BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026M10

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP16085.1|  unnamed protein product                                260   1e-82   Coffea canephora [robusta coffee]
ref|XP_010245571.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    248   5e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010245563.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    248   1e-77   Nelumbo nucifera [Indian lotus]
gb|KDP30124.1|  hypothetical protein JCGZ_18119                         246   4e-77   Jatropha curcas
ref|XP_010656946.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    245   7e-77   Vitis vinifera
ref|XP_009787019.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    245   8e-77   Nicotiana sylvestris
ref|XP_009608372.1|  PREDICTED: probable endoplasmic reticulum-Go...    242   1e-76   Nicotiana tomentosiformis
gb|KJB40581.1|  hypothetical protein B456_007G069900                    243   4e-76   Gossypium raimondii
ref|XP_006481288.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    243   5e-76   Citrus sinensis [apfelsine]
ref|XP_007048888.1|  Endoplasmic reticulum vesicle transporter pr...    243   6e-76   Theobroma cacao [chocolate]
ref|XP_011074286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    242   1e-75   Sesamum indicum [beniseed]
gb|EPS71314.1|  hypothetical protein M569_03444                         241   4e-75   Genlisea aurea
ref|XP_008463181.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    240   5e-75   Cucumis melo [Oriental melon]
gb|KGN51067.1|  hypothetical protein Csa_5G426440                       240   7e-75   Cucumis sativus [cucumbers]
ref|XP_008229748.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    239   1e-74   Prunus mume [ume]
ref|XP_007215619.1|  hypothetical protein PRUPE_ppa007922mg             239   3e-74   Prunus persica
ref|XP_006605681.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    238   3e-74   Glycine max [soybeans]
ref|XP_007048889.1|  Endoplasmic reticulum vesicle transporter pr...    238   4e-74   
gb|ACU19028.1|  unknown                                                 238   4e-74   Glycine max [soybeans]
ref|XP_009591169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    238   5e-74   Nicotiana tomentosiformis
ref|XP_009771009.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    238   5e-74   Nicotiana sylvestris
ref|XP_008380042.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    239   5e-74   
ref|XP_008342279.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    238   7e-74   
ref|XP_010112882.1|  hypothetical protein L484_017718                   237   1e-73   Morus notabilis
ref|XP_009407709.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    237   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    236   2e-73   Fragaria vesca subsp. vesca
ref|XP_009135799.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    236   4e-73   Brassica rapa
ref|XP_006858296.1|  hypothetical protein AMTR_s00064p00067290          236   4e-73   Amborella trichopoda
ref|XP_006351995.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    235   6e-73   Solanum tuberosum [potatoes]
emb|CDY24301.1|  BnaC03g42740D                                          235   7e-73   Brassica napus [oilseed rape]
ref|XP_006298011.1|  hypothetical protein CARUB_v10014056mg             234   2e-72   Capsella rubella
ref|XP_007145973.1|  hypothetical protein PHAVU_006G002400g             234   2e-72   Phaseolus vulgaris [French bean]
dbj|BAB17274.1|  unnamed protein product                                233   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004243621.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    233   4e-72   Solanum lycopersicum
ref|XP_002883352.1|  hypothetical protein ARALYDRAFT_479742             233   5e-72   
ref|NP_188868.2|  Endoplasmic reticulum vesicle transporter protein     233   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794432.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    233   6e-72   Phoenix dactylifera
ref|XP_010532527.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    233   7e-72   Tarenaya hassleriana [spider flower]
ref|XP_011008533.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    233   7e-72   Populus euphratica
gb|KEH35189.1|  endoplasmic reticulum vesicle transporter               232   1e-71   Medicago truncatula
ref|XP_011467640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    231   2e-71   Fragaria vesca subsp. vesca
ref|XP_003542168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    231   2e-71   Glycine max [soybeans]
emb|CDY37404.1|  BnaC05g30260D                                          231   2e-71   Brassica napus [oilseed rape]
ref|XP_010036056.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    231   2e-71   Eucalyptus grandis [rose gum]
