+TFI FFE K H   KSSPVVPV+DPTLLFANAGMNQFKPIFLGTV P 
Sbjct  49   AAMDWPANRVRETFITFFEQKGHVNWKSSPVVPVDDPTLLFANAGMNQFKPIFLGTVHPG  108

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            T L KLKR C+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  109  TPLGKLKRVCNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  152



>gb|EEC66648.1| hypothetical protein OsI_32912 [Oryza sativa Indica Group]
Length=953

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_010904628.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Elaeis 
guineensis]
Length=995

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A +EWP SKVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  49   ATMEWPGSKVRETFISFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  108

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  109  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  152



>ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=963

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_006305941.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
 gb|EOA38839.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
Length=1003

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K+H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  53   EPSEIQWPAKRVRDTYFDFFKGKSHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  112

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  113  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  158



>ref|XP_002894237.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70496.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
Length=955

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPARRVRDTYVDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>emb|CAA80381.1| cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
Length=955

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana  (fragment)
Length=989

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  44   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  103

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  104  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  144



>gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
 gb|AAO00886.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68246.1| At1g50200 [Arabidopsis thaliana]
Length=955

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|NP_175439.2| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 sp|P36428.3|SYA_ARATH RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32524.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=1003

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  58   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  117

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  118  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  158



>gb|KHN32273.1| Alanine--tRNA ligase, partial [Glycine soja]
Length=919

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  204  PSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  383
            P+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT LSK
Sbjct  1    PAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTALSK  60

Query  384  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  61   LSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  99



>emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana]
Length=1003

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  58   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  117

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  118  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  158



>ref|NP_001064254.1| Os10g0182000 [Oryza sativa Japonica Group]
 gb|ABG65948.1| Alanyl-tRNA synthetase, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26168.1| Os10g0182000 [Oryza sativa Japonica Group]
 dbj|BAG89937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=999

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+  L
Sbjct  52   EWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDAPL  111

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  112  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  152



>ref|XP_010927937.1| PREDICTED: alanine--tRNA ligase-like [Elaeis guineensis]
Length=995

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+SKVR+TF +FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P   
Sbjct  51   MEWPASKVRETFFRFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPANP  110

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  LGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  152



>ref|XP_010479473.1| PREDICTED: alanine--tRNA ligase [Camelina sativa]
Length=1006

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_001773539.1| predicted protein [Physcomitrella patens]
 gb|EDQ61577.1| predicted protein [Physcomitrella patens]
Length=937

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP+++VR+TF  FFESK HT V SSPVVPV+DPTLLFANAGMNQFKPIFLGTVDP +   
Sbjct  7    WPANRVRETFNSFFESKNHTFVPSSPVVPVDDPTLLFANAGMNQFKPIFLGTVDPRSARG  66

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  67   NLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_010463338.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1050

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  57   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  116

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  117  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  162



>ref|XP_010500574.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1006

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  161



>ref|XP_006393173.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30459.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1005

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  156



>ref|XP_006393171.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30457.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=994

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  156



>ref|XP_006393172.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30458.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1001

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  156



>gb|KHN05437.1| Alanine--tRNA ligase [Glycine soja]
Length=324

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E   +EWP+ +VRDTF  FF+ K H   KSSPVVP NDPTLLF N GMNQFKPIFLGT D
Sbjct  5    ETHDVEWPAKRVRDTFFIFFQDKNHVNWKSSPVVPFNDPTLLFVNPGMNQFKPIFLGTAD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTGLSKLSRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>emb|CEG77795.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=401

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  105



>ref|XP_011396133.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM23263.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
Length=926

 Score =   183 bits (465),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP S VR TFI FF+SK HT   SSPVVPVNDPTLLF+NAGMNQ+KPIFLGTVDP ++L
Sbjct  6    DWPGSVVRSTFIDFFKSKGHTFNPSSPVVPVNDPTLLFSNAGMNQYKPIFLGTVDPASDL  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA + QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  66   GKLKRATNAQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  106



>ref|XP_009147848.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=999

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  154



>emb|CDY22784.1| BnaA06g02930D [Brassica napus]
Length=999

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  154



>ref|XP_003571715.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Brachypodium 
distachyon]
Length=993

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ +VR+TFI+++ESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  43   EWPARRVRETFIQYYESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  102

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  103  GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  143



>emb|CDY42520.1| BnaC06g03380D [Brassica napus]
Length=947

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  51   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  110

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  111  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  152



>ref|XP_008720639.1| alanyl-tRNA synthetase [Cyphellophora europaea CBS 101466]
 gb|ETN37107.1| alanyl-tRNA synthetase [Cyphellophora europaea CBS 101466]
Length=963

 Score =   183 bits (464),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + +VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   EWSAQQVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   GQWKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|KDD75735.1| class II (A) tRNA synthetase, partial [Helicosporidium sp. ATCC 
50920]
Length=721

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            M+  EWP+++VR TF+ FF SK HT V SS VVP+NDPTLLF NAGMNQFKP+FLGT DP
Sbjct  1    MSAAEWPAARVRSTFLDFFRSKEHTIVPSSAVVPLNDPTLLFTNAGMNQFKPLFLGTADP  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +++ KLKRA DTQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  61   KSDMGKLKRAADTQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNW  105



>emb|CDY29328.1| BnaA05g15950D [Brassica napus]
Length=928

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP+L FANAGMNQ+KPIFLGT D
Sbjct  5    EPSEIKWPAKRVRDTYFDFFKGKGHKFWASSPVVPHNDPSLFFANAGMNQYKPIFLGTAD  64

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  65   PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  110



>ref|XP_008810673.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Phoenix dactylifera]
Length=983

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  150



>ref|XP_008810668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Phoenix dactylifera]
Length=993

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  150



>gb|KIY74247.1| hypothetical protein CYLTODRAFT_427840 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=953

 Score =   181 bits (460),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WPS+ VRD F KFF+SK HT V SSP +P  DPTLLFANAGMNQ+K IFLGTVDP++E++
Sbjct  10   WPSATVRDEFFKFFKSKGHTYVASSPTIPYEDPTLLFANAGMNQYKSIFLGTVDPHSEMA  69

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  70   KLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  109



>gb|KIW83490.1| alanine-tRNA ligase [Fonsecaea pedrosoi CBS 271.37]
Length=963

 Score =   182 bits (461),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVRDTFIK+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  12   EWTAPKVRDTFIKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  71

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + +R  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  72   GQYRRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  112



>ref|XP_005537171.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81135.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
Length=1061

