BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026P06

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095399.1|  PREDICTED: protein translation factor SUI1 h...    198   3e-62   Sesamum indicum [beniseed]
ref|XP_006346213.1|  PREDICTED: protein translation factor SUI1 h...    196   1e-61   Solanum tuberosum [potatoes]
ref|XP_004244116.1|  PREDICTED: protein translation factor SUI1 h...    196   2e-61   Solanum lycopersicum
ref|XP_009628718.1|  PREDICTED: protein translation factor SUI1 h...    195   3e-61   Nicotiana tomentosiformis
ref|XP_011097879.1|  PREDICTED: protein translation factor SUI1 h...    194   6e-61   Sesamum indicum [beniseed]
ref|XP_006586085.1|  PREDICTED: protein translation factor SUI1 h...    196   1e-60   Glycine max [soybeans]
ref|XP_002280065.1|  PREDICTED: protein translation factor SUI1 h...    192   4e-60   Vitis vinifera
ref|XP_004500068.1|  PREDICTED: protein translation factor SUI1 h...    191   2e-59   Cicer arietinum [garbanzo]
gb|AFY13590.1|  translation factor SUI1                                 190   5e-59   Aeschynomene evenia
gb|ADK79108.1|  putative eukaryotic translation initiation factor...    190   5e-59   Catharanthus roseus [chatas]
ref|XP_006602202.1|  PREDICTED: protein translation factor SUI1 h...    189   1e-58   Glycine max [soybeans]
gb|AFY13584.1|  translation factor SUI1                                 188   2e-58   Aeschynomene evenia
ref|XP_004152930.1|  PREDICTED: protein translation factor SUI1 h...    188   2e-58   
gb|AGS78110.1|  translation factor SUI1                                 188   3e-58   Aeschynomene filosa
ref|XP_007146479.1|  hypothetical protein PHAVU_006G043900g             187   3e-58   Phaseolus vulgaris [French bean]
gb|KCW66993.1|  hypothetical protein EUGRSUZ_F00759                     192   3e-58   Eucalyptus grandis [rose gum]
gb|KCW66994.1|  hypothetical protein EUGRSUZ_F00759                     192   4e-58   Eucalyptus grandis [rose gum]
gb|AFK38938.1|  unknown                                                 186   1e-57   Lotus japonicus
gb|AGS78105.1|  translation factor SUI1                                 186   1e-57   Aeschynomene indica
ref|XP_010060345.1|  PREDICTED: protein translation factor SUI1 h...    186   2e-57   Eucalyptus grandis [rose gum]
gb|ABY75807.1|  SUI1 B protein                                          184   6e-57   Opuntia streptacantha
ref|XP_003600096.1|  Translation factor SUI1-like protein               184   6e-57   Medicago truncatula
ref|XP_004171416.1|  PREDICTED: protein translation factor SUI1 h...    184   1e-56   
gb|EPS65465.1|  hypothetical protein M569_09317                         184   1e-56   Genlisea aurea
ref|XP_004139787.1|  PREDICTED: protein translation factor SUI1 h...    184   1e-56   Cucumis sativus [cucumbers]
gb|ACJ85979.1|  unknown                                                 182   3e-56   Medicago truncatula
ref|XP_010545223.1|  PREDICTED: protein translation factor SUI1 h...    182   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_010675717.1|  PREDICTED: protein translation factor SUI1 h...    182   7e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|ADB85107.1|  translation initiation factor-like protein              181   8e-56   Jatropha curcas
ref|XP_007212250.1|  hypothetical protein PRUPE_ppa013625mg             181   9e-56   Prunus persica
emb|CDY52575.1|  BnaC03g71830D                                          182   1e-55   Brassica napus [oilseed rape]
emb|CDP05760.1|  unnamed protein product                                181   2e-55   Coffea canephora [robusta coffee]
gb|EYU33643.1|  hypothetical protein MIMGU_mgv1a016664mg                180   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_009360995.1|  PREDICTED: protein translation factor SUI1 h...    180   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_004491401.1|  PREDICTED: protein translation factor SUI1 h...    180   4e-55   Cicer arietinum [garbanzo]
ref|XP_010448878.1|  PREDICTED: protein translation factor SUI1 h...    179   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002866067.1|  hypothetical protein ARALYDRAFT_918633             179   5e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_008359266.1|  PREDICTED: protein translation factor SUI1 h...    179   8e-55   
ref|XP_010092161.1|  Protein translation factor SUI1-2-like protein     179   9e-55   Morus notabilis
ref|XP_009132417.1|  PREDICTED: protein translation factor SUI1 h...    178   1e-54   Brassica rapa
gb|ACV50429.1|  eukaryotic translation initiation factor SUI1           179   1e-54   Jatropha curcas
ref|NP_568818.1|  translation initiation factor SUI1 family protein     178   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003617548.1|  Translation factor SUI1-like protein               178   2e-54   Medicago truncatula
ref|XP_009338696.1|  PREDICTED: protein translation factor SUI1 h...    178   2e-54   Pyrus x bretschneideri [bai li]
emb|CDY43020.1|  BnaA03g11670D                                          177   4e-54   Brassica napus [oilseed rape]
gb|KJB11840.1|  hypothetical protein B456_002G088900                    177   6e-54   Gossypium raimondii
ref|XP_006401506.1|  hypothetical protein EUTSA_v10015063mg             176   8e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010482910.1|  PREDICTED: protein translation factor SUI1 h...    176   8e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008349901.1|  PREDICTED: protein translation factor SUI1 h...    176   9e-54   
ref|XP_010276095.1|  PREDICTED: protein translation factor SUI1 h...    176   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004294387.1|  PREDICTED: protein translation factor SUI1 h...    176   2e-53   Fragaria vesca subsp. vesca
gb|ABQ42058.1|  putative translation factor                             176   2e-53   Sonneratia caseolaris
ref|XP_007020819.1|  Translation initiation factor SUI1 family pr...    176   2e-53   
gb|ABQ42057.1|  putative translation factor                             175   2e-53   Sonneratia alba
ref|XP_006281351.1|  hypothetical protein CARUB_v10027407mg             175   2e-53   
gb|EEC79466.1|  hypothetical protein OsI_20483                          179   2e-53   Oryza sativa Indica Group [Indian rice]
gb|KJB62620.1|  hypothetical protein B456_009G426500                    175   3e-53   Gossypium raimondii
ref|XP_002522857.1|  translation factor sui1, putative                  174   9e-53   
gb|KHN11920.1|  Protein translation factor SUI1-like protein            174   1e-52   Glycine soja [wild soybean]
gb|AFW78548.1|  LOW QUALITY PROTEIN: protein translation factor SUI1    176   1e-52   
ref|XP_009417250.1|  PREDICTED: protein translation factor SUI1 h...    173   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278682.1|  PREDICTED: protein translation factor SUI1 h...    173   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008365050.1|  PREDICTED: protein translation factor SUI1 h...    173   2e-52   
gb|AAM77753.1|AF521961_1  translation initiation factor B04             173   2e-52   Helianthus annuus
ref|XP_006304318.1|  hypothetical protein CARUB_v10010698mg             173   2e-52   Capsella rubella
ref|NP_175831.1|  protein translation factor SUI1-2                     172   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010232448.1|  PREDICTED: protein translation factor SUI1 h...    174   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_009378877.1|  PREDICTED: protein translation factor SUI1 h...    172   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_007216425.1|  hypothetical protein PRUPE_ppa022105mg             174   4e-52   
gb|EEE67305.1|  hypothetical protein OsJ_24532                          176   4e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KHG12156.1|  hypothetical protein F383_20129                         172   4e-52   Gossypium arboreum [tree cotton]
ref|XP_008365631.1|  PREDICTED: protein translation factor SUI1 h...    172   4e-52   Malus domestica [apple tree]
ref|XP_007142286.1|  hypothetical protein PHAVU_008G267800g             172   4e-52   Phaseolus vulgaris [French bean]
gb|AFK35113.1|  unknown                                                 172   4e-52   Lotus japonicus
emb|CDY46663.1|  BnaA03g48450D                                          175   4e-52   Brassica napus [oilseed rape]
ref|XP_009120023.1|  PREDICTED: protein translation factor SUI1 h...    172   5e-52   
ref|XP_010501111.1|  PREDICTED: protein translation factor SUI1 h...    171   7e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001055949.1|  Os05g0498400                                       171   7e-52   
emb|CDX92777.1|  BnaC07g40350D                                          174   8e-52   
gb|KDP39065.1|  hypothetical protein JCGZ_00822                         171   9e-52   Jatropha curcas
ref|XP_011096112.1|  PREDICTED: protein translation factor SUI1 h...    171   1e-51   Sesamum indicum [beniseed]
emb|CDY17292.1|  BnaA10g09260D                                          175   1e-51   Brassica napus [oilseed rape]
ref|XP_006413104.1|  hypothetical protein EUTSA_v10026037mg             176   1e-51   
gb|KHG23747.1|  hypothetical protein F383_10557                         171   1e-51   Gossypium arboreum [tree cotton]
ref|XP_009106912.1|  PREDICTED: protein translation factor SUI1 h...    171   1e-51   Brassica rapa
gb|KJB62619.1|  hypothetical protein B456_009G426400                    174   1e-51   Gossypium raimondii
gb|AFD22856.1|  eukaryotic translation initiation factor SUI1-lik...    171   1e-51   Tamarix androssowii
ref|XP_010539284.1|  PREDICTED: protein translation factor SUI1 h...    171   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_006279715.1|  hypothetical protein CARUB_v10027405mg             171   2e-51   Capsella rubella
gb|AFK48465.1|  unknown                                                 170   2e-51   Lotus japonicus
ref|XP_002867520.1|  hypothetical protein ARALYDRAFT_492082             170   2e-51   
gb|KHG30632.1|  hypothetical protein F383_00215                         170   2e-51   Gossypium arboreum [tree cotton]
ref|XP_010448172.1|  PREDICTED: protein translation factor SUI1 h...    170   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010062975.1|  PREDICTED: protein translation factor SUI1 h...    170   3e-51   Eucalyptus grandis [rose gum]
gb|AFK48865.1|  unknown                                                 170   3e-51   Lotus japonicus
ref|XP_010930963.1|  PREDICTED: protein translation factor SUI1 h...    170   3e-51   Elaeis guineensis
gb|KHN46541.1|  Protein translation factor SUI1 like 1                  171   3e-51   Glycine soja [wild soybean]
ref|NP_194443.1|  protein translation factor SUI1-1                     170   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542418.1|  PREDICTED: protein translation factor SUI1 h...    170   3e-51   Tarenaya hassleriana [spider flower]
sp|Q9SQF4.1|SUI1_BRAOL  RecName: Full=Protein translation factor ...    170   3e-51   Brassica oleracea
ref|NP_200287.1|  translation initiation factor SUI1 family protein     170   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784556.1|  PREDICTED: protein translation factor SUI1 h...    170   3e-51   Phoenix dactylifera
gb|ADV04053.1|  eukaryotic translation initiation factor 2              169   4e-51   Hevea brasiliensis [jebe]
emb|CDY26128.1|  BnaC06g10680D                                          169   5e-51   Brassica napus [oilseed rape]
ref|XP_007213988.1|  hypothetical protein PRUPE_ppa013607mg             169   5e-51   Prunus persica
ref|XP_009594373.1|  PREDICTED: protein translation factor SUI1 h...    169   5e-51   Nicotiana tomentosiformis
gb|KJB13596.1|  hypothetical protein B456_002G083300                    169   6e-51   Gossypium raimondii
ref|XP_010545205.1|  PREDICTED: protein translation factor SUI1 h...    169   6e-51   Tarenaya hassleriana [spider flower]
ref|XP_002281872.1|  PREDICTED: protein translation factor SUI1 h...    169   6e-51   Vitis vinifera
ref|XP_010931827.1|  PREDICTED: protein translation factor SUI1 h...    169   6e-51   Elaeis guineensis
ref|XP_011097918.1|  PREDICTED: protein translation factor SUI1 h...    169   6e-51   Sesamum indicum [beniseed]
gb|KHG06771.1|  hypothetical protein F383_09792                         169   6e-51   Gossypium arboreum [tree cotton]
ref|XP_009774027.1|  PREDICTED: protein translation factor SUI1 h...    169   6e-51   Nicotiana sylvestris
ref|XP_007132953.1|  hypothetical protein PHAVU_011G139000g             169   7e-51   Phaseolus vulgaris [French bean]
gb|KHG06773.1|  hypothetical protein F383_09794                         169   7e-51   Gossypium arboreum [tree cotton]
ref|XP_008803218.1|  PREDICTED: protein translation factor SUI1 h...    169   7e-51   Phoenix dactylifera
ref|XP_008244365.1|  PREDICTED: protein translation factor SUI1 h...    169   8e-51   Prunus mume [ume]
ref|XP_002458630.1|  hypothetical protein SORBIDRAFT_03g036990          169   8e-51   Sorghum bicolor [broomcorn]
ref|XP_007132567.1|  hypothetical protein PHAVU_011G105700g             169   9e-51   Phaseolus vulgaris [French bean]
ref|XP_004244151.1|  PREDICTED: protein translation factor SUI1 h...    169   9e-51   Solanum lycopersicum
ref|XP_003568176.1|  PREDICTED: protein translation factor SUI1 h...    169   9e-51   Brachypodium distachyon [annual false brome]
ref|XP_007132952.1|  hypothetical protein PHAVU_011G138900g             169   9e-51   Phaseolus vulgaris [French bean]
ref|NP_001150984.1|  GOS2 homolog                                       169   9e-51   
ref|XP_011011189.1|  PREDICTED: protein translation factor SUI1 h...    169   1e-50   Populus euphratica
ref|NP_001239651.1|  uncharacterized protein LOC100784390               169   1e-50   Glycine max [soybeans]
gb|EYU27827.1|  hypothetical protein MIMGU_mgv1a016640mg                168   1e-50   Erythranthe guttata [common monkey flower]
ref|NP_001152681.1|  LOC100286322                                       168   1e-50   Zea mays [maize]
ref|XP_003564393.1|  PREDICTED: protein translation factor SUI1 h...    168   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_009388867.1|  PREDICTED: protein translation factor SUI1 h...    168   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001059843.1|  Os07g0529800                                       168   2e-50   
ref|XP_006370639.1|  hypothetical protein POPTR_0001s44450g             168   2e-50   Populus trichocarpa [western balsam poplar]
gb|ADV04054.1|  eukaryotic translation initiation factor 3              168   2e-50   Hevea brasiliensis [jebe]
ref|XP_004957905.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   
ref|XP_009412007.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007021029.1|  Translation initiation factor SUI1 family pr...    168   2e-50   
ref|XP_002532561.1|  translation factor sui1, putative                  168   2e-50   Ricinus communis
ref|XP_002280157.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   
ref|XP_009408662.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401666.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009109147.1|  PREDICTED: protein translation factor SUI1 h...    168   2e-50   Brassica rapa
ref|XP_011048301.1|  PREDICTED: protein translation factor SUI1 h...    167   2e-50   Populus euphratica
ref|XP_006284787.1|  hypothetical protein CARUB_v10006056mg             167   2e-50   
ref|XP_003596650.1|  Translation factor Sui1-like protein               167   2e-50   Medicago truncatula
ref|XP_009137639.1|  PREDICTED: protein translation factor SUI1 h...    167   2e-50   Brassica rapa
ref|NP_001104887.1|  protein translation factor SUI1 homolog            167   2e-50   Zea mays [maize]
gb|KHN38274.1|  Protein translation factor SUI1 like                    167   3e-50   Glycine soja [wild soybean]
ref|XP_006363526.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Solanum tuberosum [potatoes]
ref|XP_008809850.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Phoenix dactylifera
ref|XP_009397784.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010035571.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Eucalyptus grandis [rose gum]
ref|NP_001044504.2|  Os01g0794500                                       167   3e-50   
ref|XP_010909791.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Elaeis guineensis