ref|XP_011010108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    231   2e-71   Populus euphratica
ref|XP_011040642.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    231   4e-71   Populus euphratica
ref|XP_010313686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    230   6e-71   Solanum lycopersicum
ref|XP_010511216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    229   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010466507.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    229   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002307923.1|  hypothetical protein POPTR_0006s02470g             229   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010688789.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    229   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145393.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    228   4e-70   Brassica rapa
ref|XP_010314961.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    227   8e-70   Solanum lycopersicum
ref|XP_004502082.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    227   8e-70   Cicer arietinum [garbanzo]
gb|KJB75345.1|  hypothetical protein B456_012G039800                    226   1e-69   Gossypium raimondii
gb|KJB75346.1|  hypothetical protein B456_012G039800                    226   2e-69   Gossypium raimondii
gb|KJB75343.1|  hypothetical protein B456_012G039800                    226   2e-69   Gossypium raimondii
ref|XP_010525179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    226   3e-69   Tarenaya hassleriana [spider flower]
gb|KJB75347.1|  hypothetical protein B456_012G039800                    226   5e-69   Gossypium raimondii
gb|KJB75344.1|  hypothetical protein B456_012G039800                    226   5e-69   Gossypium raimondii
ref|XP_010923701.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    225   6e-69   Elaeis guineensis
gb|KJB75349.1|  hypothetical protein B456_012G039800                    226   7e-69   Gossypium raimondii
ref|XP_010923699.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    224   1e-68   Elaeis guineensis
ref|XP_010525178.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    224   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_009408557.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    223   3e-68   
ref|XP_002322569.2|  hypothetical protein POPTR_0016s02310g             223   4e-68   
ref|XP_009377930.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    215   5e-65   Pyrus x bretschneideri [bai li]
ref|NP_001051473.1|  Os03g0784400                                       211   1e-63   
gb|EEC76283.1|  hypothetical protein OsI_13786                          210   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_006650685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   9e-63   Oryza brachyantha
ref|XP_004959338.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    207   1e-62   
ref|XP_004982677.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    208   2e-62   Setaria italica
ref|XP_003558212.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    207   3e-62   Brachypodium distachyon [annual false brome]
ref|XP_008654279.1|  PREDICTED: DUF1692 domain, endoplasmic retic...    207   5e-62   Zea mays [maize]
ref|XP_001754824.1|  predicted protein                                  206   2e-61   
ref|XP_002458688.1|  hypothetical protein SORBIDRAFT_03g038260          205   4e-61   Sorghum bicolor [broomcorn]
dbj|BAJ84787.1|  predicted protein                                      201   9e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22267.1|  hypothetical protein F775_30192                         202   1e-59   
gb|EMS49840.1|  hypothetical protein TRIUR3_11686                       202   2e-58   Triticum urartu
ref|XP_002993277.1|  hypothetical protein SELMODRAFT_431378             189   3e-55   
ref|NP_001145501.1|  uncharacterized protein LOC100278902               174   3e-52   
ref|XP_006406186.1|  hypothetical protein EUTSA_v10021173mg             172   8e-49   
ref|XP_006406187.1|  hypothetical protein EUTSA_v10021173mg             171   1e-48   
ref|XP_004140296.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    169   6e-47   
gb|KDO64245.1|  hypothetical protein CISIN_1g022650mg                   142   3e-39   Citrus sinensis [apfelsine]
gb|KDO64244.1|  hypothetical protein CISIN_1g022650mg                   141   3e-38   Citrus sinensis [apfelsine]
gb|KDO64243.1|  hypothetical protein CISIN_1g022650mg                   142   8e-38   Citrus sinensis [apfelsine]
ref|NP_001131002.1|  DUF1692 domain, endoplasmic reticulum vescic...    132   5e-34   Zea mays [maize]
gb|KJB75348.1|  hypothetical protein B456_012G039800                    131   1e-33   Gossypium raimondii
ref|XP_002948747.1|  hypothetical protein VOLCADRAFT_80399              119   3e-28   Volvox carteri f. nagariensis