 Score =   182 bits (461),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WPSS+VR TFI +F  + HT V+SSPVVP +DPTLLF NAGMNQFKP+FLG VDP + L 
Sbjct  23   WPSSRVRQTFIDYFIDRGHTFVESSPVVPFDDPTLLFTNAGMNQFKPLFLGRVDPTSPLF  82

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRAC+TQKC+RAGGKHNDLDDVG+DTYHHTFFEMLGNW
Sbjct  83   GLKRACNTQKCVRAGGKHNDLDDVGRDTYHHTFFEMLGNW  122



>gb|EFW22234.1| alanyl-tRNA synthetase [Coccidioides posadasii str. Silveira]
Length=964

 Score =   181 bits (459),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  13   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  72

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  73   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  114



>ref|XP_004983350.1| PREDICTED: alanine--tRNA ligase-like isoform X3 [Setaria italica]
Length=1005

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_004983349.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Setaria italica]
Length=1005

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>gb|EPY51753.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces cryophilus 
OY26]
Length=1019

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP++KVR TF+KFFE + HT V SS VVP +DPTLLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   IEWPANKVRSTFLKFFEERGHTVVPSSSVVPYDDPTLLFANAGMNQFKPIFLGTVDPSHE  127

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNW
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNW  169



>ref|XP_005645178.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20634.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
Length=1151

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W   +VR TF++FFE+K HT V SS VVP NDPTLLFANAGMNQFKPIFLGTVDPN++ +
Sbjct  211  WSGDRVRATFVEFFETKGHTAVPSSSVVPHNDPTLLFANAGMNQFKPIFLGTVDPNSDFA  270

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +L RACD+QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  271  RLSRACDSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  310



>ref|XP_004983348.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Setaria italica]
Length=1022

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  157



>ref|XP_003079014.1| SYA_ARATH Alanyl-tRNA synthetase, mitochondrial precursor (ISS) 
[Ostreococcus tauri]
Length=1170

 Score =   181 bits (459),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  344



>emb|CEF97732.1| Thioredoxin-like fold [Ostreococcus tauri]
Length=1183

 Score =   181 bits (459),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  344



>emb|CEG71324.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  105



>gb|KGK39868.1| hypothetical protein JL09_g980 [Pichia kudriavzevii]
Length=1474

 Score =   181 bits (460),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVRDTF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++  
Sbjct  15   EWPAAKVRDTFLNYFKSKGHTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTVDPSSSF  74

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  75   ANLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  115



>ref|XP_001248510.1| alanyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]
 gb|EAS36927.3| alanine-tRNA ligase [Coccidioides immitis RS]
Length=1023

 Score =   180 bits (457),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  173



>emb|CEI92968.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  105



>ref|XP_003070819.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER28674.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
Length=1023

 Score =   180 bits (457),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  173



>gb|AFR32145.1| alanyl-tRNA synthetase, partial [Galactomyces candidum]
Length=971

 Score =   180 bits (456),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 76/100 (76%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  21   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  80

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  81   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  120



>ref|XP_007759596.1| alanyl-tRNA synthetase [Cladophialophora yegresii CBS 114405]
 gb|EXJ57062.1| alanyl-tRNA synthetase [Cladophialophora yegresii CBS 114405]
Length=962

 Score =   180 bits (456),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W + KVRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++  
Sbjct  12   WTAPKVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKEG  71

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  72   QYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|AFR32153.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32155.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32157.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32161.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32162.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   180 bits (456),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 76/100 (76%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  128



>gb|KIX98796.1| alanine-tRNA ligase [Fonsecaea multimorphosa CBS 102226]
Length=959

 Score =   180 bits (456),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR+TF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  8    EWSAPKVRETFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  68   GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  108



>gb|EPX70595.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces octosporus 
yFS286]
Length=1019

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+SKVR TF+KFFE + HT V SS VVP +DP+LLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   LKWPASKVRSTFLKFFEERGHTIVPSSSVVPYDDPSLLFANAGMNQFKPIFLGTVDPSHE  127

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNW
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNW  169



>ref|XP_002504833.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
 gb|ACO66091.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
Length=945

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ ++R TF+ FFE K HT V SSPVVP +DPTLLFANAGMNQFKP FLGT DP   L
Sbjct  6    EWPAQRIRQTFLDFFEGKEHTVVPSSPVVPHDDPTLLFANAGMNQFKPCFLGTADPKGPL  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +KLKRA DTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  66   AKLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_008725247.1| alanyl-tRNA synthetase [Cladophialophora carrionii CBS 160.54]
 gb|ETI25902.1| alanyl-tRNA synthetase [Cladophialophora carrionii CBS 160.54]
Length=962

 Score =   179 bits (454),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W + KVR+TF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   QWTAPKVRETFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|KIX01548.1| alanine-tRNA ligase [Rhinocladiella mackenziei CBS 650.93]
Length=962

 Score =   179 bits (454),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +S VRDTF+KFFE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++  
Sbjct  12   WSASLVRDTFLKFFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKEG  71

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + +R  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  72   QYQRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|AFW56405.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=399

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNW
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNW  154



>emb|CDK27200.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=989

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++KVR TF+KFFES+ HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  39   DWTAAKVRSTFLKFFESRGHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  98

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  99   ATLKRAVNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  139



>ref|XP_007724363.1| alanyl-tRNA synthetase [Capronia coronata CBS 617.96]
 gb|EXJ88357.1| alanyl-tRNA synthetase [Capronia coronata CBS 617.96]
Length=962

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++KVRDTF+++FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  11   QWTATKVRDTFLQYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   GQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|EJK71470.1| hypothetical protein THAOC_07085 [Thalassiosira oceanica]
Length=1072

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP  KVR TFI FFE   HT  +SSP VP +DPTLLF NAGMNQ+KP+FLGTVDPN E+
Sbjct  118  EWPMDKVRSTFISFFERNGHTFWRSSPCVPYDDPTLLFTNAGMNQYKPLFLGTVDPNVEM  177

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + LKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  178  AGLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  218



>ref|XP_011111424.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40594.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
Length=1063

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVR+TF K+FESK H  VKSSP VPV+D TLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  106  EWPAAKVRETFFKYFESKGHEYVKSSPCVPVDDKTLLFANAGMNQYKSIFLGTVDPNSKF  165

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  166  GKLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  206



>gb|EGE01186.1| alanyl-tRNA synthetase [Trichophyton equinum CBS 127.97]
Length=963

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  117



>ref|XP_002843973.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
 gb|EEQ34937.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
Length=963

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGT+DPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTIDPNSD  75

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  117



>ref|XP_006687556.1| hypothetical protein CANTEDRAFT_109802 [Candida tenuis ATCC 10573]
 gb|EGV61386.1| hypothetical protein CANTEDRAFT_109802 [Candida tenuis ATCC 10573]
Length=953