ref|XP_004294347.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-50   Fragaria vesca subsp. vesca
gb|AFC01199.1|  eukaryotic translation initiation factor                167   4e-50   Ammopiptanthus mongolicus
ref|XP_006475205.1|  PREDICTED: protein translation factor SUI1 h...    167   4e-50   Citrus sinensis [apfelsine]
gb|KJB81730.1|  hypothetical protein B456_013G159400                    167   4e-50   Gossypium raimondii
sp|Q9SM41.1|SUI1_SPOST  RecName: Full=Protein translation factor ...    167   4e-50   Sporobolus stapfianus [resurrection grass]
ref|XP_004159225.1|  PREDICTED: protein translation factor SUI1 h...    169   4e-50   
sp|O82569.1|SUI1_PIMBR  RecName: Full=Protein translation factor ...    167   5e-50   Spuriopimpinella brachycarpa
ref|XP_010240920.1|  PREDICTED: protein translation factor SUI1 h...    167   5e-50   Nelumbo nucifera [Indian lotus]
emb|CAC84489.1|  putative translation factor                            167   5e-50   Pinus pinaster [cluster pine]
ref|XP_004287929.1|  PREDICTED: protein translation factor SUI1 h...    167   5e-50   Fragaria vesca subsp. vesca
ref|XP_007215170.1|  hypothetical protein PRUPE_ppa013601mg             167   5e-50   Prunus persica
ref|XP_004970238.1|  PREDICTED: protein translation factor SUI1 h...    167   6e-50   Setaria italica
gb|KHG11307.1|  hypothetical protein F383_12372                         166   7e-50   Gossypium arboreum [tree cotton]
gb|EEE55519.1|  hypothetical protein OsJ_03741                          168   7e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002310461.1|  SUI1 family protein                                166   7e-50   Populus trichocarpa [western balsam poplar]
emb|CDY10602.1|  BnaC03g70120D                                          166   8e-50   Brassica napus [oilseed rape]
ref|XP_004487600.1|  PREDICTED: protein translation factor SUI1 h...    166   8e-50   
gb|EPS65463.1|  hypothetical protein M569_09315                         166   9e-50   Genlisea aurea
ref|XP_002310460.1|  hypothetical protein POPTR_0007s02520g             166   9e-50   Populus trichocarpa [western balsam poplar]
ref|XP_003527483.1|  PREDICTED: protein translation factor SUI1 h...    166   9e-50   Glycine max [soybeans]
gb|KHN41202.1|  Protein translation factor SUI1 like                    166   1e-49   Glycine soja [wild soybean]
gb|EYU33614.1|  hypothetical protein MIMGU_mgv1a016641mg                166   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_004144489.1|  PREDICTED: protein translation factor SUI1 h...    166   1e-49   Cucumis sativus [cucumbers]
gb|ABO15891.1|  translation initiation factor eIF1                      166   1e-49   synthetic construct
ref|XP_010694233.1|  PREDICTED: protein translation factor SUI1 h...    166   1e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG17081.1|  Protein translation factor SUI1                         167   1e-49   Gossypium arboreum [tree cotton]
ref|XP_009800522.1|  PREDICTED: protein translation factor SUI1 h...    166   1e-49   Nicotiana sylvestris
ref|XP_006352492.1|  PREDICTED: protein translation factor SUI1 h...    166   1e-49   Solanum tuberosum [potatoes]
ref|XP_004248369.1|  PREDICTED: protein translation factor SUI1 h...    166   2e-49   Solanum lycopersicum
ref|XP_006447521.1|  hypothetical protein CICLE_v10017243mg             166   2e-49   Citrus clementina [clementine]
ref|XP_004234488.1|  PREDICTED: protein translation factor SUI1 h...    166   2e-49   Solanum lycopersicum
ref|XP_010923943.1|  PREDICTED: protein translation factor SUI1 h...    166   2e-49   Elaeis guineensis
ref|XP_002316980.1|  hypothetical protein POPTR_0011s13810g             166   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010267759.1|  PREDICTED: protein translation factor SUI1 h...    165   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011030847.1|  PREDICTED: protein translation factor SUI1 h...    165   2e-49   Populus euphratica
emb|CDP20340.1|  unnamed protein product                                165   2e-49   Coffea canephora [robusta coffee]
ref|XP_004304159.1|  PREDICTED: protein translation factor SUI1 h...    165   2e-49   Fragaria vesca subsp. vesca
ref|XP_008341979.1|  PREDICTED: protein translation factor SUI1 h...    165   3e-49   Malus domestica [apple tree]
gb|ACS68685.1|  putative translation factor                             164   3e-49   Sonneratia alba
ref|NP_001238017.1|  uncharacterized protein LOC100306129               165   3e-49   Glycine max [soybeans]
ref|NP_001236633.1|  uncharacterized protein LOC100499833               165   3e-49   Glycine max [soybeans]
sp|O48650.1|SUI1_SALBA  RecName: Full=Protein translation factor ...    165   3e-49   Salix bakko [Japanese willow]
gb|KHN02839.1|  Protein translation factor SUI1 like 2                  166   3e-49   Glycine soja [wild soybean]
ref|XP_002960838.1|  hypothetical protein SELMODRAFT_437304             164   4e-49   Selaginella moellendorffii
gb|EPS74118.1|  hypothetical protein M569_00639                         164   4e-49   Genlisea aurea
ref|XP_004515084.1|  PREDICTED: protein translation factor SUI1 h...    164   4e-49   Cicer arietinum [garbanzo]
ref|XP_008230087.1|  PREDICTED: protein translation factor SUI1 h...    164   4e-49   Prunus mume [ume]
emb|CDO99708.1|  unnamed protein product                                164   5e-49   Coffea canephora [robusta coffee]
ref|XP_010105571.1|  Protein translation factor SUI1-1-like protein     167   5e-49   
ref|XP_008341842.1|  PREDICTED: protein translation factor SUI1 h...    164   6e-49   Malus domestica [apple tree]
ref|XP_003527319.1|  PREDICTED: protein translation factor SUI1 h...    164   7e-49   Glycine max [soybeans]
ref|XP_009603077.1|  PREDICTED: protein translation factor SUI1 h...    164   8e-49   Nicotiana tomentosiformis
ref|XP_009771770.1|  PREDICTED: protein translation factor SUI1 h...    164   8e-49   Nicotiana sylvestris
gb|EEC82174.1|  hypothetical protein OsI_26284                          177   8e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_009342251.1|  PREDICTED: protein translation factor SUI1 h...    163   1e-48   Pyrus x bretschneideri [bai li]
gb|KEH29652.1|  eukaryotic translation initiation factor SUI1           163   1e-48   Medicago truncatula
gb|ACG24808.1|  protein translation factor SUI1                         163   1e-48   Zea mays [maize]
ref|XP_009611793.1|  PREDICTED: protein translation factor SUI1 h...    163   1e-48   Nicotiana tomentosiformis
gb|EYU19220.1|  hypothetical protein MIMGU_mgv1a016636mg                163   2e-48   Erythranthe guttata [common monkey flower]
gb|ABI48954.1|  putative protein translation factor Sui1                163   2e-48   Viola baoshanensis
gb|ACN30624.1|  unknown                                                 162   2e-48   Zea mays [maize]
ref|XP_009624679.1|  PREDICTED: protein translation factor SUI1 h...    163   2e-48   Nicotiana tomentosiformis
gb|KCW46999.1|  hypothetical protein EUGRSUZ_K00804                     163   2e-48   Eucalyptus grandis [rose gum]
ref|XP_006644837.1|  PREDICTED: protein translation factor SUI1 h...    162   2e-48   Oryza brachyantha
gb|ABY75806.1|  SUI1 A protein                                          162   2e-48   Opuntia streptacantha
ref|XP_009398183.1|  PREDICTED: protein translation factor SUI1 h...    162   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD58628.1|  SUI1 protein                                           162   2e-48   Coffea arabica [arabica coffee]
gb|AFK43238.1|  unknown                                                 162   3e-48   Medicago truncatula
emb|CDP05794.1|  unnamed protein product                                162   3e-48   Coffea canephora [robusta coffee]
ref|XP_008810164.1|  PREDICTED: protein translation factor SUI1 h...    164   4e-48   
emb|CAD58629.1|  SUI1 protein                                           162   4e-48   Coffea arabica [arabica coffee]
ref|XP_004961617.1|  PREDICTED: protein translation factor SUI1 h...    161   7e-48   
gb|AGT16828.1|  protein translation factor SUI1                         161   8e-48   Saccharum hybrid cultivar R570
gb|AFW78550.1|  hypothetical protein ZEAMMB73_586492                    161   1e-47   
ref|NP_001274850.1|  uncharacterized protein LOC102577437               160   1e-47   Solanum tuberosum [potatoes]
ref|XP_010272070.1|  PREDICTED: protein translation factor SUI1 h...    160   2e-47   Nelumbo nucifera [Indian lotus]
gb|KJB39023.1|  hypothetical protein B456_007G314400                    160   2e-47   Gossypium raimondii
gb|KDP20792.1|  hypothetical protein JCGZ_21263                         160   2e-47   Jatropha curcas
ref|XP_002316065.1|  hypothetical protein POPTR_0010s16160g             159   3e-47   Populus trichocarpa [western balsam poplar]
gb|KEH38847.1|  eukaryotic translation initiation factor SUI1           159   4e-47   Medicago truncatula
ref|XP_004970237.1|  PREDICTED: protein translation factor SUI1 h...    159   5e-47   
ref|XP_006370638.1|  hypothetical protein POPTR_0001s44450g             159   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007021023.1|  Translation initiation factor SUI1 family pr...    160   5e-47   
ref|XP_006475204.1|  PREDICTED: protein translation factor SUI1 h...    159   6e-47   
gb|KEH38845.1|  eukaryotic translation initiation factor SUI1           159   7e-47   Medicago truncatula
ref|XP_002985789.1|  hypothetical protein SELMODRAFT_234882             158   9e-47   Selaginella moellendorffii
ref|XP_004144491.1|  PREDICTED: protein translation factor SUI1 h...    157   2e-46   
ref|XP_006827315.1|  hypothetical protein AMTR_s00010p00266770          159   3e-46   
ref|XP_004487599.1|  PREDICTED: protein translation factor SUI1 h...    157   3e-46   
ref|XP_006452372.1|  hypothetical protein CICLE_v10009975mg             156   6e-46   Citrus clementina [clementine]
ref|XP_009624686.1|  PREDICTED: protein translation factor SUI1 h...    156   6e-46   
ref|XP_006591819.1|  PREDICTED: uncharacterized protein LOC100306...    156   7e-46   
gb|ABK24036.1|  unknown                                                 156   8e-46   Picea sitchensis
ref|XP_006352509.1|  PREDICTED: protein translation factor SUI1 h...    156   1e-45   Solanum tuberosum [potatoes]
gb|EMS51805.1|  Protein translation factor SUI1-like protein            157   1e-45   Triticum urartu
ref|XP_010109526.1|  Protein translation factor SUI1-1-like protein     157   1e-45   
gb|AAM34279.1|AF508969_1  translation initiation factor                 155   2e-45   Triticum aestivum [Canadian hard winter wheat]
gb|KEH38844.1|  eukaryotic translation initiation factor SUI1           155   2e-45   Medicago truncatula
ref|XP_002976303.1|  hypothetical protein SELMODRAFT_232756             155   3e-45   Selaginella moellendorffii
ref|XP_003562997.1|  PREDICTED: protein translation factor SUI1 h...    154   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_008647990.1|  PREDICTED: LOC100286322 isoform X2                 154   5e-45   Zea mays [maize]
ref|XP_008351221.1|  PREDICTED: protein translation factor SUI1 h...    154   7e-45   
gb|EMT21575.1|  Protein translation factor SUI1-like protein            153   1e-44   
gb|KJB39025.1|  hypothetical protein B456_007G314400                    153   1e-44   Gossypium raimondii
gb|ADJ67213.1|  hypothetical protein                                    152   1e-44   Jatropha curcas
gb|EMS63057.1|  Protein translation factor SUI1-like protein            152   2e-44   Triticum urartu
ref|XP_006833020.1|  hypothetical protein AMTR_s00094p00033760          151   4e-44   
gb|KCW70138.1|  hypothetical protein EUGRSUZ_F03432                     154   5e-44   Eucalyptus grandis [rose gum]
ref|XP_001756581.1|  predicted protein                                  151   7e-44   
gb|ADU56181.1|  hypothetical protein                                    150   7e-44   Jatropha curcas
dbj|BAN10326.1|  translation initiation factor SUI1 family protein      150   1e-43   Buxus microphylla var. japonica
gb|ADJ67174.1|  hypothetical protein                                    149   2e-43   Jatropha curcas
gb|EMT13356.1|  Protein translation factor SUI1-like protein            150   2e-43   
dbj|BAN10309.1|  eukaryotic translation initiation factor SUI1          149   2e-43   Chamaecyparis obtusa
gb|EMT19520.1|  Protein translation factor SUI1-like protein            149   3e-42   
ref|XP_006372949.1|  hypothetical protein POPTR_0017s06480g             145   7e-42   
ref|XP_010327265.1|  PREDICTED: protein translation factor SUI1 h...    144   4e-41   Solanum lycopersicum
emb|CAB56294.1|  putative protein translation factor                    143   4e-41   Phleum pratense [timothy]
ref|XP_010533344.1|  PREDICTED: protein translation factor SUI1 h...    143   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_001752498.1|  predicted protein                                  142   2e-40   
ref|XP_008776100.1|  PREDICTED: protein translation factor SUI1 h...    143   2e-40   Phoenix dactylifera
ref|XP_005645489.1|  translation initiation factor SU                   139   6e-39   Coccomyxa subellipsoidea C-169
gb|KJB62621.1|  hypothetical protein B456_009G426500                    136   2e-38   Gossypium raimondii
ref|XP_010092162.1|  Protein translation factor SUI1-like protein       137   3e-38   Morus notabilis
gb|KDD75795.1|  hypothetical protein H632_c495p1                        135   2e-37   Helicosporidium sp. ATCC 50920
gb|KJB45591.1|  hypothetical protein B456_007G314200                    133   4e-37   Gossypium raimondii
gb|KJB78392.1|  hypothetical protein B456_013G163400                    133   6e-37   Gossypium raimondii
gb|AFW78551.1|  hypothetical protein ZEAMMB73_586492                    133   7e-37   
gb|KJB13597.1|  hypothetical protein B456_002G083300                    132   1e-36   
gb|KIZ01467.1|  putative Protein translation factor SUI1 like pro...    135   1e-36   
dbj|BAF63490.1|  translational initiation factor eIF1                   131   2e-36   
ref|XP_001691459.1|  translation initiation protein                     131   4e-36   
ref|XP_002949286.1|  hypothetical protein VOLCADRAFT_109710             131   5e-36   
ref|XP_006284788.1|  hypothetical protein CARUB_v10006056mg             131   6e-36   
gb|KJB13598.1|  hypothetical protein B456_002G083300                    130   6e-36   
gb|AFW75026.1|  hypothetical protein ZEAMMB73_109319                    129   8e-36   
tpg|DAA62968.1|  TPA: translation initiation factor1                    130   1e-35   
gb|KEH38846.1|  eukaryotic translation initiation factor SUI1           129   2e-35   
ref|XP_008650268.1|  PREDICTED: protein translation factor SUI1 h...    128   3e-35   
ref|XP_004515083.1|  PREDICTED: protein translation factor SUI1 h...    128   1e-34   
ref|XP_008382302.1|  PREDICTED: protein translation factor SUI1 h...    127   3e-34   
ref|XP_009138116.1|  PREDICTED: probable phenylalanine--tRNA liga...    129   4e-34   
ref|XP_005847583.1|  hypothetical protein CHLNCDRAFT_133842             125   1e-33   
ref|XP_011396751.1|  Translation factor SUI1-like protein 1             124   5e-33   
emb|CDH49154.1|  eukaryotic translation initiation factor 1             123   6e-33   
ref|XP_003580602.2|  PREDICTED: splicing factor, proline- and glu...    128   6e-33   
gb|EAY95661.1|  hypothetical protein OsI_17527                          125   2e-32   
gb|ACD99647.1|  translation initiation factor                           125   2e-32   
emb|CAJ86367.1|  OSIGBa0117N13.11                                       125   4e-32   
ref|XP_010090607.1|  Protein translation factor SUI1-like protein       120   7e-32   
emb|CEG82542.1|  Putative Translation initiation factor SUI1            119   2e-31   
emb|CDY02665.1|  BnaC02g07700D                                          124   2e-31   
gb|AFN10635.1|  translation initiation factor-like protein              118   3e-31   
ref|XP_002448570.1|  hypothetical protein SORBIDRAFT_06g029340          123   3e-31   
gb|ACN30667.1|  unknown                                                 119   3e-31   
ref|NP_001053955.1|  Os04g0627900                                       122   4e-31   
dbj|BAK05450.1|  predicted protein                                      118   5e-31   
emb|CEJ03608.1|  Putative Translation initiation factor SUI1            118   5e-31   
gb|ADM67806.1|  putative eukaryotic translation initiation factor...    116   9e-31   