ref|XP_004169627.1|  PREDICTED: uncharacterized protein LOC101223739    103   4e-25   
gb|KIZ05378.1|  Endoplasmic reticulum-Golgi intermediate compartm...    109   6e-25   Monoraphidium neglectum
ref|XP_004340798.1|  golgi family protein, putative                     108   1e-24   Acanthamoeba castellanii str. Neff
gb|KFM75669.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   1e-23   Stegodyphus mimosarum
ref|XP_010901818.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   2e-23   Esox lucius
ref|XP_010901817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   2e-23   Esox lucius
ref|XP_006126747.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    104   2e-23   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006126746.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    104   3e-23   Pelodiscus sinensis [Chinese softshell turtle]
emb|CDQ64042.1|  unnamed protein product                                104   4e-23   Oncorhynchus mykiss
ref|NP_001158869.1|  Endoplasmic reticulum-Golgi intermediate com...    103   5e-23   Salmo salar
ref|XP_001693564.1|  predicted protein                                  103   6e-23   Chlamydomonas reinhardtii
ref|XP_006434016.1|  hypothetical protein CICLE_v10001505mg             102   1e-22   
ref|XP_005986794.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   1e-22   Latimeria chalumnae
ref|XP_006472628.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   1e-22   Citrus sinensis [apfelsine]
ref|XP_005986793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   1e-22   Latimeria chalumnae
ref|XP_009050136.1|  hypothetical protein LOTGIDRAFT_142052             102   2e-22   Lottia gigantea
ref|XP_005294108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   2e-22   Chrysemys picta bellii
ref|XP_003058372.1|  predicted protein                                  102   2e-22   Micromonas pusilla CCMP1545
ref|XP_005294106.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-22   Chrysemys picta bellii
ref|XP_005294107.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-22   Chrysemys picta bellii
dbj|GAM20914.1|  hypothetical protein SAMD00019534_040890               101   4e-22   Acytostelium subglobosum LB1
ref|XP_006266817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   4e-22   Alligator mississippiensis
ref|XP_007429094.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   4e-22   Python bivittatus
ref|NP_957309.1|  endoplasmic reticulum-Golgi intermediate compar...    100   5e-22   Danio rerio [leopard danio]
ref|NP_001028277.1|  endoplasmic reticulum-Golgi intermediate com...    100   6e-22   Danio rerio [leopard danio]
ref|XP_007258562.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   8e-22   Astyanax mexicanus [blind cave fish]
ref|XP_007258561.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   8e-22   Astyanax mexicanus [blind cave fish]
ref|XP_003220520.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   1e-21   Anolis carolinensis [Carolina anole]
gb|EKC31342.1|  Endoplasmic reticulum-Golgi intermediate compartm...    100   1e-21   Crassostrea gigas
ref|XP_011434519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   1e-21   Crassostrea gigas
ref|XP_003220521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   1e-21   Anolis carolinensis [Carolina anole]
ref|XP_007141162.1|  hypothetical protein PHAVU_008G172300g           99.8    1e-21   Phaseolus vulgaris [French bean]
gb|EFA85803.1|  endoplasmic reticulum-golgi intermediate compartm...  99.8    1e-21   Heterostelium album PN500
ref|XP_004085560.2|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    2e-21   
ref|XP_001764962.1|  predicted protein                                99.4    2e-21   
gb|KDP41359.1|  hypothetical protein JCGZ_15766                       99.0    2e-21   Jatropha curcas
ref|XP_010538949.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_003642492.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    2e-21   
ref|XP_003642491.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    2e-21   
emb|CDQ62105.1|  unnamed protein product                              98.2    3e-21   Oncorhynchus mykiss
ref|XP_007429095.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    3e-21   Python bivittatus
gb|KJE90687.1|  Ergic3 protein                                        99.0    4e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_004364824.1|  Ergic3 protein                                   98.6    4e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_005147588.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    4e-21   Melopsittacus undulatus
ref|XP_005147587.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    4e-21   Melopsittacus undulatus
gb|KJB59934.1|  hypothetical protein B456_009G281900                  98.2    5e-21   Gossypium raimondii