 Score =   178 bits (451),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EW +SKVR TF+ FF+ K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP+++
Sbjct  7    IEWSASKVRTTFLDFFKDKKHTFVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPSSD  66

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  67   FANLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>gb|EGD95966.1| alanyl-tRNA synthetase [Trichophyton tonsurans CBS 112818]
Length=963

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  117



>gb|EZF33517.1| alanyl-tRNA synthetase [Trichophyton interdigitale H6]
 gb|KDB23468.1| alanyl-tRNA synthetase [Trichophyton interdigitale MR816]
Length=963

 Score =   178 bits (451),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  117



>emb|CEP13586.1| hypothetical protein [Parasitella parasitica]
Length=959

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGTVDPN+ L
Sbjct  7    EWPANKVRSTFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTVDPNSPL  66

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNW
Sbjct  67   ANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNW  107



>gb|EIE82853.1| alanyl-tRNA synthetase [Rhizopus delemar RA 99-880]
Length=955

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVR TF+KFFE   H  V SS  +P +DPTLLFANAGMNQFKP+FLGT+DPN+ L
Sbjct  3    EWPANKVRSTFVKFFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDPNSPL  62

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  63   ANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  103



>gb|AFR32146.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32147.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32148.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32149.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32150.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32151.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32152.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32154.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32156.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32158.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32159.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32160.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP+SKVR+TF+ +F+S  HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSNEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  128



>gb|KIZ04229.1| alanyl-tRNA synthetase [Monoraphidium neglectum]
Length=965

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP + VR  F  FF SK HT   S+ VVP+NDPTLLF NAGMNQFKP+FLGTVDPN+E+
Sbjct  4    EWPGAVVRKAFNDFFVSKGHTYWPSNAVVPLNDPTLLFTNAGMNQFKPVFLGTVDPNSEM  63

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +LK AC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  64   GRLKSACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  104



>ref|XP_007741222.1| alanyl-tRNA synthetase [Cladophialophora psammophila CBS 110553]
 gb|EXJ74122.1| alanyl-tRNA synthetase [Cladophialophora psammophila CBS 110553]
Length=962

 Score =   177 bits (450),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR+TF+K+FE + HT V+SSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   EWTAPKVRETFLKYFEERGHTFVRSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  71   GQYKRVVNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  111



>dbj|BAJ96541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1008

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  58   DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTASPDSQL  117

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  118  GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  158



>gb|KIW91962.1| alanine-tRNA ligase [Cladophialophora bantiana CBS 173.52]
Length=962

 Score =   177 bits (449),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR+TF+K+FE + HT V+SSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   EWTAPKVRETFLKYFEERGHTFVRSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  71   GQYKRVVNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  111



>ref|XP_001731546.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
 gb|EDP44332.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
Length=963

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVR TF+ FF  K HT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP++E 
Sbjct  11   EWPAAKVRSTFLDFFREKEHTFVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPSSEF  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  71   SKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  111



>dbj|GAN03494.1| alanyl-tRNA synthetase [Mucor ambiguus]
Length=958

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  186  MAGL-EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            MAG  EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQSEWPANKVRATFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNW
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNW  106



>ref|XP_002839828.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84019.1| unnamed protein product [Tuber melanosporum]
Length=959

 Score =   177 bits (449),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            ++ +EWP+S VR TFI +F++  HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDP
Sbjct  5    LSTVEWPASLVRKTFIDYFKNNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDP  64

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +++ + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  65   SSDFASLKRAANSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  109



>gb|EPB88726.1| alanyl-tRNA synthetase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=958

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  186  MAG-LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            MAG  EWP++KVR TF+K+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQTEWPANKVRSTFVKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNW
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNW  106



>emb|CDO95315.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=956

 Score =   177 bits (449),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR TF+ FF+SK HT V SSPV+P  DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRTTFLDFFKSKGHTFVPSSPVIPYEDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>gb|KDN38724.1| hypothetical protein RSAG8_09274, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=904

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++++R  FI FFE++ H    SS V+P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  83   EWPANRIRKEFIDFFEARGHKFWPSSSVIPYDDPTLLFANAGMNQYKSIFLGTVDPNSEL  142

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  143  SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  183



>ref|XP_007737759.1| alanyl-tRNA synthetase [Capronia epimyces CBS 606.96]
 gb|EXJ78314.1| alanyl-tRNA synthetase [Capronia epimyces CBS 606.96]
Length=962

 Score =   177 bits (448),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR+TF+ +F+ + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVD  ++ 
Sbjct  11   EWTALKVRETFLNYFQERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDSTSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   GQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|KIW23162.1| alanine-tRNA ligase [Cladophialophora immunda]
Length=1064

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  113  EWSAPKVRDTFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  172

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  173  GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  213



>gb|EMT18589.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1012

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_009159895.1| alanyl-tRNA synthetase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59434.1| alanyl-tRNA synthetase [Exophiala dermatitidis NIH/UT8656]
Length=1107

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR+TF+K+FE + HT V+SSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  153  EWTAPKVRETFLKYFEERGHTFVRSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  212

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  213  GQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  253



>ref|XP_007582290.1| putative alanyl-trna synthetase protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD50240.1| putative alanyl-trna synthetase protein [Neofusicoccum parvum 
UCRNP2]
Length=962

 Score =   176 bits (447),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ +VR TF+ FF+   HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  10   EWPAQRVRQTFLDFFKKNGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  70   ATLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  110



>emb|CEJ88871.1| Putative Alanyl-tRNA synthetase [Torrubiella hemipterigena]
Length=955

 Score =   176 bits (447),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 78/105 (74%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            MA L+WP+++VR TF+ FFE K HT V S  VVP NDPTLLF NAGMNQFKPIFLGTV  
Sbjct  1    MADLKWPAARVRQTFLDFFEKKGHTIVPSGSVVPHNDPTLLFTNAGMNQFKPIFLGTVGQ  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
               ++ LKRA DTQK IRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  61   TDPMASLKRAADTQKVIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  105



>dbj|BAO40758.1| alanyl-tRNA synthetase [Kluyveromyces marxianus DMKU3-1042]
Length=956

 Score =   176 bits (447),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>ref|XP_007291338.1| tRNA synthetase class II [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD18456.1| tRNA synthetase class II [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=949

 Score =   176 bits (447),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 79/105 (75%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            MA  +W +  VR TF++FFE+K HT V SS VVP NDPTLLF NAGMNQFKPIFLGTV  
Sbjct  1    MAQEKWTAPVVRKTFLEFFEAKGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTVGQ  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              +L++LKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  61   TDDLAQLKRAVDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  105