gb|AFK42504.1|  unknown                                                 117   2e-30   
emb|CDO92794.1|  unnamed protein product                                116   2e-30   
ref|XP_452335.1|  hypothetical protein                                  116   2e-30   
gb|ADM67808.1|  putative eukaryotic translation initiation factor...    115   3e-30   
ref|XP_007267881.1|  eukaryotic translation initiation factor SUI1      116   4e-30   
dbj|GAC71792.1|  translation initiation factor 1                        116   4e-30   
dbj|BAD97168.1|  translation factor sui1 homolog                        116   4e-30   
emb|CBQ73048.1|  probable translation initiation factor SUI1            116   4e-30   
ref|XP_005539321.1|  probable eukaryotic translation initiation f...    115   5e-30   
ref|XP_004177891.1|  hypothetical protein TBLA_0A05790                  115   5e-30   
ref|XP_007418771.1|  hypothetical protein MELLADRAFT_84135              115   7e-30   
dbj|GAN03056.1|  eukaryotic translation initiation factor SUI1          115   8e-30   
emb|CCO28058.1|  Protein translation factor SUI1                        115   9e-30   
ref|XP_003957154.1|  hypothetical protein KAFR_0D03710                  114   1e-29   
emb|CCK70740.1|  hypothetical protein KNAG_0F00710                      114   1e-29   
gb|KIL68601.1|  hypothetical protein M378DRAFT_120853                   115   1e-29   
emb|CDI53525.1|  probable translation initiation factor SUI1            114   2e-29   
gb|EUC62160.1|  eukaryotic translation initiation factor SUI1           114   2e-29   
ref|XP_006377837.1|  hypothetical protein POPTR_0011s13810g             113   2e-29   
gb|ERZ95524.1|  hypothetical protein GLOINDRAFT_341178                  114   2e-29   
emb|CEG78008.1|  Putative Translation initiation factor SUI1            114   2e-29   
ref|XP_001731784.1|  hypothetical protein MGL_1052                      114   2e-29   
ref|XP_448041.1|  hypothetical protein                                  114   2e-29   
emb|CAE04242.3|  OSJNBa0089N06.3                                        121   2e-29   
ref|XP_003670956.1|  hypothetical protein NDAI_0F03950                  114   3e-29   
gb|EPB81403.1|  hypothetical protein HMPREF1544_11892                   114   3e-29   
emb|CDR41170.1|  CYFA0S06e03092g1_1                                     115   3e-29   
gb|EST05525.1|  translation initiation factor 1                         114   3e-29   
gb|KIY98436.1|  putative Protein translation factor SUI1 like pro...    113   4e-29   
ref|XP_004706531.1|  PREDICTED: eukaryotic translation initiation...    114   4e-29   
gb|ETS64770.1|  hypothetical protein PaG_00729                          117   4e-29   
ref|NP_014155.1|  translation initiation factor eIF1                    113   5e-29   
ref|XP_011389050.1|  putative translation initiation factor eIF1        113   5e-29   
ref|XP_007286334.1|  translation initiation factor                      113   5e-29   
gb|ENH77587.1|  translation initiation factor                           113   5e-29   
gb|EIE77311.1|  translation initiation factor SUI1                      113   6e-29   
gb|ELU11301.1|  hypothetical protein CAPTEDRAFT_160473                  113   6e-29   
gb|EIE79257.1|  translation initiation factor SUI1                      112   6e-29   
emb|CEP64385.1|  LALA0S11e02872g1_1                                     112   7e-29   
ref|XP_004334397.1|  protein translation factor, putative               112   8e-29   
ref|XP_006041882.1|  PREDICTED: eukaryotic translation initiation...    112   8e-29   
gb|EQB58948.1|  hypothetical protein CGLO_00736                         112   8e-29   
ref|XP_003673034.1|  hypothetical protein NCAS_0A00830                  112   8e-29   
gb|ADB54840.1|  eukaryotic translation initiation factor 1              112   8e-29   
ref|XP_002554352.1|  KLTH0F03234p                                       112   8e-29   
emb|CCF52891.1|  probable translation initiation factor SUI1            112   9e-29   
gb|AJT06393.1|  Sui1p                                                   112   9e-29   
ref|NP_001037082.1|  protein translation factor SUI1 homolog            112   9e-29   
ref|XP_004712205.1|  PREDICTED: eukaryotic translation initiation...    112   1e-28   
gb|EFQ29558.1|  translation initiation factor SUI1                      112   1e-28   
dbj|GAA25864.1|  K7_Sui1p                                               112   1e-28   
ref|XP_007799176.1|  putative translation initiation factor protein     112   1e-28   
ref|XP_003684518.1|  hypothetical protein TPHA_0B04140                  112   1e-28   
ref|XP_002497891.1|  ZYRO0F15884p                                       112   1e-28   
ref|XP_003680684.1|  hypothetical protein TDEL_0C05840                  112   1e-28   
ref|XP_003319710.1|  hypothetical protein PGTG_01884                    112   1e-28   
ref|XP_011105142.1|  sui1p                                              112   1e-28   
emb|CDK25787.1|  unnamed protein product                                112   1e-28   
emb|CCF41479.1|  eukaryotic translation initiation factor eIF-1         112   1e-28   
gb|ELU44743.1|  SUI1 domain-containing protein                          115   1e-28   
ref|XP_007763994.1|  eukaryotic translation initiation factor SUI1      112   1e-28   
gb|KEQ95419.1|  hypothetical protein AUEXF2481DRAFT_5024                112   2e-28   
gb|KIM87020.1|  hypothetical protein PILCRDRAFT_815455                  112   2e-28   
ref|XP_001833664.2|  eukaryotic translation initiation factor 1         111   2e-28   
ref|XP_005707772.1|  protein translation factor                         111   2e-28   
ref|XP_001646920.1|  hypothetical protein Kpol_2000p26                  111   2e-28   
ref|NP_983701.1|  ADL395Cp                                              111   2e-28   
gb|KII88592.1|  hypothetical protein PLICRDRAFT_111559                  111   2e-28   
ref|XP_005344888.1|  PREDICTED: eukaryotic translation initiation...    111   2e-28   
emb|CDF91750.1|  ZYBA0S14-00166g1_1                                     111   2e-28   
gb|KEQ66269.1|  putative translation initiation factor SUI1             111   3e-28   
ref|XP_005717422.1|  Translation initiation factor eIF1                 111   3e-28   
gb|KJB24471.1|  hypothetical protein B456_004G147000                    110   3e-28   
gb|ENN73110.1|  hypothetical protein YQE_10251                          111   3e-28   
ref|XP_001902992.1|  hypothetical protein                               111   3e-28   
gb|AFM87132.1|  translation factor sui1-like protein                    111   3e-28   
gb|KEQ72568.1|  putative translation initiation factor SUI1             111   4e-28   
emb|CDJ79841.1|  eukaryotic translation initiation factor 1             110   4e-28   
gb|KDQ60757.1|  hypothetical protein JAAARDRAFT_31728                   110   4e-28   
gb|KHK00035.1|  Translation initiation factor SUI1                      111   4e-28   
ref|XP_004194644.1|  Piso0_005151                                       110   4e-28   
gb|KIM49411.1|  hypothetical protein M413DRAFT_438590                   110   4e-28   
gb|ESW98385.1|  Eukaryotic translation initiation factor eIF-1          110   4e-28   
gb|KJB39022.1|  hypothetical protein B456_007G314400                    109   5e-28   
gb|KIY50999.1|  eukaryotic translation initiation factor 1              110   5e-28   
ref|XP_004519899.1|  PREDICTED: protein translation factor SUI1 h...    110   5e-28   
gb|KIJ69226.1|  hypothetical protein HYDPIDRAFT_145043                  110   5e-28   
gb|ETN67045.1|  sui1                                                    110   5e-28   
ref|XP_007338565.1|  eukaryotic translation initiation factor 1         110   5e-28   
ref|XP_009025362.1|  hypothetical protein HELRODRAFT_163156             110   6e-28   
ref|XP_007300579.1|  eukaryotic translation initiation factor 1         110   7e-28   
ref|XP_009217014.1|  eukaryotic translation initiation factor eIF-1     110   8e-28   
gb|KIO26221.1|  hypothetical protein M407DRAFT_243788                   110   9e-28   
gb|AGM32795.1|  eukaryotic initiation factor 1                          110   9e-28   
gb|KIM62075.1|  hypothetical protein SCLCIDRAFT_15919                   110   9e-28   
gb|AFN10636.1|  translation initiation factor-like protein              108   9e-28   
ref|XP_002838067.1|  hypothetical protein                               110   9e-28   
ref|XP_972771.1|  PREDICTED: protein translation factor SUI1 homolog    109   9e-28   
gb|EFX82803.1|  hypothetical protein DAPPUDRAFT_302358                  109   1e-27   
ref|XP_011122353.1|  hypothetical protein AOL_s00079g176                109   1e-27   
ref|XP_008551957.1|  PREDICTED: protein translation factor SUI1 h...    109   1e-27   
ref|XP_004195741.1|  Piso0_005151                                       109   1e-27   
ref|XP_002066294.1|  GK18213                                            109   1e-27   
ref|XP_011275934.1|  hypothetical protein BN7_1721                      109   1e-27   
gb|KDR81774.1|  hypothetical protein GALMADRAFT_239964                  109   1e-27   
gb|KJA27496.1|  hypothetical protein HYPSUDRAFT_35413                   109   1e-27   
ref|XP_009268812.1|  Protein translation factor SUI1                    109   2e-27   
ref|XP_002130503.1|  PREDICTED: eukaryotic translation initiation...    109   2e-27   
ref|XP_006959410.1|  eukaryotic translation initiation factor SUI1      109   2e-27   
gb|EJU05625.1|  eukaryotic translation initiation factor 1              109   2e-27   
ref|XP_004895335.1|  PREDICTED: eukaryotic translation initiation...    109   2e-27   
dbj|GAK64420.1|  eukaryotic translation initiation factor 1             118   2e-27   
ref|XP_007385723.1|  eukaryotic translation initiation factor 1         108   2e-27   
ref|XP_005187256.1|  PREDICTED: protein translation factor SUI1 h...    108   2e-27   
ref|XP_007321854.1|  hypothetical protein SERLADRAFT_475242             108   2e-27   
ref|XP_002432016.1|  translation factor sui1, putative                  108   2e-27   
ref|XP_001948896.1|  PREDICTED: protein translation factor SUI1 h...    108   2e-27   
gb|AFK40627.1|  unknown                                                 109   2e-27   
ref|XP_001661080.1|  AAEL010843-PA                                      108   3e-27   
ref|XP_001863733.1|  sui1                                               108   3e-27   
ref|XP_003486256.1|  PREDICTED: protein translation factor SUI1 h...    108   3e-27   
gb|KIM24002.1|  hypothetical protein M408DRAFT_332058                   108   3e-27   
ref|XP_001878593.1|  predicted protein                                  108   3e-27   
gb|ABV44713.1|  translation initiation factor 1-like protein            108   3e-27   
gb|ABR27954.1|  translation initiation factor 1                         108   4e-27   
dbj|BAN20281.1|  conserved hypothetical protein                         108   4e-27   
ref|XP_006675909.1|  hypothetical protein BATDEDRAFT_84447              108   4e-27   
ref|XP_007879556.1|  hypothetical protein PFL1_03842                    108   4e-27   
gb|AFM90303.1|  translation factor sui1-like protein                    108   4e-27   
emb|CDY33072.1|  BnaC06g07070D                                          108   4e-27   
ref|XP_460278.1|  DEHA2E22484p                                          108   5e-27   
dbj|GAN08090.1|  conserved hypothetical protein                         108   5e-27   
ref|XP_316499.2|  AGAP006459-PA                                         107   5e-27   
ref|XP_002172371.1|  translation initiation factor eIF1                 107   5e-27   
gb|KIY68625.1|  eukaryotic translation initiation factor SUI1           107   6e-27   
ref|XP_009172778.1|  hypothetical protein T265_08648                    108   6e-27   
ref|XP_002019643.1|  GL12102                                            107   7e-27   
ref|XP_534229.2|  PREDICTED: eukaryotic translation initiation fa...    107   7e-27   
ref|XP_011056576.1|  PREDICTED: protein translation factor SUI1 h...    110   8e-27   
ref|XP_003716163.1|  eukaryotic translation initiation factor eIF-1     107   8e-27   
gb|KIK06524.1|  hypothetical protein K443DRAFT_129804                   107   8e-27   
gb|AAT40136.1|  putative translation initiation factor                  106   9e-27   
ref|XP_003035163.1|  hypothetical protein SCHCODRAFT_81353              107   9e-27   
gb|ELQ38364.1|  translation factor SUI1                                 108   9e-27   
ref|NP_001155788.1|  eukaryotic translation initiation factor 1         107   9e-27   
ref|XP_007590547.1|  dioxygenase                                        113   1e-26   
gb|KDR15926.1|  Translation factor SUI1-like protein                    107   1e-26   
ref|XP_011115198.1|  hypothetical protein H072_9640                     109   1e-26   
ref|XP_011257191.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    109   1e-26   
dbj|BAH71030.1|  ACYPI004195                                            106   1e-26   
ref|XP_004363304.1|  translation initiation factor SUI1                 106   2e-26   
gb|KIK49310.1|  hypothetical protein CY34DRAFT_7608                     106   2e-26   
ref|XP_008328667.1|  PREDICTED: eukaryotic translation initiation...    106   2e-26   
ref|XP_004717826.1|  PREDICTED: eukaryotic translation initiation...    106   2e-26   
ref|XP_006634521.1|  PREDICTED: eukaryotic translation initiation...    106   2e-26   
ref|XP_002199008.1|  PREDICTED: eukaryotic translation initiation...    106   2e-26   
emb|CDS29728.1|  protein translation factor sui1                        106   2e-26   
ref|XP_007375453.1|  hypothetical protein SPAPADRAFT_55697              106   2e-26   
dbj|GAA57591.1|  translation initiation factor 1                        106   2e-26   
gb|ACO52071.1|  Eukaryotic translation initiation factor 1b             106   2e-26   
emb|CCG84468.1|  protein of unknown function                            105   3e-26   
gb|AAM93956.1|  protein translation factor                              105   3e-26   
gb|AAD19900.1|  putative translation initiation factor A121/Sui1        105   3e-26   
gb|EPX75032.1|  translation initiation factor eIF1                      105   3e-26   
ref|XP_011423571.1|  PREDICTED: eukaryotic translation initiation...    105   3e-26   
ref|XP_001989273.1|  GH10143                                            105   4e-26   
gb|KIO13603.1|  hypothetical protein M404DRAFT_122244                   106   4e-26   
gb|ACO10483.1|  translation factor SUI1 homolog                         105   4e-26   
gb|KFB35115.1|  AGAP006459-PA-like protein                              105   4e-26   
dbj|BAB29089.1|  unnamed protein product                                105   4e-26   
ref|XP_006638396.1|  PREDICTED: eukaryotic translation initiation...    105   4e-26   
ref|XP_003362611.1|  PREDICTED: eukaryotic translation initiation...    105   4e-26   
ref|XP_006883883.1|  PREDICTED: eukaryotic translation initiation...    105   4e-26   
gb|AAX37073.1|  translation factor sui1-like                            105   4e-26   
ref|XP_006108120.1|  PREDICTED: eukaryotic translation initiation...    105   4e-26   
ref|XP_003756178.1|  PREDICTED: eukaryotic translation initiation...    105   4e-26   
ref|NP_005866.1|  eukaryotic translation initiation factor 1b           105   5e-26   
ref|NP_001291770.1|  eukaryotic translation initiation factor 1         105   5e-26   
ref|NP_005792.1|  eukaryotic translation initiation factor 1            105   5e-26   
gb|EPY49607.1|  translation initiation factor eIF1                      105   5e-26   
ref|XP_009686092.1|  PREDICTED: eukaryotic translation initiation...    105   5e-26   
ref|XP_006894618.1|  PREDICTED: eukaryotic translation initiation...    105   5e-26   
ref|XP_001863732.1|  eukaryotic translation initiation factor 1b        105   5e-26   
gb|ELR59745.1|  Eukaryotic translation initiation factor 1b             105   5e-26   
ref|XP_004434545.1|  PREDICTED: eukaryotic translation initiation...    105   5e-26   
gb|ELR53946.1|  Eukaryotic translation initiation factor 1              105   5e-26   
gb|AAP36749.1|  Homo sapiens putative translation initiation factor     105   5e-26   
ref|XP_006008886.1|  PREDICTED: eukaryotic translation initiation...    105   5e-26   
ref|XP_004855393.1|  PREDICTED: eukaryotic translation initiation...    105   5e-26   