ref|XP_002513896.1|  Endoplasmic reticulum-Golgi intermediate com...  98.2    5e-21   Ricinus communis
emb|CDY41876.1|  BnaA08g06230D                                        98.2    6e-21   Brassica napus [oilseed rape]
ref|XP_009107911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    6e-21   Brassica rapa
gb|KJB59936.1|  hypothetical protein B456_009G281900                  98.2    6e-21   Gossypium raimondii
gb|KHG13361.1|  Endoplasmic reticulum-Golgi intermediate compartm...  98.2    6e-21   Gossypium arboreum [tree cotton]
ref|XP_002977139.1|  hypothetical protein SELMODRAFT_271242           98.2    6e-21   Selaginella moellendorffii
ref|XP_007513569.1|  predicted protein                                98.2    7e-21   Bathycoccus prasinos
ref|XP_001754958.1|  predicted protein                                97.8    7e-21   
ref|XP_003976750.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    7e-21   
ref|XP_003976749.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    7e-21   Takifugu rubripes [tiger puffer]
gb|KJB59933.1|  hypothetical protein B456_009G281900                  97.8    8e-21   Gossypium raimondii
ref|NP_001001226.1|  endoplasmic reticulum-Golgi intermediate com...  97.8    8e-21   Xenopus tropicalis [western clawed frog]
ref|XP_010752864.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    9e-21   
ref|XP_001759631.1|  predicted protein                                97.4    1e-20   
ref|XP_008282244.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    1e-20   Stegastes partitus
ref|XP_009595173.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    1e-20   Nicotiana tomentosiformis
ref|XP_009595172.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    1e-20   Nicotiana tomentosiformis
ref|XP_004237893.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    1e-20   Solanum lycopersicum
ref|XP_002127888.2|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    1e-20   
gb|KIZ06292.1|  Endoplasmic reticulum-Golgi intermediate compartm...  97.8    1e-20   Monoraphidium neglectum
ref|XP_009419691.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007544069.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   Poecilia formosa
ref|XP_008406425.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   Poecilia reticulata
ref|XP_009860519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   Ciona intestinalis [sea vase]
ref|XP_007544071.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   Poecilia formosa
ref|XP_008406424.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   Poecilia reticulata
ref|XP_006354000.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    2e-20   Solanum tuberosum [potatoes]
gb|ACF79024.1|  unknown                                               94.4    2e-20   Zea mays [maize]
gb|ELU18587.1|  hypothetical protein CAPTEDRAFT_139951                96.3    2e-20   Capitella teleta
emb|CAF95749.1|  unnamed protein product                              95.9    2e-20   Tetraodon nigroviridis
ref|XP_006639728.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    2e-20   
ref|XP_005534205.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    2e-20   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009097047.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    2e-20   Serinus canaria [canary]
ref|NP_001091124.1|  ERGIC and golgi 3                                96.3    2e-20   Xenopus laevis [clawed frog]
ref|XP_005534206.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    2e-20   
ref|XP_006639727.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    2e-20   
ref|XP_002306582.1|  hypothetical protein POPTR_0005s16700g           96.3    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_005496545.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    2e-20   Zonotrichia albicollis
ref|XP_006826951.1|  hypothetical protein AMTR_s00010p00188050        96.3    2e-20   Amborella trichopoda
ref|XP_009097046.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    2e-20   
ref|XP_005496546.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    2e-20   
ref|XP_002302286.1|  hypothetical protein POPTR_0002s09500g           96.3    2e-20   
ref|XP_005810880.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    3e-20   Xiphophorus maculatus
ref|XP_005810881.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    3e-20   Xiphophorus maculatus
ref|XP_002891208.1|  hypothetical protein ARALYDRAFT_891247           96.3    3e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_008319388.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    3e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001762360.1|  predicted protein                                96.3    3e-20   