>dbj|BAJ98134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  183  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  362
            E A  +WPS+ VR  FI FF S+AHT   SSPVVP  DPTLLFANAGMNQ+KP+FLG  D
Sbjct  49   EEAAPDWPSALVRQVFIDFFRSRAHTPWPSSPVVPFEDPTLLFANAGMNQYKPVFLGAAD  108

Query  363  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            P++ L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  109  PDSPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  154



>dbj|BAP72231.1| alanyl-tRNA synthetase [Kluyveromyces marxianus]
Length=956

 Score =   176 bits (447),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>ref|NP_593640.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe 972h-]
 sp|O13914.1|SYA_SCHPO RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS [Schizosaccharomyces pombe 972h-]
 emb|CAB11162.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe]
Length=959

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            + WP++++R TF+K+FE   HT V SS V+P +DPTLLFANAGMNQFKPIFLGTVDP+++
Sbjct  8    VNWPANEIRRTFLKYFEDHGHTIVPSSSVIPYDDPTLLFANAGMNQFKPIFLGTVDPSSD  67

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +KLKRACD+QKCIRAGGKHNDL+DVGKD YHHT FEMLGNW
Sbjct  68   FAKLKRACDSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNW  109



>ref|XP_011121665.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX49611.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
Length=940

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A  +WP++KVR TFI+FFE K H   KSSP VP++D TLLFANAGMNQFKPIFLGTVD  
Sbjct  18   AEQKWPATKVRQTFIEFFEKKGHVFYKSSPCVPLDDKTLLFANAGMNQFKPIFLGTVDET  77

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++  KLKRAC+TQKCIRAGGKHNDL+DVG D+YHHTFFEMLGNW
Sbjct  78   SDFGKLKRACNTQKCIRAGGKHNDLEDVGSDSYHHTFFEMLGNW  121



>ref|XP_455190.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG97897.1| KLLA0F02431p [Kluyveromyces lactis]
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAANVRSTFLDYFKSKGHTFVPSSPVIPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>gb|EIF48501.1| cytoplasmic alanyl-trna synthetase [Brettanomyces bruxellensis 
AWRI1499]
Length=993

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP+SKVRDTF+ FF+ + HT V SS V+P +DPTLLFANAGMNQ+KPIFLGT+DP++ L+
Sbjct  44   WPASKVRDTFLNFFKERGHTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTIDPSSPLA  103

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +KRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  104  HIKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  143



>gb|KIW20001.1| alanine-tRNA ligase [Exophiala spinifera]
Length=962

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW +  VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  11   EWSAPVVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|KIW00804.1| alanine-tRNA ligase [Verruconis gallopava]
Length=998

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW ++ VR  FI +FE + HT V SSPVVP+NDPTLLF NAGMNQFK IFLGTVDPN+  
Sbjct  49   EWTANSVRKQFIDYFEQRGHTYVPSSPVVPLNDPTLLFTNAGMNQFKSIFLGTVDPNSNF  108

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +KLKRA +TQKCIRAGGKHNDLDDVGKD+YHHT+FEMLGNW
Sbjct  109  AKLKRAVNTQKCIRAGGKHNDLDDVGKDSYHHTYFEMLGNW  149



>ref|XP_001830532.2| tRNA synthetase class II [Coprinopsis cinerea okayama7#130]
 gb|EAU91282.2| tRNA synthetase class II [Coprinopsis cinerea okayama7#130]
Length=968

 Score =   176 bits (446),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W S +VR+ F ++F ++ HT V+SSP +P +DPTLLFANAGMNQ+K IFLGTVDPN+ELS
Sbjct  11   WTSRRVREEFFEYFRARDHTFVRSSPTIPFDDPTLLFANAGMNQYKSIFLGTVDPNSELS  70

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            K+KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   KVKRAFNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  110



>gb|EPS99866.1| hypothetical protein FOMPIDRAFT_1024013 [Fomitopsis pinicola 
FP-58527 SS1]
Length=958

 Score =   176 bits (446),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L WP++KVR  F  +F+SK HT V SS  +P +DPTLLFANAGMNQFK IFLGTVDP ++
Sbjct  7    LNWPAAKVRQEFFNYFQSKGHTLVPSSSTIPHDDPTLLFANAGMNQFKAIFLGTVDPQSD  66

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L++L RA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  67   LARLNRAFNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  108



>ref|XP_004199688.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE81569.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP++E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPSSEFA  77

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  117



>gb|KIH58709.1| alanine--tRNA ligase [Ancylostoma duodenale]
Length=259

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +3

Query  210  SKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  386
            ++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+KL
Sbjct  106  NEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKL  165

Query  387  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  166  KRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  203



>ref|XP_004198838.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE82501.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPGSEFA  77

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  117



>emb|CCX13711.1| Similar to Alanine--tRNA ligase; acc. no. Q5AQL1 [Pyronema omphalodes 
CBS 100304]
Length=951

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EW + +VR TFI++F+   HT V SS VVP +DPTLLFANAGMNQ+K IFLGTVDP+++
Sbjct  1    MEWSADRVRKTFIEYFQKHEHTFVPSSSVVPHSDPTLLFANAGMNQYKSIFLGTVDPSSD  60

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             SKLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  61   FSKLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  102



>emb|CDH15032.1| probable ALA1-Alanyl-tRNA synthetase,cytosolic [Zygosaccharomyces 
bailii ISA1307]
Length=956

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>emb|CDF90599.1| ZYBA0S07-04786g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=956

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>ref|XP_008662576.1| PREDICTED: alanine--tRNA ligase [Zea mays]
 gb|AFW56406.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=1002

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNW
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNW  154



>gb|KIV86028.1| alanine-tRNA ligase [Exophiala sideris]
Length=1059

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDTF+KFFE + HT V+SSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  107  QWSAQVVRDTFLKFFEERGHTFVRSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  166

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  167  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  207



>emb|CCA39700.1| alanyl-tRNA synthetase [Komagataella pastoris CBS 7435]
Length=959

 Score =   175 bits (444),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            +A  EW ++KVR TF  FF+SK HT V SS V+P +DPTLLF NAGMNQ+KPIFLGTVDP
Sbjct  4    LASKEWTANKVRSTFFDFFKSKDHTYVPSSSVIPYDDPTLLFTNAGMNQYKPIFLGTVDP  63

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +++ + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  64   SSDFATLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>emb|CEL61027.1| alanyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=991

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+++VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  44   EWPANRVRKEFIDFFEARGHKFWASSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  103

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  104  SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  144