>ref|XP_011095399.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011095400.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   198 bits (503),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +PTAFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDLDLQIPTAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            D+KKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFL+SAG+VKK
Sbjct  61   DVKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKK  104



>ref|XP_006346213.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=112

 Score =   196 bits (499),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDIDVQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKK  104



>ref|XP_004244116.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=112

 Score =   196 bits (498),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDIDIQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKK  104



>ref|XP_009628718.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009778004.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=112

 Score =   195 bits (496),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK++SY+KILK
Sbjct  1    MVDIDVQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKQFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKK  104



>ref|XP_011097879.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   194 bits (494),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVEVDLQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNG VVQDKELGKVIQLQGDQRKNVSQFL+SAG+VKK
Sbjct  61   DLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKK  104



>ref|XP_006586085.1| PREDICTED: protein translation factor SUI1 homolog 2 [Glycine 
max]
 gb|KHM99561.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=157

 Score =   196 bits (497),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYS  263
            L QA YMVD+E  +P+AFDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+S
Sbjct  40   LQQAKYMVDLEIQVPSAFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFS  99

Query  264  YDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            Y+KILKDLKK+FCCNG VVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  100  YEKILKDLKKDFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  149



>ref|XP_002280065.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI26638.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   192 bits (489),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVELDLQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSNFLVQAGLVKK  104



>ref|XP_004500068.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cicer 
arietinum]
Length=112

 Score =   191 bits (485),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV++E  +PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVELEIQVPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV  GLV+K
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQVGLVRK  104



>gb|AFY13590.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13591.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13592.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13593.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13594.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13595.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13596.1| translation factor SUI1 [Aeschynomene denticulata]
 gb|AGC95066.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95067.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95068.1| translation factor SUI1 [Aeschynomene ciliata]
 gb|AGS78101.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78102.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78103.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78104.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78106.1| translation factor SUI1 [Aeschynomene scabra]
 gb|AGS78107.1| translation factor SUI1 [Aeschynomene rudis]
 gb|AGS78108.1| translation factor SUI1 [Aeschynomene sensitiva]
 gb|AGS78109.1| translation factor SUI1 [Aeschynomene sp. CPI104040]
 gb|AGS78111.1| translation factor SUI1 [Aeschynomene tambacoundensis]
 gb|AGS78112.1| translation factor SUI1 [Aeschynomene deamii]
 gb|AGS78114.1| translation factor SUI1 [Aeschynomene pratensis]
 gb|AGS78115.1| translation factor SUI1 [Aeschynomene virginica]
 gb|AGS78116.1| translation factor SUI1 [Aeschynomene virginica]
Length=112

 Score =   190 bits (482),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>gb|ADK79108.1| putative eukaryotic translation initiation factor SUI1 [Catharanthus 
roseus]
Length=112

 Score =   190 bits (482),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +PTAFDPFAEAK+SGAPGAKEYVHIR+QQRNGKK LTT+QGL+KE+S +KILK
Sbjct  1    MVDLDIQIPTAFDPFAEAKDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKEFSLEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGKVIQLQGDQRKNVSQFL++AG+VKK
Sbjct  61   DLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLITAGIVKK  104



>ref|XP_006602202.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Glycine max]
 ref|XP_006602203.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Glycine max]
Length=112

 Score =   189 bits (479),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNG VVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKEFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>gb|AFY13584.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13585.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13586.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13587.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13588.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13589.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGS78113.1| translation factor SUI1 [Aeschynomene pratensis]
Length=112

 Score =   188 bits (478),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>ref|XP_004152930.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_004168731.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_008463414.1| PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis 
melo]
 gb|KGN56126.1| hypothetical protein Csa_3G077610 [Cucumis sativus]
Length=112

 Score =   188 bits (477),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SYDKILK
Sbjct  1    MVDLDVQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYDKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKK  104



>gb|AGS78110.1| translation factor SUI1 [Aeschynomene filosa]
Length=112

 Score =   188 bits (477),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>ref|XP_007146479.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
 gb|ESW18473.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
Length=112

 Score =   187 bits (476),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV++E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVELEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>gb|KCW66993.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=261

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  87   HQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  266
            + A+YMV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY
Sbjct  145  NPANYMVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSY  204

Query  267  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +KILKDLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +VKK
Sbjct  205  EKILKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKK  253



>gb|KCW66994.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=260

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  87   HQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  266
            + A+YMV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY
Sbjct  144  NPANYMVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSY  203

Query  267  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +KILKDLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +VKK
Sbjct  204  EKILKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKK  252



>gb|AFK38938.1| unknown [Lotus japonicus]
Length=112

 Score =   186 bits (473),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +P  FDPFAEAKES APG KEYVH+RIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQIPNRFDPFAEAKESDAPGVKEYVHVRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FLV AGLVKK
Sbjct  61   DLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVKK  104



>gb|AGS78105.1| translation factor SUI1 [Aeschynomene indica]
Length=112

 Score =   186 bits (472),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E   P+ FDPFAEAKES APGAKEYVHIR+QQRNGKKSLTTVQGL+K +SY+KILK
Sbjct  1    MVDLEIQFPSPFDPFAEAKESDAPGAKEYVHIRVQQRNGKKSLTTVQGLKKGFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+K
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRK  104



>ref|XP_010060345.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 ref|XP_010060381.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW67040.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67041.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67042.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
Length=112

 Score =   186 bits (471),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKK  104



>gb|ABY75807.1| SUI1 B protein [Opuntia streptacantha]
Length=112

 Score =   184 bits (468),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD E  +P AFDPF+ AK+SGAPGAKEYV IRIQQRNGKKSLTTVQGLRK++SY++ILK
Sbjct  1    MVDYEVQIPAAFDPFSGAKDSGAPGAKEYVRIRIQQRNGKKSLTTVQGLRKDFSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV+ FLV AGLVKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVANFLVQAGLVKK  104



>ref|XP_003600096.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AES70347.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK42757.1| unknown [Medicago truncatula]
Length=112

 Score =   184 bits (468),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPFA+A ES APG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVELDIQIPTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRK VSQFLV AGLV+K
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRK  104



>ref|XP_004171416.1| PREDICTED: protein translation factor SUI1 homolog 1-like, partial 
[Cucumis sativus]
Length=110

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDFQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            D+KKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKK
Sbjct  61   DVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKK  104



>gb|EPS65465.1| hypothetical protein M569_09317 [Genlisea aurea]
Length=113

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKE-SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            MV++E  + +AFDPFAEAKE S APGAKEY+HIRIQQRNGKKSLTTVQGLRKE+SY+KIL
Sbjct  1    MVELEVEIRSAFDPFAEAKEDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNGNVV DKELGKVIQLQGDQRKNVSQFL++AGLVKK
Sbjct  61   KDLKKDFCCNGNVVHDKELGKVIQLQGDQRKNVSQFLINAGLVKK  105



>ref|XP_004139787.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
sativus]
 ref|XP_008447738.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
melo]
 gb|KGN44162.1| hypothetical protein Csa_7G209580 [Cucumis sativus]
Length=112

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDFQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            D+KKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKK
Sbjct  61   DVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKK  104