ref|NP_001154394.1|  Endoplasmic reticulum vesicle transporter pr...  96.3    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496064.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006305051.1|  hypothetical protein CARUB_v10009417mg           96.3    3e-20   Capsella rubella
ref|NP_001052965.2|  Os04g0455900                                     95.1    3e-20   
gb|KCW66745.1|  hypothetical protein EUGRSUZ_F00498                   95.9    3e-20   Eucalyptus grandis [rose gum]
ref|XP_008319387.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    3e-20   
gb|KFK24003.1|  hypothetical protein AALP_AAs67745U000100             95.9    3e-20   Arabis alpina [alpine rockcress]
ref|XP_006654573.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    3e-20   Oryza brachyantha
ref|XP_011013540.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    3e-20   Populus euphratica
ref|XP_010060169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    4e-20   Eucalyptus grandis [rose gum]
gb|KCW66744.1|  hypothetical protein EUGRSUZ_F00498                   95.9    4e-20   Eucalyptus grandis [rose gum]
gb|AFW82354.1|  DUF1692 domain, endoplasmic reticulum vescicle tr...  94.0    4e-20   
ref|XP_002191084.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    4e-20   Taeniopygia guttata
ref|XP_010461344.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007907500.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    4e-20   Callorhinchus milii [Australian ghost shark]
ref|XP_010461342.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007907499.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    4e-20   Callorhinchus milii [Australian ghost shark]
ref|XP_005111657.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    4e-20   
ref|XP_006783096.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    4e-20   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004548890.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    4e-20   Maylandia zebra
ref|XP_003448415.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    4e-20   Oreochromis niloticus
ref|XP_003448416.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    5e-20   Oreochromis niloticus
ref|XP_004548891.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    5e-20   Maylandia zebra
ref|XP_001419260.1|  predicted protein                                95.1    5e-20   Ostreococcus lucimarinus CCE9901
ref|XP_006783095.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    5e-20   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007018816.1|  Endoplasmic reticulum vesicle transporter pr...  95.5    5e-20   
emb|CDP01032.1|  unnamed protein product                              92.4    5e-20   Coffea canephora [robusta coffee]
ref|XP_003568216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    5e-20   Brachypodium distachyon [annual false brome]
tpg|DAA37501.1|  TPA: DUF1692 domain, endoplasmic reticulum vesci...  94.4    6e-20   
ref|XP_010461343.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002114205.1|  hypothetical protein TRIADDRAFT_37998            95.1    6e-20   Trichoplax adhaerens
ref|XP_011299088.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    7e-20   Fopius arisanus
ref|NP_001087591.1|  endoplasmic reticulum-Golgi intermediate com...  95.1    8e-20   Xenopus laevis [clawed frog]
ref|XP_010535613.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.7    8e-20   Tarenaya hassleriana [spider flower]
emb|CAE02574.2|  OSJNBa0006M15.17                                     94.7    8e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439992.1|  hypothetical protein SORBIDRAFT_09g023960        94.7    9e-20   Sorghum bicolor [broomcorn]
ref|NP_564467.5|  Endoplasmic reticulum vesicle transporter protein   95.9    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403044.1|  hypothetical protein EUTSA_v10003455mg           94.7    9e-20   
ref|XP_002447951.1|  hypothetical protein SORBIDRAFT_06g018670        94.7    9e-20   Sorghum bicolor [broomcorn]
gb|ELU18591.1|  hypothetical protein CAPTEDRAFT_139954                94.0    9e-20   Capitella teleta
ref|XP_003283473.1|  hypothetical protein DICPUDRAFT_52316            94.7    1e-19   Dictyostelium purpureum
ref|XP_010500060.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.4    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009390586.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.7    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_629760.1|  endoplasmic reticulum-golgi intermediate compar...  94.7    1e-19   Dictyostelium discoideum AX4
gb|KEH28066.1|  endoplasmic reticulum vesicle transporter             94.0    1e-19   Medicago truncatula
gb|ACN35132.1|  unknown                                               94.4    1e-19   Zea mays [maize]
ref|XP_010500058.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.4    1e-19   Camelina sativa [gold-of-pleasure]