>ref|XP_002492690.1| Cytoplasmic alanyl-tRNA synthetase [Komagataella pastoris GS115]
 emb|CAY70511.1| Cytoplasmic alanyl-tRNA synthetase [Komagataella pastoris GS115]
Length=981

 Score =   175 bits (444),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            +A  EW ++KVR TF  FF+SK HT V SS V+P +DPTLLF NAGMNQ+KPIFLGTVDP
Sbjct  26   LASKEWTANKVRSTFFDFFKSKDHTYVPSSSVIPYDDPTLLFTNAGMNQYKPIFLGTVDP  85

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +++ + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  86   SSDFATLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  130



>ref|XP_002173036.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB06743.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
Length=961

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            LEWP++KVR TFI +F+   HT V SS V+P  DPTLLFANAGMNQ+KPIFLGTVDP++ 
Sbjct  7    LEWPANKVRSTFIDYFKEHGHTFVPSSSVIPFEDPTLLFANAGMNQYKPIFLGTVDPSSS  66

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +KLKRAC++QKCIRAGGKHNDL+DVGKD YHHT FEMLGNW
Sbjct  67   FAKLKRACNSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNW  108



>emb|CDH13133.1| probable ALA1-Alanyl-tRNA synthetase,cytosolic [Zygosaccharomyces 
bailii ISA1307]
Length=954

 Score =   175 bits (443),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  6    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  66   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  106



>gb|KIW56168.1| alanine-tRNA ligase [Exophiala xenobiotica]
Length=1051

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDTF+K+FE + HT VKSSPVVPV+DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  100  KWSAPVVRDTFLKYFEDRGHTFVKSSPVVPVSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  159

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  160  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  200



>emb|CCV00729.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=966

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  189  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  368
            A   WP++KVR TF+ FF+ +AHT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP+
Sbjct  8    ASTAWPAAKVRSTFLDFFKEQAHTNVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPS  67

Query  369  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  68   SDFSKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  111



>ref|XP_002615762.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ40516.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
Length=964

 Score =   175 bits (443),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +S VR TF+ +F++K+HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WSASTVRSTFLDYFKNKSHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPTSEFA  77

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  117



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  106



>ref|XP_002796769.1| alanyl-tRNA synthetase [Paracoccidioides sp. 'lutzii' Pb01]
Length=962

 Score =   175 bits (443),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ +VR+ F+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTV+PN++ 
Sbjct  11   EWPALRVRNAFLDFFKDNGHTFVPSSSVVPLSDPTLLFANAGMNQYKAIFLGTVEPNSDF  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++LKRA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   AQLKRAHNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>gb|KEP53395.1| alanyl-tRNA synthetase [Rhizoctonia solani 123E]
Length=953

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  107



>gb|EKG22385.1| Alanyl-tRNA synthetase class IIc [Macrophomina phaseolina MS6]
Length=963

 Score =   175 bits (443),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + +VRDTF+ +F+   HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  11   EWSAQRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  70

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  71   ATLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  111



>ref|XP_003060777.1| alanyl-tRNA synthetase [Micromonas pusilla CCMP1545]
 gb|EEH55546.1| alanyl-tRNA synthetase [Micromonas pusilla CCMP1545]
Length=972

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            WP++K+R TF+ FFESK H  V SSPVVP +DPTLLFANAGMNQFK IFLG  DP   L+
Sbjct  11   WPANKIRQTFLDFFESKEHAVVPSSPVVPHDDPTLLFANAGMNQFKSIFLGKADPKGPLA  70

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KLKRA DTQKCIRAGGKHNDLDDVGKDTYHHT+FEMLGNW
Sbjct  71   KLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTYFEMLGNW  110



>sp|Q5AQL1.2|SYA_EMENI RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS [Aspergillus nidulans FGSC A4]
 tpe|CBF84773.1| TPA: alanyl-tRNA synthetase, putative (AFU_orthologue; AFUA_8G03880) 
[Aspergillus nidulans FGSC A4]
Length=961

 Score =   174 bits (442),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W S  VRDTF+++F+ K HT V SSPV P++DPTLLF NAGMNQFK IFLGTV+PN++ 
Sbjct  10   KWTSKLVRDTFLQYFQGKGHTFVASSPVAPLSDPTLLFTNAGMNQFKSIFLGTVNPNSDF  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++LK A ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  70   AQLKSAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  110



>gb|EUC64360.1| alanyl-tRNA synthetase, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=934

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  107



>ref|XP_005710836.1| Alanine--tRNA ligase [Chondrus crispus]
 emb|CDF40542.1| Alanine--tRNA ligase [Chondrus crispus]
Length=965

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            L WP+S+VR TFI FF +S AHT V SSPVVP +DPTLLFANAGMNQ+KPIFLG   P++
Sbjct  13   LAWPASRVRSTFIDFFSQSHAHTFVPSSPVVPHDDPTLLFANAGMNQYKPIFLGVAPPDS  72

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LS LKRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  73   FLSTLKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  115



>ref|XP_007779583.1| alanyl-tRNA synthetase [Coniosporium apollinis CBS 100218]
 gb|EON64266.1| alanyl-tRNA synthetase [Coniosporium apollinis CBS 100218]
Length=959

 Score =   174 bits (442),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + +VRDTF+ +F+   HT V SS VVP NDPTLLFANAGMNQ+K IFLGTVDP ++ 
Sbjct  9    EWDAVRVRDTFLDYFKKNGHTFVPSSSVVPHNDPTLLFANAGMNQYKSIFLGTVDPQSDF  68

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++LKRA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  69   AQLKRAVNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  109



>gb|EMG50125.1| Alanyl-tRNA synthetase, putative, partial [Candida maltosa Xu316]
Length=933

 Score =   174 bits (442),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ FF+ K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  12   WTASKVRSTFLDFFKQKQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  71

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  72   TLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  111



>ref|XP_003957527.1| hypothetical protein KAFR_0E02390 [Kazachstania africana CBS 
2517]
 emb|CCF58392.1| hypothetical protein KAFR_0E02390 [Kazachstania africana CBS 
2517]
Length=956

 Score =   174 bits (441),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F SK H  +KSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP +E 
Sbjct  8    KWTATNVRNTFLNYFNSKEHKFIKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASEF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKC+RAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>ref|XP_007397053.1| hypothetical protein PHACADRAFT_258158 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM54355.1| hypothetical protein PHACADRAFT_258158 [Phanerochaete carnosa 
HHB-10118-sp]
Length=951

 Score =   174 bits (441),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W S++VR+ F KFF  + HT V SS  +P  DPTLLFANAGMNQFKPIFLGTVDP++EL+
Sbjct  5    WSSTRVREEFFKFFRDREHTFVPSSSTIPYEDPTLLFANAGMNQFKPIFLGTVDPHSELA  64