>gb|ACJ85979.1| unknown [Medicago truncatula]
Length=112

 Score =   182 bits (463),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPFA+A ES APG KEYVHIRIQQRNGKK LTTVQGL+K+YSY+KILK
Sbjct  1    MVELDIQIPTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKGLTTVQGLKKDYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRK VSQFLV AGLV+K
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRK  104



>ref|XP_010545223.1| PREDICTED: protein translation factor SUI1 homolog [Tarenaya 
hassleriana]
Length=112

 Score =   182 bits (461),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +PTAFDPFAEA++S APGAKEY+HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVDLDIQIPTAFDPFAEARDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV DKE GK+IQLQGDQRKNVSQF V  G+ KK
Sbjct  61   DLKKEFCCNGNVVHDKEQGKIIQLQGDQRKNVSQFFVQKGICKK  104



>ref|XP_010675717.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score =   182 bits (461),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +P A DPFAEA ESGAPG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVDIDFQIPAALDPFAEA-ESGAPGVKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  59

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRK V+ FLV AGLVKK
Sbjct  60   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKKVANFLVQAGLVKK  103



>gb|ADB85107.1| translation initiation factor-like protein [Jatropha curcas]
 gb|KDP39133.1| hypothetical protein JCGZ_00890 [Jatropha curcas]
Length=112

 Score =   181 bits (460),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +P AFDPF+EAK+SGAPGAKEYVHIRIQQRNG+KSLTTVQGL KE+SY+KI+K
Sbjct  1    MVDLEIQVPAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKKEFCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+A LV+K
Sbjct  61   ALKKEFCCNGNVVQDKELGKVIQLQGDQRKNVQSFLVNAQLVRK  104



>ref|XP_007212250.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_007212251.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_008226898.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008226900.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 gb|EMJ13449.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 gb|EMJ13450.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
Length=112

 Score =   181 bits (460),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPFAEAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY+KILK
Sbjct  1    MVELDVQIPTAFDPFAEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKK  104



>emb|CDY52575.1| BnaC03g71830D, partial [Brassica napus]
Length=158

 Score =   182 bits (463),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  87   HQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  266
            +Q  YMV+++  +P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY
Sbjct  42   NQVYYMVELDIQVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSY  101

Query  267  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +KILKDLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS FLV  G+ KK
Sbjct  102  EKILKDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKK  150



>emb|CDP05760.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   181 bits (458),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +P AFDPF E  +SGAPGAKEYVHIR+QQRNGKK LTT+QGL+K++S +KILK
Sbjct  1    MVDLDIQIPAAFDPFTEDNDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKDFSLEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKN SQFLV+AG+VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNASQFLVTAGIVKK  104



>gb|EYU33643.1| hypothetical protein MIMGU_mgv1a016664mg [Erythranthe guttata]
Length=112

 Score =   180 bits (457),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFA+A++ GA GAKEYVHIRIQQRNGKKSLTTVQGL+KE++Y+KILK
Sbjct  1    MVELDIQIPSAFDPFADAEDLGAIGAKEYVHIRIQQRNGKKSLTTVQGLKKEFNYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +LKKEFCCNGNVVQDKELGKV+QLQGDQRKNVSQFL+ AG+VKK
Sbjct  61   NLKKEFCCNGNVVQDKELGKVVQLQGDQRKNVSQFLIGAGIVKK  104



>ref|XP_009360995.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   180 bits (456),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+ +  +PTAFDPFAEAK+  APGAKEYVHIR+QQRNGKK LTTVQGL+K++SYDKILK
Sbjct  1    MVERDVQIPTAFDPFAEAKDVDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYDKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKK  104



>ref|XP_004491401.1| PREDICTED: protein translation factor SUI1 homolog [Cicer arietinum]
Length=110

 Score =   180 bits (456),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +PT FDPF+EAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDIQ--IPTTFDPFSEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  58

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV  KELGK+IQLQGDQRKNV+ FLV AGLV+K
Sbjct  59   DLKKEFCCNGNVVNCKELGKIIQLQGDQRKNVTHFLVHAGLVRK  102



>ref|XP_010448878.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
 ref|XP_010443083.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
Length=112

 Score =   179 bits (455),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+A+DPFAEAK+S APGAK+Y+HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQVPSAYDPFAEAKDSDAPGAKDYIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKK  104



>ref|XP_002866067.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42326.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score =   179 bits (455),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAFDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKK  104



>ref|XP_008359266.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   179 bits (454),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPF+EAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY KILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKK  104



>ref|XP_010092161.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
 gb|EXB50312.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
Length=111

 Score =   179 bits (453),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD +  +PT FDPFA A +S APGAKEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVDQDVQIPTTFDPFA-AIDSDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  59

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKK
Sbjct  60   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKK  103



>ref|XP_009132417.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   178 bits (452),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++ H+P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY+KILK
Sbjct  1    MVELDIHVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS F V  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFFVQTGIAKK  104



>gb|ACV50429.1| eukaryotic translation initiation factor SUI1 [Jatropha curcas]
Length=120

 Score =   179 bits (453),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +P AFDPF+EAK+SGAPGAKEYVHIRIQQRNG+KSLTTVQGL KE+SY+KI+K
Sbjct  1    MVDLEIQVPAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKKEFCCNGNVVQDKELGKVIQLQGDQ KNV  FLV+A LV+K
Sbjct  61   ALKKEFCCNGNVVQDKELGKVIQLQGDQLKNVQSFLVNAQLVRK  104



>ref|NP_568818.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_851192.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AAK60326.1|AF385736_1 AT5g54940/MBG8_21 [Arabidopsis thaliana]
 dbj|BAB08773.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM64690.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM91507.1| AT5g54940/MBG8_21 [Arabidopsis thaliana]
 gb|AED96560.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96561.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=112

 Score =   178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+A+DPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKK  104



>ref|XP_003617548.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AET00507.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK47392.1| unknown [Medicago truncatula]
Length=110

 Score =   178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI+  +P+ FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDIQ--IPSTFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  58

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV  K+LGK+IQLQGDQRKNVS FL+ AGLV+K
Sbjct  59   DLKKEFCCNGNVVNCKDLGKIIQLQGDQRKNVSHFLIHAGLVRK  102



>ref|XP_009338696.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009338697.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPF+EAK++ APGAK+YVHIR+QQRNGKK LTTVQGL+K++ YDKILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKDYVHIRVQQRNGKKCLTTVQGLKKDFIYDKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKK  104



>emb|CDY43020.1| BnaA03g11670D [Brassica napus]
Length=112

 Score =   177 bits (449),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY+KILK
Sbjct  1    MVELDIQVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS FLV  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKK  104



>gb|KJB11840.1| hypothetical protein B456_002G088900 [Gossypium raimondii]
Length=112

 Score =   177 bits (448),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD++  +PT FDPFAEA E G  G KEYVHIRIQQRNGKKSLTTVQGLR + SY+KILK
Sbjct  1    MVDLDVQIPTTFDPFAEAGEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLRHDLSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKK+FCCNGNVV+DKELGK+IQLQGDQRKNVSQFLV+AG+VKK
Sbjct  61   SLKKDFCCNGNVVKDKELGKIIQLQGDQRKNVSQFLVNAGIVKK  104



>ref|XP_006401506.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
 dbj|BAJ34327.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42959.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
Length=112

 Score =   176 bits (447),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEA+++ APG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY++ILK
Sbjct  1    MVELDIQIPSAFDPFAEAQDTDAPGTKEYVHIRIQQRNGKKSLTTVQGLKKDYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+  K
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIANK  104



>ref|XP_010482910.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=112

 Score =   176 bits (447),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+A+DPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQVPSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQ+KELGK+IQLQGDQRK VSQFLV AG+ +K
Sbjct  61   DLKKDFCCNGNVVQNKELGKIIQLQGDQRKKVSQFLVQAGIAEK  104



>ref|XP_008349901.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_008349902.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   176 bits (447),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PTAFDPF+EAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY KILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK FCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK
Sbjct  61   DLKKVFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKK  104



>ref|XP_010276095.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   176 bits (446),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPF EAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K +SY+KILK
Sbjct  1    MVELDIQIPSAFDPFFEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKTFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKEL-GKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNG VV D+EL GKVIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   DLKKEFCCNGTVVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKK  105



>ref|XP_004294387.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=112

 Score =   176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  + TAFDPFAEA+++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY+KILK
Sbjct  1    MVELDVVITTAFDPFAEARDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFL+ A +VKK
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLIQARIVKK  104



>gb|ABQ42058.1| putative translation factor [Sonneratia caseolaris]
Length=114

 Score =   176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +3

Query  99   YMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            +MVD++A +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  106



>ref|XP_007020819.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12344.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=112

 Score =   176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI + +PT FDPFAEA+E G  G KEYVHIRIQQRNGKKSLTTVQGL+++ SY+KILK
Sbjct  1    MVDIGSQIPTTFDPFAEAEEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLKQDLSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKK+FCCNGNVV DKELGK+IQLQGDQRKNVSQFLV+AG+VKK
Sbjct  61   CLKKDFCCNGNVVNDKELGKIIQLQGDQRKNVSQFLVNAGIVKK  104



>gb|ABQ42057.1| putative translation factor [Sonneratia alba]
 gb|ABQ42059.1| putative translation factor [Sonneratia ovata]
 gb|ABQ42060.1| putative translation factor [Sonneratia apetala]
Length=114

 Score =   175 bits (444),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +3

Query  99   YMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            +MVD++A +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  106



>ref|XP_006281351.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
 gb|EOA14249.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
Length=112

 Score =   175 bits (444),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+A+DPFAEA +S APG KE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAYDPFAEAIDSDAPGTKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV +GL KK
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQSGLAKK  104



>gb|EEC79466.1| hypothetical protein OsI_20483 [Oryza sativa Indica Group]
 gb|EEE64240.1| hypothetical protein OsJ_19073 [Oryza sativa Japonica Group]
Length=213

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  87   HQASYMVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKE  257
             Q S+M D++  LP+AFDPFAEA  ++SGA PGAK+YVH+RIQQRNG+KSLTTVQGL+KE
Sbjct  94   QQTSFMSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKE  153

Query  258  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            YSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK
Sbjct  154  YSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKK  205



>gb|KJB62620.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
 gb|KJB62622.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=113

 Score =   175 bits (443),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++ H+PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIHIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_002522857.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF39555.1| translation factor sui1, putative [Ricinus communis]
Length=138

 Score =   174 bits (442),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  81   FLHQASYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  257
            F  Q S+M ++E+ +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE
Sbjct  19   FTDQLSFMSELESQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKE  78

Query  258  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL  AG+VKK
Sbjct  79   FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLTGAGIVKK  130



>gb|KHN11920.1| Protein translation factor SUI1-like protein [Glycine soja]
Length=114

 Score =   174 bits (440),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAH-LPTA-FDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            MV++  + +PT+ FDPFAEAKE+ APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KI
Sbjct  1    MVEVGIYQIPTSTFDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FL+ A LV+K
Sbjct  61   LKDLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLIHARLVRK  106



>gb|AFW78548.1| LOW QUALITY PROTEIN: protein translation factor SUI1 [Zea mays]
Length=185

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 98/111 (88%), Gaps = 3/111 (3%)
 Frame = +3

Query  90   QASYMVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEY  260
            Q S+M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+
Sbjct  67   QPSFMSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEF  126

Query  261  SYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK
Sbjct  127  SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKK  177



>ref|XP_009417250.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   173 bits (439),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++ H+PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVHIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG++KK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIIKK  105



>ref|XP_010278682.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278683.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278684.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   173 bits (439),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P+AFDPFAEAK+SG PG KEYVHIRIQQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDVQIPSAFDPFAEAKDSGVPGVKEYVHIRIQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKEL-GKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +LKKEFCCNG +V D+EL GKVIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   NLKKEFCCNGTIVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKK  105



>ref|XP_008365050.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  114  EAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKK  293
            +  +PTAFDPFAEAK++ APGAKEYVH+R+QQRNGKK LTTVQGL+K+++YDKILKDLKK
Sbjct  6    DXQIPTAFDPFAEAKDADAPGAKEYVHVRVQQRNGKKCLTTVQGLKKDFNYDKILKDLKK  65

Query  294  EFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            EFCCNGNVVQDKELGK+IQLQGDQRK V QFLV A +VKK
Sbjct  66   EFCCNGNVVQDKELGKIIQLQGDQRKKVLQFLVQAKIVKK  105



>gb|AAM77753.1|AF521961_1 translation initiation factor B04 [Helianthus annuus]
Length=114

 Score =   173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKE--SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            MVDIE  +P+AFDPFA+ ++   G  G KEYVHIRIQQRNG+KSLTTVQGL+KE SYDKI
Sbjct  1    MVDIEVQIPSAFDPFADVEQDSGGGAGVKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQDKELGKVIQLQGDQRKNVS FL  AG+VKK
Sbjct  61   LKDLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSAFLSRAGIVKK  106



>ref|XP_006304318.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
 ref|XP_010462345.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 ref|XP_010480023.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 gb|EOA37216.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
Length=113

 Score =   173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|NP_175831.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 ref|XP_002894486.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006392693.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
 sp|Q94JV4.1|SUI12_ARATH RecName: Full=Protein translation factor SUI1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAD25609.1|AC005287_11 translation initiation factor [Arabidopsis thaliana]
 gb|AAK49626.1|AF372910_1 At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|AAN18215.1| At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|EFH70745.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE33076.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 gb|ESQ29979.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
Length=113

 Score =   172 bits (437),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_010232448.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Brachypodium distachyon]
Length=143

 Score =   174 bits (440),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 94/112 (84%), Gaps = 3/112 (3%)
 Frame = +3

Query  87   HQASYMVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  257
             Q S+M D++  LP+AFDPFAEA     S   G+K+YVH+R+QQRNG+KSLTTVQGL+KE
Sbjct  24   QQPSFMSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKE  83

Query  258  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            YSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK
Sbjct  84   YSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKK  135



>ref|XP_009378877.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus 
x bretschneideri]
Length=113

 Score =   172 bits (437),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M DI+  LPTAFDPFAEA  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_007216425.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
 gb|EMJ17624.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
Length=170