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            KL RA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  65   KLNRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  104



>emb|CCJ30352.1| unnamed protein product [Pneumocystis jirovecii]
Length=959

 Score =   174 bits (441),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 76/103 (74%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
             L+WPS KVR+TFI +F+ + HT V S+ VVP NDPTLLF NAGMNQ+K IFLGTVDP +
Sbjct  4    ALKWPSHKVRETFISYFKERDHTFVPSASVVPYNDPTLLFTNAGMNQYKSIFLGTVDPYS  63

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             L KLKRA ++QK IRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  64   PLGKLKRAVNSQKVIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  106



>ref|XP_001417607.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95900.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=967

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            EWPSS+VRDTF+ +F E + H    SSP VPVNDPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  27   EWPSSRVRDTFVNYFIEKQGHVNWPSSPAVPVNDPTLLFANAGMNQYKPIFLGKADPKTA  86

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  87   FAKLTRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  128



>gb|KIW65631.1| alanine-tRNA ligase [Capronia semiimmersa]
Length=1061

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W + KVR+TF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  110  QWTAPKVRETFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  169

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  170  GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  210



>gb|KHN71931.1| Alanine--tRNA ligase, cytoplasmic [Toxocara canis]
Length=246

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  207  SSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  386
            + +VR TFI+FF  + HT V SS V+P  DPTLLFANAGMNQFKPIFLGTV+P +EL++L
Sbjct  7    ADEVRSTFIRFFAEREHTYVHSSSVIPFEDPTLLFANAGMNQFKPIFLGTVEPCSELARL  66

Query  387  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +RA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  67   RRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNW  104



>ref|XP_003676658.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
 emb|CCC70299.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
Length=956

 Score =   174 bits (440),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VR+TF+ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAQNVRNTFLDYFKSKEHTFVPSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKC+RAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|KIW48370.1| alanine-tRNA ligase [Exophiala oligosperma]
Length=1047

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +  VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  96   KWSAPVVRDTFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  155

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  156  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  196



>ref|XP_002552804.1| KLTH0D01848p [Lachancea thermotolerans]
 emb|CAR22366.1| KLTH0D01848p [Lachancea thermotolerans CBS 6340]
Length=955

 Score =   174 bits (440),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W +S VR TF++FF+ + HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDY  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  68   YSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>gb|EHN00072.1| Ala1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=958

 Score =   174 bits (440),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTAANVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EGA60508.1| Ala1p [Saccharomyces cerevisiae FostersO]
Length=833

 Score =   172 bits (437),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EJT44225.1| ALA1-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=958

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTAANVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>emb|CCF32573.1| alanyl-tRNA synthetase [Colletotrichum higginsianum]
Length=955

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/105 (73%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            MA  +WP + VR TF++FFE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+  
Sbjct  1    MAEPKWPGAVVRKTFLEFFEKRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTISK  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
               +  LKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  61   ADPMYSLKRATDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  105



>ref|XP_001643652.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15794.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
Length=956

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W ++ VR+TF+ +F+SK H  V+SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP++E  
Sbjct  9    WTAAVVRNTFLDYFKSKEHKFVRSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSEFY  68

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  69   TLKRAYNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  108



>ref|XP_003172403.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
 gb|EFR01992.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
Length=970

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  117



>dbj|GAD98516.1| alanyl-tRNA synthetase, cytoplasmic [Byssochlamys spectabilis 
No. 5]
Length=960

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW +S+VR+TF+ +F+   HT V SS VVP++DPTLLF NAGMNQFK IFLGTVDP ++ 
Sbjct  9    EWTASQVRETFLDYFKKNGHTFVPSSSVVPLSDPTLLFTNAGMNQFKSIFLGTVDPQSDF  68

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  69   AQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  109



>ref|XP_007872286.1| alanyl-tRNA synthetase [Pneumocystis murina B123]
 gb|EMR11385.1| alanyl-tRNA synthetase [Pneumocystis murina B123]
Length=960

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            +EWPS K+R+TFI +F+ + HT V SS VVP NDPTLLF NAGMNQ+K IFLGTVDP + 
Sbjct  5    IEWPSKKIRETFISYFKKRDHTFVPSSSVVPYNDPTLLFTNAGMNQYKSIFLGTVDPYSP  64

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            L KLKRA ++QK IRAGGKHNDL+DVGKD YHHTFFEMLGNW
Sbjct  65   LGKLKRAVNSQKVIRAGGKHNDLEDVGKDNYHHTFFEMLGNW  106



>ref|XP_500483.1| YALI0B04180p [Yarrowia lipolytica]
 emb|CAG82710.1| YALI0B04180p [Yarrowia lipolytica CLIB122]
Length=960

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = +3

Query  201  WPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            WP++KVR TF+ +F E +AH+ V SS V+P +DPTLLFANAGMNQ+KPIFLGT DP++ L
Sbjct  8    WPATKVRKTFLDYFGEKRAHSFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTCDPSSPL  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKL RA ++QKCIRAGGKHNDLDDVG+D+YHHTFFEMLGNW
Sbjct  68   SKLNRAANSQKCIRAGGKHNDLDDVGRDSYHHTFFEMLGNW  108



>gb|KDN64543.1| putative tRNA synthetase class II [Colletotrichum sublineola]
Length=955

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/105 (73%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            MA  +WP + VR TF++FFE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+  
Sbjct  1    MAEPKWPGAVVRKTFLEFFEKRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTISK  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
               +  LKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  61   ADPMYSLKRATDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  105



>gb|KIL94735.1| hypothetical protein FAVG1_01666 [Fusarium avenaceum]
Length=957

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LQWPAARVRKTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|AAC49007.1| cytoplasmic alanyl-tRNA synthetase [Saccharomyces cerevisiae]
 prf||2113423A Ala-tRNA synthetase
Length=958

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EEU07514.1| Ala1p [Saccharomyces cerevisiae JAY291]
Length=958

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EGA76661.1| Ala1p [Saccharomyces cerevisiae Vin13]
 gb|EGA80661.1| Ala1p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EHN04519.1| Ala1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>ref|XP_007377582.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30611.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
Length=959

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            EW +SKVR TF+ FF + K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++
Sbjct  13   EWTASKVRSTFLDFFTKKKGHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASD  72

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  73   FASLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  114



>gb|EDV10897.1| alanyl-tRNA synthetase [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ69081.1| YOR335Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 emb|CAY86616.1| Ala1p [Saccharomyces cerevisiae EC1118]
 gb|EGA84760.1| Ala1p [Saccharomyces cerevisiae VL3]
 gb|EWG83396.1| Ala1p [Saccharomyces cerevisiae R008]
 gb|EWG93270.1| Ala1p [Saccharomyces cerevisiae R103]
 gb|AHY77607.1| Ala1p [Saccharomyces cerevisiae YJM993]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>ref|NP_014980.3| alanine--tRNA ligase [Saccharomyces cerevisiae S288c]
 emb|CAA89980.1| ALA1 [Saccharomyces cerevisiae]
 emb|CAA99658.1| ALA1 [Saccharomyces cerevisiae]
 tpg|DAA11096.1| TPA: alanine--tRNA ligase [Saccharomyces cerevisiae S288c]
 gb|EIW07764.1| Ala1p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EDN63655.1| alanyl-tRNA synthetase [Saccharomyces cerevisiae YJM789]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>dbj|GAA26640.1| K7_Ala1p [Saccharomyces cerevisiae Kyokai no. 7]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|AJP41837.1| Ala1p [Saccharomyces cerevisiae YJM1078]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>ref|XP_002565032.1| Pc22g10240 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98312.1| Pc22g10240 [Penicillium rubens Wisconsin 54-1255]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G EW + +VRDTF+ +F+   HT V SSPV P++DPTLLF NAGMNQFK IFLGTVD ++
Sbjct  5    GSEWTAQRVRDTFLDYFKQNGHTFVPSSPVAPLSDPTLLFTNAGMNQFKSIFLGTVDASS  64

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +  K+KRA ++QKC+RAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  65   DFGKMKRATNSQKCLRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|KGO43717.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
 gb|KGO52743.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
 gb|KGO68693.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G EW + +VRDTF+ +F+   HT V SSPV P++DPTLLF NAGMNQFK IFLGTVD ++
Sbjct  5    GSEWTAQRVRDTFLDYFKQNGHTFVPSSPVAPLSDPTLLFTNAGMNQFKSIFLGTVDASS  64

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +  K+KRA ++QKC+RAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  65   DFGKMKRATNSQKCLRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|EWH16115.1| Ala1p [Saccharomyces cerevisiae P283]
Length=961

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  108



>gb|EKV04967.1| Alanyl-tRNA synthetase, putative [Penicillium digitatum Pd1]
 gb|EKV05667.1| Alanyl-tRNA synthetase, putative [Penicillium digitatum PHI26]
Length=958

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  371
            G EW + +VRDTF+ +F+   HT V SSPV P++DPTLLF NAGMNQFK IFLGTVD ++
Sbjct  5    GSEWTAQRVRDTFLDYFKQNGHTFVPSSPVAPLSDPTLLFTNAGMNQFKSIFLGTVDASS  64

Query  372  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +  K+KRA ++QKC+RAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  65   DFGKMKRATNSQKCLRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|KIL68962.1| hypothetical protein M378DRAFT_71103 [Amanita muscaria Koide 
BX008]
Length=950

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/105 (71%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            M+ L W S +VR  F  +F S+ HT V SS  +P  DPTLLFANAGMNQFK IFLGTVDP
Sbjct  1    MSSLSWSSVRVRQEFFDYFRSRNHTHVPSSSTIPYEDPTLLFANAGMNQFKSIFLGTVDP  60

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            N++L+KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  61   NSDLAKLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  105



>gb|KDQ21195.1| hypothetical protein BOTBODRAFT_25615 [Botryobasidium botryosum 
FD-172 SS1]
Length=956

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EWP++KVR  FI FF++K HT V SS  +P  DPTLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  8    EWPAAKVRQVFIDFFKNKGHTFVPSSSTIPYEDPTLLFANAGMNQYKSIFLGTVDPNSDF  67

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +KLKRA ++QKCIRAGGKHNDL+DVGKDTYHHT FEMLGNW
Sbjct  68   AKLKRAVNSQKCIRAGGKHNDLEDVGKDTYHHTMFEMLGNW  108



>sp|P40825.3|SYA_YEAST RecName: Full=Alanine--tRNA ligase, mitochondrial; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Saccharomyces 
cerevisiae S288c]
Length=983

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  33   KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  92

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNW
Sbjct  93   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNW  133



>dbj|GAA89407.1| alanyl-tRNA synthetase [Aspergillus kawachii IFO 4308]
Length=961

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            LEW S +VRDTF+++F+   HT V SSPVVP +DPTLLF NAGMNQFK IFLGTVDP+++
Sbjct  9    LEWTSKRVRDTFLQYFKENGHTFVASSPVVPHSDPTLLFTNAGMNQFKSIFLGTVDPHSD  68

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + LK A +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  69   FANLKSAVNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  110



>ref|XP_001642960.1| hypothetical protein Kpol_1071p9 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15102.1| hypothetical protein Kpol_1071p9 [Vanderwaltozyma polyspora DSM 
70294]
Length=957

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W ++KVRDTF  +F+SK HT + SSPVVP +DPTLLFANAGMNQFK IFLGTVDP ++L 
Sbjct  11   WNANKVRDTFYDYFKSKNHTFISSSPVVPYDDPTLLFANAGMNQFKSIFLGTVDPTSKLY  70

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVGKD+YHHT+FEMLGNW
Sbjct  71   DLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTYFEMLGNW  110



>ref|XP_002443089.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
 gb|EES16927.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
Length=1006

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + +VR+ +I FF SK HT   SSPVVPV+DPTLLFANAGMNQ+KP+FLGT  P++ L
Sbjct  58   EWTARRVREQYISFFVSKEHTRWPSSPVVPVDDPTLLFANAGMNQYKPVFLGTAAPDSPL  117

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  118  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  158



>ref|XP_006966474.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47532.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00904.1| hypothetical protein M419DRAFT_9560 [Trichoderma reesei RUT C-30]
Length=954

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  186  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  365
            MAG  WP ++VR TF  FFE + HT V S  VVP NDPTLLF NAGMNQFKPIFLGTV+ 
Sbjct  1    MAG-NWPEAQVRKTFFDFFEQRGHTLVPSGSVVPHNDPTLLFTNAGMNQFKPIFLGTVNK  59

Query  366  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +  +S LKRA DTQK IRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  60   SDPMSNLKRAVDTQKVIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  104



>ref|XP_009262152.1| hypothetical protein FPSE_10760 [Fusarium pseudograminearum CS3096]
 gb|EKJ69061.1| hypothetical protein FPSE_10760 [Fusarium pseudograminearum CS3096]
Length=957