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 3/113 (3%)
 Frame = +3

Query  81   FLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK  254
            FL Q+S+M + +  +P+AFDPFA+A  ++SGA G KEYVH+R+QQRNG+KSLTTVQGL+K
Sbjct  51   FLQQSSFMSEFDTQVPSAFDPFADANAEDSGA-GTKEYVHVRVQQRNGRKSLTTVQGLKK  109

Query  255  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            EYSY+KILKDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  110  EYSYNKILKDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  162



>gb|EEE67305.1| hypothetical protein OsJ_24532 [Oryza sativa Japonica Group]
Length=230

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 3/113 (3%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRK  254
             HQ S+M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  110  FHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  169

Query  255  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            E+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  170  EFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  222



>gb|KHG12156.1| hypothetical protein F383_20129 [Gossypium arboreum]
Length=113

 Score =   172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_008365631.1| PREDICTED: protein translation factor SUI1 homolog 2 [Malus domestica]
 ref|XP_009358111.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
 ref|XP_009345194.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
Length=113

 Score =   172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M DI+  LPTAFDPFAEA  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_007142286.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
 gb|ESW14280.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
Length=114

 Score =   172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  129  TAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCN  308
             +FDPFAEA +  APGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILKDLKKEFCCN
Sbjct  12   NSFDPFAEATDRDAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCCN  71

Query  309  GNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            GNVV DKELGK+IQLQGDQRKNVS FL+ AGLV+K
Sbjct  72   GNVVHDKELGKIIQLQGDQRKNVSHFLIQAGLVRK  106



>gb|AFK35113.1| unknown [Lotus japonicus]
 gb|AFK48780.1| unknown [Lotus japonicus]
Length=114

 Score =   172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTAFDPFAEA  ++SGA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAAIPTAFDPFAEANAEDSGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  106



>emb|CDY46663.1| BnaA03g48450D [Brassica napus]
Length=196

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +3

Query  90   QASYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  266
            Q S+M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY
Sbjct  80   QQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSY  139

Query  267  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  140  SKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  188



>ref|XP_009120023.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   172 bits (435),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +P A+DPFAEA+++ APG KEY+H+RIQQRNGKKSLTTVQGL+KEYSY+KILK
Sbjct  1    MVELDIQVPLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKK+FCCNGNVVQDK LGK+IQLQGDQRK VS FLV  G+ KK
Sbjct  61   DLKKDFCCNGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKK  104



>ref|XP_010501111.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Camelina 
sativa]
Length=113

 Score =   171 bits (434),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDVGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|NP_001055949.1| Os05g0498400 [Oryza sativa Japonica Group]
 ref|XP_006654596.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 gb|AAT44286.1| putative protein translation factor Sui1 [Oryza sativa Japonica 
Group]
 dbj|BAF17863.1| Os05g0498400 [Oryza sativa Japonica Group]
 dbj|BAG91879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   171 bits (434),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA  ++SGA PGAK+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKK  107



>emb|CDX92777.1| BnaC07g40350D [Brassica napus]
Length=203

 Score =   174 bits (442),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 3/110 (3%)
 Frame = +3

Query  90   QASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYS  263
            Q S+M ++++ +PTAFDPFA+A  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KEYS
Sbjct  87   QQSFMSELDSQVPTAFDPFADANAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEYS  145

Query  264  YDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            Y KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  146  YSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  195



>gb|KDP39065.1| hypothetical protein JCGZ_00822 [Jatropha curcas]
Length=113

 Score =   171 bits (433),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++EA +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELEAQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_011096112.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011096113.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   171 bits (433),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +  +P+AFDPFAEAK E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDVQIPSAFDPFAEAKAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>emb|CDY17292.1| BnaA10g09260D [Brassica napus]
Length=232

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  99   YMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            YMV+++  +P A+DPFAEA+++ APG KEY+H+RIQQRNGKKSLTTVQGL+KEYSY+KIL
Sbjct  120  YMVELDIQVPLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKIL  179

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNGNVVQDK LGK+IQLQGDQRK VS FLV  G+ KK
Sbjct  180  KDLKKDFCCNGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKK  224



>ref|XP_006413104.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
 gb|ESQ54557.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
Length=256

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 3/110 (3%)
 Frame = +3

Query  90   QASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYS  263
            Q S+M ++++ +PTAFDPFA+A  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KEYS
Sbjct  140  QQSFMSELDSQVPTAFDPFADANAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEYS  198

Query  264  YDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            Y KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  199  YSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  248



>gb|KHG23747.1| hypothetical protein F383_10557 [Gossypium arboreum]
 gb|KJB45588.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45589.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45590.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB78391.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=113

 Score =   171 bits (433),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_009106912.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 ref|XP_009107080.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 emb|CDY08224.1| BnaA05g13950D [Brassica napus]
Length=115

 Score =   171 bits (433),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  107



>gb|KJB62619.1| hypothetical protein B456_009G426400 [Gossypium raimondii]
Length=213

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +3

Query  96   SYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            S+M D++  +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+K
Sbjct  99   SFMSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  158

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  159  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  205



>gb|AFD22856.1| eukaryotic translation initiation factor SUI1-like protein [Tamarix 
androssowii]
Length=113

 Score =   171 bits (433),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDP-FAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            MVD++  +PTAFDP FA+AK++ APG KEYVHIRIQQRNG+KSLTTVQGL+K++SY+KIL
Sbjct  1    MVDLQVQIPTAFDPGFADAKDTDAPGVKEYVHIRIQQRNGRKSLTTVQGLKKDFSYEKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLK+EFCCNGNVVQDKE GK+IQLQGDQRK V+Q LV AG+ KK
Sbjct  61   KDLKREFCCNGNVVQDKESGKIIQLQGDQRKKVAQSLVQAGITKK  105



>ref|XP_010539284.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
 ref|XP_010539285.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
Length=113

 Score =   171 bits (432),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  LPT FDPFA+A  E    G+KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLDTQLPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_006279715.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
 gb|EOA12613.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
Length=113

 Score =   171 bits (432),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E  + G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSSAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>gb|AFK48465.1| unknown [Lotus japonicus]
Length=116

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 4/108 (4%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGA--KEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  269
            M +++A +PTAFDPFAEA   ESGA GA  K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  270  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  108



>ref|XP_002867520.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009143120.1| PREDICTED: protein translation factor SUI1 homolog 1 [Brassica 
rapa]
 gb|EFH43779.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CDY29277.1| BnaC01g19290D [Brassica napus]
 emb|CDX89276.1| BnaA01g16170D [Brassica napus]
Length=113

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>gb|KHG30632.1| hypothetical protein F383_00215 [Gossypium arboreum]
Length=113

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_010448172.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=113

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_010062975.1| PREDICTED: protein translation factor SUI1 homolog 2 [Eucalyptus 
grandis]
Length=113

 Score =   170 bits (431),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++A +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|AFK48865.1| unknown [Lotus japonicus]
Length=116

 Score =   170 bits (431),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 4/108 (4%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGA--KEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  269
            M +++A +PTAFDPFAEA   ESGA GA  K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGIKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  270  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  108



>ref|XP_010930963.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D++  +PTAFDPFAEA   +SGA GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTAFDPFAEANADDSGA-GAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>gb|KHN46541.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=155

 Score =   171 bits (434),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 100/112 (89%), Gaps = 3/112 (3%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  257
            L ++S+M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE
Sbjct  37   LSESSFMSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKE  95

Query  258  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            +SY+KILKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  96   FSYNKILKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  147



>ref|NP_194443.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 ref|XP_010448590.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010443052.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010482884.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 sp|P41568.2|SUI11_ARATH RecName: Full=Protein translation factor SUI1 homolog 1 [Arabidopsis 
thaliana]
 gb|AAB68033.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB38843.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB79568.1| translation initiation factor [Arabidopsis thaliana]
 gb|AAK59834.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAL31168.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAM65827.1| translation initiation factor [Arabidopsis thaliana]
 gb|AEE85305.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 emb|CDY14282.1| BnaA08g14130D [Brassica napus]
 emb|CDX97378.1| BnaC08g12430D [Brassica napus]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_010542418.1| PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya 
hassleriana]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+++ +PT FDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLDSQIPTTFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>sp|Q9SQF4.1|SUI1_BRAOL RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Translation initiation factor nps45 [Brassica oleracea]
 gb|AAF04624.1|AF098672_1 translation initiation factor nps45 [Brassica oleracea]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|NP_200287.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001119436.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001190540.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|XP_002864353.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433396.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 ref|XP_010438654.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 dbj|BAB08755.1| protein translation factor Sui1 homolog [Arabidopsis thaliana]
 gb|AAO64771.1| At5g54760 [Arabidopsis thaliana]
 gb|EFH40612.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96536.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96537.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96538.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_008784556.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=113

 Score =   170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+ A LPT FDPFAEA  E    GAKEYVH+R QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLNAQLPTTFDPFAEANAEDSGAGAKEYVHVRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>gb|ADV04053.1| eukaryotic translation initiation factor 2 [Hevea brasiliensis]
Length=113

 Score =   169 bits (429),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++E  +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELETQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>emb|CDY26128.1| BnaC06g10680D [Brassica napus]
 emb|CDY08222.1| BnaA05g13970D [Brassica napus]
Length=115

 Score =   169 bits (429),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQG++KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGIKKEYSYTK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AGLVKK
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLIQAGLVKK  107



>ref|XP_007213988.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
 gb|EMJ15187.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
Length=113

 Score =   169 bits (429),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_009594373.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009594374.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
Length=113

 Score =   169 bits (428),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++A +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|KJB13596.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_010545205.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
 ref|XP_010545206.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +I+  +PT FDPFA+A  E    G+KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEIDTQIPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_002281872.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI23936.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G+K+YVHIRIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSELDIQIPTAFDPFAEANAEDSGAGSKDYVHIRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_010931827.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D+   LPT FDPFAEA   +SGA GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLNVQLPTTFDPFAEANADDSGA-GAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>ref|XP_011097918.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E+   GAK+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQVPTAFDPFADANAENSGAGAKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|KHG06771.1| hypothetical protein F383_09792 [Gossypium arboreum]
 gb|KJB11988.1| hypothetical protein B456_002G083600 [Gossypium raimondii]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAK+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_009774027.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009774028.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++A +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKK  105



>ref|XP_007132953.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
 gb|ESW04947.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
Length=113

 Score =   169 bits (428),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTAFDPFAEA   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|KHG06773.1| hypothetical protein F383_09794 [Gossypium arboreum]
Length=113

 Score =   169 bits (428),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAF+PFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_008803218.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   169 bits (428),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PT FDPFAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTTFDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>ref|XP_008244365.1| PREDICTED: protein translation factor SUI1 homolog 2 [Prunus 
mume]
Length=113

 Score =   169 bits (427),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLIQAGIVKK  105



>ref|XP_002458630.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
 gb|EES03750.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
Length=115

 Score =   169 bits (427),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVEAGIVKK  107



>ref|XP_007132567.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
 gb|ESW04561.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
Length=113

 Score =   169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + E ++P+AFDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFETNIPSAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_004244151.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
 ref|XP_004244152.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_003568176.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA  +++GA PGAK+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVTLPSAFDPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKK  107



>ref|XP_007132952.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
 gb|ESW04946.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
Length=113

 Score =   169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTAFDPFAEA   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKK  105



>ref|NP_001150984.1| GOS2 homolog [Zea mays]
 gb|ACG41169.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48501.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA57283.1| TPA: protein translation factor SUI1 isoform 1 [Zea mays]
 tpg|DAA57284.1| TPA: protein translation factor SUI1 isoform 2 [Zea mays]
Length=115

 Score =   169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  107



>ref|XP_011011189.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=112

 Score =   169 bits (427),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV +E  +P+AFDPFA+AK+SG  G KEYVHIRIQQRNGKKSLTTVQGL KE SY+ ILK
Sbjct  1    MVGLEFEIPSAFDPFADAKQSGGAGTKEYVHIRIQQRNGKKSLTTVQGLPKELSYETILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKK+FCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+  +VKK
Sbjct  61   TLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKK  104



>ref|NP_001239651.1| uncharacterized protein LOC100784390 [Glycine max]
 ref|XP_006591863.1| PREDICTED: uncharacterized protein LOC100784390 isoform X1 [Glycine 
max]
 gb|ACU18971.1| unknown [Glycine max]
 gb|KHN22844.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   169 bits (427),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PTAFDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|EYU27827.1| hypothetical protein MIMGU_mgv1a016640mg [Erythranthe guttata]
Length=113

 Score =   168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P+ FDPFAEAK E    G+KEYVHIRIQQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSDLDTQIPSPFDPFAEAKAEDSGVGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|NP_001152681.1| LOC100286322 [Zea mays]
 ref|XP_002440017.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 ref|XP_004961618.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
 ref|XP_008647991.1| PREDICTED: LOC100286322 isoform X1 [Zea mays]
 gb|ACF83099.1| unknown [Zea mays]
 gb|ACG26980.1| protein translation factor SUI1 [Zea mays]
 gb|ACG32428.1| protein translation factor SUI1 [Zea mays]
 gb|ACG47286.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48899.1| protein translation factor SUI1 [Zea mays]
 gb|ACN35402.1| unknown [Zea mays]
 gb|EES18447.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 gb|AFW78549.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKK  107



>ref|XP_003564393.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Brachypodium distachyon]
Length=115

 Score =   168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKK  107



>ref|XP_009388867.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D++  +PT FDPFA+A   +SGA GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTTFDPFADANADDSGA-GAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLK+EFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDLKREFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  105



>ref|NP_001059843.1| Os07g0529800 [Oryza sativa Japonica Group]
 sp|Q0D5W6.1|SUI1_ORYSJ RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Japonica Group]
 sp|A6MZM2.1|SUI1_ORYSI RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Indica Group]
 gb|AAK56324.1|AF380357_1 translational initiation factor eIF1 [Oryza coarctata]
 emb|CAA36190.1| GOS2 [Oryza sativa Indica Group]
 gb|AAC67556.1| translation initiation factor [Oryza sativa Japonica Group]
 dbj|BAC45143.1| translational initiation factor eIF1 [Oryza sativa Japonica Group]
 dbj|BAF21757.1| Os07g0529800 [Oryza sativa Japonica Group]
 gb|ABR25442.1| putative protein translation factor sui1 [Oryza sativa Indica 
Group]
 gb|ABR26117.1| protein translation factor sui1 [Oryza sativa Indica Group]
 gb|ACJ09228.1| translation initiation factor eIF1 [Oryza sativa Indica Group]
 dbj|BAH00131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71284.1| protein translation factor SUI 1 [Oryza sativa Japonica Group]
Length=115