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF ++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGTV     
Sbjct  6    LKWPAARVRKTFFEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTVGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MASLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>ref|XP_011316641.1| alanyl-tRNA synthetase [Fusarium graminearum PH-1]
 gb|ESU06156.1| alanyl-tRNA synthetase [Fusarium graminearum PH-1]
 gb|EYB26307.1| hypothetical protein FG05_00906 [Fusarium graminearum]
 emb|CEF72941.1| unnamed protein product [Fusarium graminearum]
Length=957

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF ++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGTV     
Sbjct  6    LKWPAARVRKTFFEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTVGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MASLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>ref|XP_003053770.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU48057.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=956

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LKWPAARVRQTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|KHJ35999.1| putative alanyl-trna synthetase [Erysiphe necator]
Length=1000

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L W +  VR+TF+K+FE K HT V SS VVP NDPTLLF NAGMNQFKP+FLGT++    
Sbjct  47   LNWSAPVVRNTFLKYFEQKRHTLVPSSSVVPHNDPTLLFTNAGMNQFKPLFLGTINQTDA  106

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             S+LKRA DTQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNW
Sbjct  107  FSQLKRAVDTQKCIRAGGKHNDLDDVGKDGYHHTFFEMLGNW  148



>gb|KGQ88605.1| alanyl-tRNA synthetase [Candida albicans GC75]
Length=969

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|EEQ46641.1| alanyl-tRNA synthetase [Candida albicans WO-1]
 gb|KGU21757.1| alanyl-tRNA synthetase [Candida albicans P34048]
 gb|KGU24863.1| alanyl-tRNA synthetase [Candida albicans P57055]
 gb|KHC31357.1| alanyl-tRNA synthetase [Candida albicans P76055]
 gb|KHC58491.1| alanyl-tRNA synthetase [Candida albicans P75010]
 gb|KHC70962.1| alanyl-tRNA synthetase [Candida albicans P78042]
Length=969

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>ref|XP_007833565.1| Alanine--tRNA ligase [Pestalotiopsis fici W106-1]
 gb|ETS81791.1| Alanine--tRNA ligase [Pestalotiopsis fici W106-1]
Length=957

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 78/101 (77%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW   KVR TF  FF  + HT V S  VVP NDPTLLF NAGMNQFKPIFLGTV    +L
Sbjct  6    EWTGLKVRQTFFDFFAERGHTIVPSGSVVPHNDPTLLFTNAGMNQFKPIFLGTVASTDDL  65

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            SKLKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   SKLKRAVDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  106



>gb|KGR08732.1| alanyl-tRNA synthetase [Candida albicans P57072]
 gb|KHC31556.1| alanyl-tRNA synthetase [Candida albicans P76067]
Length=969

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>ref|XP_718082.1| hypothetical protein CaO19.5746 [Candida albicans SC5314]
 ref|XP_718016.1| hypothetical protein CaO19.13169 [Candida albicans SC5314]
 sp|Q5A8K2.1|SYA_CANAL RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Candida albicans 
SC5314]
 gb|EAK99075.1| hypothetical protein CaO19.13169 [Candida albicans SC5314]
 gb|EAK99149.1| hypothetical protein CaO19.5746 [Candida albicans SC5314]
 gb|KGQ86242.1| alanyl-tRNA synthetase [Candida albicans P37005]
 gb|KGR06506.1| alanyl-tRNA synthetase [Candida albicans P78048]
 gb|KGR09932.1| alanyl-tRNA synthetase [Candida albicans P37037]
 gb|KGT65856.1| alanyl-tRNA synthetase [Candida albicans 12C]
 gb|KGU05658.1| alanyl-tRNA synthetase [Candida albicans 19F]
 gb|KGU06133.1| alanyl-tRNA synthetase [Candida albicans L26]
 gb|KHC47879.1| alanyl-tRNA synthetase [Candida albicans P60002]
 gb|KHC50537.1| alanyl-tRNA synthetase [Candida albicans P37039]
 gb|KHC73506.1| alanyl-tRNA synthetase [Candida albicans SC5314]
 gb|KHC82774.1| alanyl-tRNA synthetase [Candida albicans SC5314]
Length=969

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KHC63511.1| alanyl-tRNA synthetase [Candida albicans P75016]
Length=969

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KHC33201.1| alanyl-tRNA synthetase [Candida albicans Ca6]
Length=969

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KGU04317.1| alanyl-tRNA synthetase [Candida albicans P87]
 gb|KGU25257.1| alanyl-tRNA synthetase [Candida albicans P75063]
Length=969

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KGQ84359.1| alanyl-tRNA synthetase [Candida albicans P94015]
Length=969

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KIV89764.1| alanine-tRNA ligase [Exophiala mesophila]
Length=1064

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W + +VRDTF+ FF+ + H  VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  113  QWTAQEVRDTFLNFFQERGHAFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  172

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  173  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  213



>gb|EST08427.1| alanyl-tRNA synthetase [Pseudozyma brasiliensis GHG001]
Length=986

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +WP++KVRDTF  +F+ +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  17   DWPATKVRDTFTGYFKERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGVADPNSSF  76

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW
Sbjct  77   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  117



>gb|EMT61526.1| Alanyl-tRNA synthetase [Fusarium oxysporum f. sp. cubense race 
4]
Length=959

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LKWPAARVRKTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|EGU79625.1| hypothetical protein FOXB_09908 [Fusarium oxysporum Fo5176]
 gb|ENH61369.1| Alanyl-tRNA synthetase [Fusarium oxysporum f. sp. cubense race 
1]
Length=959

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LKWPAARVRKTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>emb|CCT62693.1| probable alanine--tRNA ligase, cytosolic [Fusarium fujikuroi 
IMI 58289]
Length=959

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  195  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  374
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LKWPAARVRKTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  375  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  107



>gb|EME44029.1| hypothetical protein DOTSEDRAFT_44310 [Dothistroma septosporum 
NZE10]
Length=960

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            EW + KVR TFI +F+   HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  10   EWTAQKVRSTFIDYFKQHGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  69

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
            +KLKRA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEM+GNW
Sbjct  70   AKLKRAANTQKCIRAGGKHNDLDDVGKDSYHHTFFEMMGNW  110



>ref|XP_002421135.1| alanyl-tRNA synthetase, putative [Candida dubliniensis CD36]
 emb|CAX41294.1| alanyl-tRNA synthetase, putative [Candida dubliniensis CD36]
Length=969

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  380
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKQQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  381  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNW
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNW  123



>gb|KIV89765.1| alanine-tRNA ligase, variant 1 [Exophiala mesophila]
Length=1024

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  377
            +W + +VRDTF+ FF+ + H  VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  113  QWTAQEVRDTFLNFFQERGHAFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  172

Query  378  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNW  500
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNW
Sbjct  173  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNW  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300