 Score =   168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>ref|XP_006370639.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 ref|XP_006370640.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
 gb|ABK94414.1| unknown [Populus trichocarpa]
 gb|ERP67208.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ERP67209.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++   PTAFDPFA+A  E    GAKEYVHIR QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|ADV04054.1| eukaryotic translation initiation factor 3 [Hevea brasiliensis]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++E  +P+ FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELETQIPSTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_004957905.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
 ref|XP_004957906.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>ref|XP_009412007.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412008.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D++  LPTAFDPFAEA   +SGA GAKEYVH+R+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGA-GAKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL   G+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLSQTGIVKK  105



>ref|XP_007021029.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12554.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKVFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_002532561.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF29822.1| translation factor sui1, putative [Ricinus communis]
Length=109

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +PTAFDPF+EAK+SGA   K+YVHIRI QRNGKK+LTTVQGL KEYS +KILK
Sbjct  1    MVDLEVQIPTAFDPFSEAKDSGA---KDYVHIRIYQRNGKKNLTTVQGLPKEYSLEKILK  57

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKKEFCCNGNVVQDK+LGK+IQLQGDQRKNV  FLVSA LV+K
Sbjct  58   SLKKEFCCNGNVVQDKDLGKIIQLQGDQRKNVQSFLVSANLVRK  101



>ref|XP_002280157.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 ref|XP_003633291.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 emb|CBI28951.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++A++PT FDPFA+A  E    G KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDANIPTTFDPFADANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_009408662.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408663.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D+EA +P+AFDPFA+A   +SGA G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLEAQIPSAFDPFADANADDSGA-GTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKN S FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNASNFLVQAGIVKK  105



>ref|XP_009401666.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  LPTAFDPFAEA  +    GAKEYVH+R+QQRNG+K LTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGVGAKEYVHVRVQQRNGRKCLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_009109147.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+K+YSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVQGLKKDYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|XP_011048301.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=113

 Score =   167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++   PTAFDPFA+A  E    GAKEYVHIR QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_006284787.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17685.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=113

 Score =   167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A LVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQASLVKK  105



>ref|XP_003596650.1| Translation factor Sui1-like protein [Medicago truncatula]
 gb|AES66901.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK43860.1| unknown [Medicago truncatula]
Length=114

 Score =   167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTA+DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKK  106



>ref|XP_009137639.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTV+GL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVKGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKK  105



>ref|NP_001104887.1| protein translation factor SUI1 homolog [Zea mays]
 ref|XP_006657782.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 ref|XP_006659299.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 sp|P56330.1|SUI1_MAIZE RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2 [Zea mays]
 gb|AAB88615.1| translation initiation factor [Zea mays]
 gb|ACF80856.1| unknown [Zea mays]
 gb|ACG27240.1| protein translation factor SUI1 [Zea mays]
 gb|ACG28108.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30000.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30907.1| protein translation factor SUI1 [Zea mays]
 gb|ACG37835.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA62967.1| TPA: translation initiation factor1 [Zea mays]
Length=115

 Score =   167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>gb|KHN38274.1| Protein translation factor SUI1 like [Glycine soja]
Length=114

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAH-LPTA-FDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            MV++  + +PT+  DPFAEAKE+ APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KI
Sbjct  1    MVEVGIYQIPTSSLDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKE CCNGNVV DKELGK+IQLQGDQRKNVS FL+ A L +K
Sbjct  61   LKDLKKELCCNGNVVHDKELGKIIQLQGDQRKNVSHFLIHARLARK  106



>ref|XP_006363526.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Solanum 
tuberosum]
Length=113

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  E+   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPNAFDPFAEANAENSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGVVKK  105



>ref|XP_008809850.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D++  +PTA+DPFAEA   +SGA G+KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTAYDPFAEANAGDSGA-GSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>ref|XP_009397784.1| PREDICTED: protein translation factor SUI1 homolog 2 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+   +PTAFDPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLNVQIPTAFDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_010035571.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 ref|XP_010035572.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 gb|KCW46998.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=113

 Score =   167 bits (423),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PT FDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|NP_001044504.2| Os01g0794500 [Oryza sativa Japonica Group]
 dbj|BAD53005.1| putative translation initiation factor [Oryza sativa Japonica 
Group]
 gb|EEC71629.1| hypothetical protein OsI_04056 [Oryza sativa Indica Group]
 dbj|BAF06418.2| Os01g0794500 [Oryza sativa Japonica Group]
Length=115

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  107



>ref|XP_010909791.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   167 bits (423),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D+   LPTAFD FAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSDLNVQLPTAFDSFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>ref|XP_004294347.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   167 bits (423),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G KEYVHIR+QQRNG+KSLTTVQGL+K++SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|AFC01199.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=113

 Score =   167 bits (423),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PT FDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_006475205.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO52967.1| hypothetical protein CISIN_1g033711mg [Citrus sinensis]
Length=113

 Score =   167 bits (423),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +  +P AFDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|KJB81730.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
 gb|KJB81731.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
Length=112

 Score =   167 bits (423),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MV+++  +PT FDPFAEA+E G+ G K+YVHIRIQQRNG+KSLTTV+GL++E S DKILK
Sbjct  1    MVELDIQIPTTFDPFAEAEEFGSTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
             LKKEFCCNGNVV DKELGK+IQLQGDQRK V+ FLV+AG+VKK
Sbjct  61   SLKKEFCCNGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKK  104



>sp|Q9SM41.1|SUI1_SPOST RecName: Full=Protein translation factor SUI1 homolog [Sporobolus 
stapfianus]
 emb|CAB61837.1| putative translation initiation factor eIF-1 [Sporobolus stapfianus]
Length=115

 Score =   167 bits (423),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPF+EA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>ref|XP_004159225.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis sativus]
Length=177

 Score =   169 bits (428),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +3

Query  78   SFLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLR  251
            S+  Q S+M +    +P+AFDPFA+A  ++SGA GAKEYVH+RIQQRNG+KS TTVQGL+
Sbjct  57   SYSGQPSFMSEFNVQIPSAFDPFADANAEDSGA-GAKEYVHVRIQQRNGRKSPTTVQGLK  115

Query  252  KEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KE+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  116  KEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  169



>sp|O82569.1|SUI1_PIMBR RecName: Full=Protein translation factor SUI1 homolog [Spuriopimpinella 
brachycarpa]
 gb|AAC61599.1| protein translation factor SUI1 homolog [Spuriopimpinella brachycarpa]
Length=113

 Score =   167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGA-KEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            MVD +  +PT+FDPFAEA+ + A G+ KEYVHIRIQQRNG+KSLTTVQGL+KE SYDKIL
Sbjct  1    MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK  CCNG VV DKELGKVIQLQGDQRKNVS F+V AG+VKK
Sbjct  61   KDLKKALCCNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKK  105



>ref|XP_010240920.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PT FDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>emb|CAC84489.1| putative translation factor [Pinus pinaster]
 gb|ABK20970.1| unknown [Picea sitchensis]
 gb|ABK22220.1| unknown [Picea sitchensis]
 gb|ABK23355.1| unknown [Picea sitchensis]
 gb|ABK26752.1| unknown [Picea sitchensis]
 gb|ABR16497.1| unknown [Picea sitchensis]
 gb|ABR18467.1| unknown [Picea sitchensis]
 gb|ACN39759.1| unknown [Picea sitchensis]
 gb|ACN40001.1| unknown [Picea sitchensis]
 gb|ACN40379.1| unknown [Picea sitchensis]
 gb|ACN40927.1| unknown [Picea sitchensis]
Length=113

 Score =   167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P A+DPFA+A  E    G+KEYVH+RIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSDLDVQIPGAYDPFADANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  105



>ref|XP_004287929.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M ++E  +P+ FDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSELETQVPSTFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_007215170.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
 ref|XP_008230362.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Prunus 
mume]
 gb|EMJ16369.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
Length=113

 Score =   167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_004970238.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   167 bits (422),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FL  AG+ KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLTQAGIAKK  107



>gb|KHG11307.1| hypothetical protein F383_12372 [Gossypium arboreum]
Length=113

 Score =   166 bits (421),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDILIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGIVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|EEE55519.1| hypothetical protein OsJ_03741 [Oryza sativa Japonica Group]
Length=165

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK  254
            L  A++  D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  45   LKLANFRSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKK  104

Query  255  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            EYSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  105  EYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  157



>ref|XP_002310461.1| SUI1 family protein [Populus trichocarpa]
 gb|EEE90911.1| SUI1 family protein [Populus trichocarpa]
Length=113

 Score =   166 bits (421),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>emb|CDY10602.1| BnaC03g70120D [Brassica napus]
 emb|CDY02466.1| BnaA08g00730D [Brassica napus]
Length=116

 Score =   166 bits (421),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 4/108 (4%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV-SAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  AGLVKK
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQQAGLVKK  108



>ref|XP_004487600.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Cicer arietinum]
Length=113

 Score =   166 bits (421),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++A +PT FDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQAGIVKK  105



>gb|EPS65463.1| hypothetical protein M569_09315 [Genlisea aurea]
Length=113

 Score =   166 bits (420),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++   P +FDPFA+A  E+  PG+K+Y+HIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIETPISFDPFADANAENSGPGSKDYIHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_002310460.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_006380311.1| SUI1 family protein [Populus trichocarpa]
 ref|XP_006380312.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_011026342.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 ref|XP_011026343.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 gb|ABK95531.1| unknown [Populus trichocarpa]
 gb|EEE90910.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 gb|ERP58108.1| SUI1 family protein [Populus trichocarpa]
 gb|ERP58109.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
Length=113

 Score =   166 bits (420),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_003527483.1| PREDICTED: protein translation factor SUI1 homolog isoform 1 
[Glycine max]
 ref|XP_003527484.1| PREDICTED: protein translation factor SUI1 homolog isoform 2 
[Glycine max]
Length=113

 Score =   166 bits (420),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PTAFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKK  105



>gb|KHN41202.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PTAFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKK  105



>gb|EYU33614.1| hypothetical protein MIMGU_mgv1a016641mg [Erythranthe guttata]
Length=113

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PT FDPFA+A  E+   G K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTTFDPFADANAENSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_004144489.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
1 [Cucumis sativus]
 ref|XP_004144490.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
2 [Cucumis sativus]
 ref|XP_008455418.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455419.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455420.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 gb|KGN43535.1| hypothetical protein Csa_7G044260 [Cucumis sativus]
Length=113

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +    +P+AFDPFA+A  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|ABO15891.1| translation initiation factor eIF1 [synthetic construct]
 gb|ABX61094.1| putative translation initiation factor [Triticum aestivum]
 gb|ADD62702.1| eukaryotic translation initiation factor 1 [Leymus chinensis]
 emb|CDM84532.1| unnamed protein product [Triticum aestivum]
Length=115

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA  ++SGA  G+K YVH+R+QQRNG+KSLTTVQGL+K+YSY+K
Sbjct  1    MSDLDVQVPTAFDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKK  107



>ref|XP_010694233.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=113

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M DI+  +P A+DPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDIDVQIPAAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|KHG17081.1| Protein translation factor SUI1 [Gossypium arboreum]
Length=164

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  93   ASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
              YMV++   +PT FDPFAEA+E G  G K+YVHIRIQQRNG+KSLTTV+GL++E S DK
Sbjct  50   TKYMVELGIQIPTTFDPFAEAEEFGRTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDK  109

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILK LKKEFCCNGNVV DKELGK+IQLQGDQRK V+ FLV+AG+VKK
Sbjct  110  ILKSLKKEFCCNGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKK  156



>ref|XP_009800522.1| PREDICTED: protein translation factor SUI1 homolog 2 [Nicotiana 
sylvestris]
Length=113

 Score =   166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +I+  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL++E+SY+KI
Sbjct  1    MSEIDVQIPTNFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKREFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKK  105



>ref|XP_006352492.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=113

 Score =   166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_004248369.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_006447521.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 ref|XP_006469705.1| PREDICTED: protein translation factor SUI1 homolog [Citrus sinensis]
 gb|ESR60761.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 gb|KDO59835.1| hypothetical protein CISIN_1g039810mg [Citrus sinensis]
Length=113

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +P+AFDPFAEA  E    G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_004234488.1| PREDICTED: protein translation factor SUI1 homolog 1 [Solanum 
lycopersicum]
 ref|XP_006343300.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Solanum 
tuberosum]
Length=113

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDIQVPTTFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKK  105



>ref|XP_010923943.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M  ++  +PTA+DPFAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSGLDIQVPTAYDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>ref|XP_002316980.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 ref|XP_006377838.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ABK93182.1| unknown [Populus trichocarpa]
 gb|ABK93949.1| unknown [Populus trichocarpa]
 gb|EEE97592.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55635.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=113

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +A  P+A+DPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_010267759.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   165 bits (418),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PT FDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKK  105



>ref|XP_011030847.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
Length=113

 Score =   165 bits (418),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +A  PTA+DPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDAQTPTAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKK  105



>emb|CDP20340.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   165 bits (418),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M + +   PT FDPFA+A   +SGA GAKEYVH+R+QQRNG+KSLTTVQGLRKEYSY+KI
Sbjct  1    MSEHDIQTPTTFDPFADATADDSGA-GAKEYVHVRVQQRNGRKSLTTVQGLRKEYSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKK+FCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDLKKDFCCNGTVVQDPELGKVIQLQGDQRKNVSAFLVQAGIVKK  105



>ref|XP_004304159.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   165 bits (417),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKK  105



>ref|XP_008341979.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   165 bits (417),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +P+AFDPFA+A  E+   G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFADANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|ACS68685.1| putative translation factor [Sonneratia alba]
 gb|ACS68756.1| putative translation factor, partial [Sonneratia alba]
Length=102

 Score =   164 bits (416),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +3

Query  120  HLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKE  296
             +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY KILKDLKKE
Sbjct  2    QVPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  61

Query  297  FCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  62   FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  100



>ref|NP_001238017.1| uncharacterized protein LOC100306129 [Glycine max]
 gb|ACU14161.1| unknown [Glycine max]
 gb|KHN47859.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   165 bits (417),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|NP_001236633.1| uncharacterized protein LOC100499833 [Glycine max]
 gb|ACU13849.1| unknown [Glycine max]
Length=113

 Score =   165 bits (417),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>sp|O48650.1|SUI1_SALBA RecName: Full=Protein translation factor SUI1 homolog [Salix 
bakko]
 dbj|BAA24697.1| SUI1 homolog [Salix bakko]
Length=113

 Score =   165 bits (417),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+K+YSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|KHN02839.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=141

 Score =   166 bits (419),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVD+E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQ  365
            DLKKEFCCNG VVQDKELGK+IQLQGDQ
Sbjct  61   DLKKEFCCNGTVVQDKELGKIIQLQGDQ  88



>ref|XP_002960838.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
 ref|XP_002983834.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ14846.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ38377.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
Length=114

 Score =   164 bits (416),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M + +  +P A+DPFAEA  +ESG  G+ EYVH+R+QQRNG+KSLTTVQGLRKE++Y+KI
Sbjct  1    MSEADIQIPGAYDPFAEANAEESGGVGSAEYVHVRVQQRNGRKSLTTVQGLRKEFNYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD KKEFCCNG VVQD ELG+VIQLQGDQRKNVSQFLV AG+VKK
Sbjct  61   LKDFKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSQFLVQAGVVKK  106



>gb|EPS74118.1| hypothetical protein M569_00639 [Genlisea aurea]
Length=113

 Score =   164 bits (416),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +  +PT FDPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDVQIPTTFDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_004515084.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Cicer arietinum]
Length=113

 Score =   164 bits (416),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++P+ FDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_008230087.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008230088.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
Length=113

 Score =   164 bits (416),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +P+AFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>emb|CDO99708.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   164 bits (415),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PT FDPFA+A  ++ + G+KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFADANADNSSAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKK  105



>ref|XP_010105571.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC05100.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=222

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +3

Query  78   SFLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLR  251
            S ++Q  +M +I+  +PTAFDPFAEA  ++SGA G+KEYVHIRIQQRNG+KSLTTVQGL+
Sbjct  106  SLINQPRFMSEIDDQIPTAFDPFAEANAEDSGA-GSKEYVHIRIQQRNGRKSLTTVQGLK  164

Query  252  KEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLV  407
            KE+SY+KILKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FL+ A  +
Sbjct  165  KEFSYNKILKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQASFL  216



>ref|XP_008341842.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_009371031.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009373712.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   164 bits (415),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  E    G K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKK  105



>ref|XP_003527319.1| PREDICTED: protein translation factor SUI1 homolog 1 [Glycine 
max]
 gb|KHN46542.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   164 bits (414),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M  ++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSGLDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_009603077.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   164 bits (414),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M + +  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSEHDVQIPTTFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLIQAGIVKK  105



>ref|XP_009771770.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009771771.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   164 bits (414),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKK  105



>gb|EEC82174.1| hypothetical protein OsI_26284 [Oryza sativa Indica Group]
Length=843

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 3/113 (3%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRK  254
             HQ S+M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  723  FHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  782

Query  255  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            E+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  783  EFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  835



>ref|XP_009342251.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   163 bits (413),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +  +P+AFDPF +A  E+   G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFTDANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|KEH29652.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=113

 Score =   163 bits (413),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PT +DPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|ACG24808.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   163 bits (413),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEF CNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFYCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>ref|XP_009611793.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009792850.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009792852.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDLQVPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAEIVKK  105



>gb|EYU19220.1| hypothetical protein MIMGU_mgv1a016636mg [Erythranthe guttata]
Length=113

 Score =   163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +P+A+DPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQVPSAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|ABI48954.1| putative protein translation factor Sui1 [Viola baoshanensis]
Length=113

 Score =   163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P+AFDPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+K++SY+KIL
Sbjct  1    MSDLDIQIPSAFDPFADASTEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KD KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDXKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|ACN30624.1| unknown [Zea mays]
Length=110

 Score =   162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +3

Query  123  LPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKK  293
            +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY KILKDLKK
Sbjct  3    IPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKK  62

Query  294  EFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            EFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  63   EFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  102



>ref|XP_009624679.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Nicotiana tomentosiformis]
Length=113

 Score =   163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKK  105



>gb|KCW46999.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=114

 Score =   163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 2/106 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  +PT FDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV-SAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQQAGIVKK  106



>ref|XP_006644837.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
Length=115

 Score =   162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGTGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FL  AG+ KK
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLDKAGIAKK  107



>gb|ABY75806.1| SUI1 A protein [Opuntia streptacantha]
Length=113

 Score =   162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P A+DPFA+A  E+   GAK+YVHIR+QQRNG+KSLTTVQGL K++SY+KIL
Sbjct  1    MSDLDIQVPAAYDPFADANAENSGAGAKDYVHIRVQQRNGRKSLTTVQGLNKQFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVZDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>ref|XP_009398183.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++A +PTAFDPFA+A    +  G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFADANADDSDAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKK  105



>emb|CAD58628.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGDGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>gb|AFK43238.1| unknown [Medicago truncatula]
Length=113

 Score =   162 bits (410),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + + ++PT +DPFAEA  E    G KEYVH+R+QQRNG++SLTTVQGL+KE+SY KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRRSLTTVQGLKKEFSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>emb|CDP05794.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   162 bits (410),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_008810164.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=180

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  LPT+FDPFAEA  E    GAKEYVH+RIQQRNG+K LTTVQGL+KE+S +KIL
Sbjct  1    MSDLDVQLPTSFDPFAEANAEDSDAGAKEYVHVRIQQRNGRKCLTTVQGLKKEFSCNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  105



>emb|CAD58629.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   162 bits (410),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKK  105



>ref|XP_004961617.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=120

 Score =   161 bits (408),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLV  100



>gb|AGT16828.1| protein translation factor SUI1 [Saccharum hybrid cultivar R570]
Length=116

 Score =   161 bits (408),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = +3

Query  102  MVDIE-AHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  269
            M D++   LP+AFDPFAEA     S   G+K+YVH+R QQRNG+KSLTTVQGL+KEYSY+
Sbjct  1    MSDLDLQQLPSAFDPFAEANAEDSSAGAGSKDYVHVRSQQRNGRKSLTTVQGLKKEYSYN  60

Query  270  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKK  108



>gb|AFW78550.1| hypothetical protein ZEAMMB73_586492 [Zea mays]
Length=118

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLV  100



>ref|NP_001274850.1| uncharacterized protein LOC102577437 [Solanum tuberosum]
 gb|ABB02649.1| unknown [Solanum tuberosum]
Length=113

 Score =   160 bits (406),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  + TAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIRTAFDPFAEANADNFGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQ DQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQDDQRKNVSTFLVQAGIVKK  105



>ref|XP_010272070.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272071.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272072.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=112

 Score =   160 bits (405),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGL KE+SY KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLTKEFSYTKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDL KE CCNG VVQD ELG+V+QLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDL-KELCCNGTVVQDPELGQVVQLQGDQRKNVSTFLVQAGIVKK  104



>gb|KJB39023.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39024.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39026.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39027.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PTAFDPFA+A  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVK  410
            KDL KEFCCNG VVQD ELG+VIQLQGDQR NVS FLV AG+VK
Sbjct  61   KDL-KEFCCNGTVVQDPELGQVIQLQGDQRNNVSTFLVQAGIVK  103



>gb|KDP20792.1| hypothetical protein JCGZ_21263 [Jatropha curcas]
Length=113

 Score =   160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M + +  +PTAFDP AEA   +SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+ I
Sbjct  1    MSERDIQIPTAFDPLAEANAADSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNMI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKK  105



>ref|XP_002316065.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
 gb|ABK94563.1| unknown [Populus trichocarpa]
 gb|EEF02236.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
Length=108

 Score =   159 bits (403),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 3/101 (3%)
 Frame = +3

Query  111  IEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLK  290
            +E  +P+AFDPFA+AK+SG    KEYVHIRIQQRNGKKSLTTVQGL KE SY+KILK LK
Sbjct  3    LEFEIPSAFDPFADAKQSGT---KEYVHIRIQQRNGKKSLTTVQGLPKELSYEKILKTLK  59

Query  291  KEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            K+FCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+  +VKK
Sbjct  60   KDFCCNGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKK  100



>gb|KEH38847.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=110

 Score =   159 bits (403),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTA+DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            LKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLV  99



>ref|XP_004970237.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=118

 Score =   159 bits (403),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  LP+AFDPFAEA     S   G+KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FL 
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLT  100



>ref|XP_006370638.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ABK95287.1| unknown [Populus trichocarpa]
 gb|ERP67207.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
Length=125

 Score =   159 bits (403),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++   PTAFDPFA+A  E    GAKEYVHIR QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLV  98



>ref|XP_007021023.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
 gb|EOY12548.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
Length=163

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV  98



>ref|XP_006475204.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Citrus sinensis]
Length=115

 Score =   159 bits (402),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +  +P AFDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV  98



>gb|KEH38845.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=115

 Score =   159 bits (402),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PTA+DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            LKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLV  99



>ref|XP_002985789.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
 gb|EFJ12966.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
Length=113

 Score =   158 bits (400),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D +  +P AFDPFAEA  +    G+KEYVH+RIQQRNG+KSLTTVQGL+KE++Y++IL
Sbjct  1    MSDFDIQIPGAFDPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNRIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KD K+EFCCNG VV D ELG+VIQLQGDQRKNVSQFLV AG+ KK
Sbjct  61   KDFKREFCCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKK  105



>ref|XP_004144491.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
3 [Cucumis sativus]
Length=105

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +    +P+AFDPFA+A  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV  98



>ref|XP_006827315.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
 gb|ERM94552.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
Length=177

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 3/107 (3%)
 Frame = +3

Query  99   YMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            +M D++  +P  FDPFA+A  ++SGA G K+YVH+R+QQRNG+K LTTVQG++KE++Y+K
Sbjct  64   FMSDLDIQVPGVFDPFADALGEDSGA-GTKDYVHVRVQQRNGRKCLTTVQGVKKEFNYNK  122

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKD KKEFCCNG VVQDKELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  123  ILKDFKKEFCCNGTVVQDKELGQVIQLQGDQRKNVSNFLVQAGIVKK  169



>ref|XP_004487599.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Cicer arietinum]
Length=125

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++A +PT FDPFAEA  ++SGA G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGA-GTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAG  401
            LKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FL+   
Sbjct  60   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQVA  101



>ref|XP_006452372.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006452373.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006475068.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006475069.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Citrus sinensis]
 gb|ESR65612.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|ESR65613.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|KDO62726.1| hypothetical protein CISIN_1g033744mg [Citrus sinensis]
Length=112

 Score =   156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  281
            MVDI++ +PT++DPFA+ K+S APG K YVH+R+QQRNGKK LTTVQGL++++ Y KILK
Sbjct  1    MVDIDSQIPTSYDPFADIKDSLAPGDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILK  60

Query  282  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            DLKKEFCCNGNVV DK LGKVIQLQGD RKNV  FLV + +V K
Sbjct  61   DLKKEFCCNGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDK  104



>ref|XP_009624686.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Nicotiana tomentosiformis]
Length=102

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV  392
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV  98



>ref|XP_006591819.1| PREDICTED: uncharacterized protein LOC100306129 isoform X1 [Glycine 
max]
Length=114

 Score =   156 bits (395),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 90/103 (87%), Gaps = 3/103 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGL  404
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV   +
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVTI  102



>gb|ABK24036.1| unknown [Picea sitchensis]
Length=112

 Score =   156 bits (394),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPF--AEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  275
            M D +  +PT FDPF  +EA ++G PG K+YVH+RIQQRNG+K LTT+QGLRK+Y+Y+KI
Sbjct  1    MSDQDIQIPT-FDPFKDSEADDAG-PGTKDYVHVRIQQRNGRKCLTTIQGLRKDYNYNKI  58

Query  276  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKD KKEFCCNG VVQD ELG++IQLQGDQRKNVSQFL++AGLVKK
Sbjct  59   LKDFKKEFCCNGTVVQDLELGQIIQLQGDQRKNVSQFLINAGLVKK  104



>ref|XP_006352509.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=132

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  108  DIEAHLPTAFDPFAEAKESGAPGAK-EYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKD  284
            D +  +P +FDPFAE+K+ GA G K EYVHIR+QQRNGKKS T ++GL+K++SY+KILKD
Sbjct  22   DSDVQIPRSFDPFAESKDLGARGTKKEYVHIRVQQRNGKKSWTMIEGLKKDFSYEKILKD  81

Query  285  LKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            LKKE+CCNG ++QDKELGKVIQLQGDQR NVS+FLV A +VKK
Sbjct  82   LKKEYCCNGTIIQDKELGKVIQLQGDQRNNVSKFLVKADIVKK  124



>gb|EMS51805.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=163

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +3

Query  84   LHQASYMVDIEAHLPTAFDPFAEAKESGAPG---AKEYVHIRIQQRNGKKSLTTVQGLRK  254
            L    +M D++  +PTAFDPFAEA    A     +K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  43   LSPGDFMSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  102

Query  255  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            E+SY KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  103  EFSYSKILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKK  155



>ref|XP_010109526.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC23130.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=149

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  278
            M +++  LP+AFDPFA+A    +  G KEYVH+R+QQRNG+KSLTTVQGL+K+YSY KIL
Sbjct  1    MSELDQQLPSAFDPFADASADDSSAGGKEYVHVRVQQRNGRKSLTTVQGLKKQYSYSKIL  60

Query  279  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK  105



>gb|AAM34279.1|AF508969_1 translation initiation factor [Triticum aestivum]
Length=115

 Score =   155 bits (392),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  MVDIEAHLPTAFDPFAEAKESGAPG---AKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  272
            M D++  +PTAFDPFAEA    A     +K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  273  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  61   ILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKK  107



>gb|KEH38844.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=116

 Score =   155 bits (391),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +3

Query  123  LPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKE  296
            + T  DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKE
Sbjct  10   VATILDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  69

Query  297  FCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKK  413
            FCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK
Sbjct  70   FCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKK  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564491502050