ref|NP_001148795.1|  LOC100282412                                     94.4    1e-19   Zea mays [maize]
ref|XP_001634898.1|  predicted protein                                94.4    1e-19   Nematostella vectensis
gb|EYU18489.1|  hypothetical protein MIMGU_mgv1a008051mg              94.4    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_002264644.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.4    1e-19   Vitis vinifera
ref|XP_010500059.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002157414.2|  PREDICTED: endoplasmic reticulum-Golgi inter...  93.6    2e-19   
ref|XP_004961675.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    2e-19   Setaria italica
ref|XP_003615024.1|  Endoplasmic reticulum-Golgi intermediate com...  94.0    2e-19   Medicago truncatula
ref|XP_009419975.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132255.1|  DUF1692 domain, endoplasmic reticulum vescic...  94.0    2e-19   Zea mays [maize]
gb|AAI02327.1|  ERGIC and golgi 3                                     92.4    2e-19   Bos taurus [bovine]
ref|XP_005651581.1|  DUF1692-domain-containing protein                93.2    2e-19   Coccomyxa subellipsoidea C-169
gb|AFW82353.1|  DUF1692 domain, endoplasmic reticulum vescicle tr...  93.6    2e-19   
ref|XP_005839166.1|  hypothetical protein GUITHDRAFT_65491            94.0    3e-19   Guillardia theta CCMP2712
ref|XP_008790816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  93.6    3e-19   Phoenix dactylifera
ref|XP_010261264.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  93.2    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010690474.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  93.2    3e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59091.1|  hypothetical protein B456_009G238700                  92.4    3e-19   Gossypium raimondii
ref|XP_010269217.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.8    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008804336.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    4e-19   Phoenix dactylifera
gb|KHG05263.1|  Endoplasmic reticulum-Golgi intermediate compartm...  92.8    4e-19   Gossypium arboreum [tree cotton]
tpg|DAA23197.1|  TPA: endoplasmic reticulum-Golgi intermediate co...  92.4    5e-19   Bos taurus [bovine]
ref|NP_001141198.1|  uncharacterized protein LOC100273285             92.8    5e-19   Zea mays [maize]
ref|XP_008802685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.8    5e-19   Phoenix dactylifera
ref|XP_003544786.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.8    5e-19   Glycine max [soybeans]
gb|KJB59090.1|  hypothetical protein B456_009G238700                  92.8    5e-19   Gossypium raimondii
emb|CDX88415.1|  BnaC06g38590D                                        92.8    5e-19   
ref|XP_006652356.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.8    5e-19   Oryza brachyantha
ref|XP_008804334.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    5e-19   Phoenix dactylifera
ref|XP_010269216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002285801.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    6e-19   
ref|XP_004163672.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  92.4    6e-19   
ref|XP_011098313.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    6e-19   Sesamum indicum [beniseed]
ref|XP_008444108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    7e-19   Cucumis melo [Oriental melon]
ref|XP_004142610.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    7e-19   Cucumis sativus [cucumbers]
ref|XP_006390025.1|  hypothetical protein EUTSA_v10018695mg           92.4    7e-19   Eutrema salsugineum [saltwater cress]
ref|XP_003542443.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.4    7e-19   Glycine max [soybeans]
ref|XP_002958233.1|  hypothetical protein VOLCADRAFT_69193            91.7    7e-19   Volvox carteri f. nagariensis
gb|AAX46728.1|  serologically defined breast cancer antigen 84 is...  91.3    8e-19   Bos taurus [bovine]
ref|XP_004230558.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    8e-19   Solanum lycopersicum
ref|XP_008445347.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   Cucumis melo [Oriental melon]
dbj|GAM26503.1|  hypothetical protein SAMD00019534_096780             92.0    9e-19   Acytostelium subglobosum LB1
ref|XP_004272824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   
ref|XP_004014574.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   Ovis aries [domestic sheep]
gb|ABF57320.1|  serologically defined breast cancer antigen 84        92.0    9e-19   Bos taurus [bovine]
ref|XP_007447834.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   Lipotes vexillifer [baiji]
ref|XP_007447835.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   Lipotes vexillifer [baiji]
ref|XP_004272825.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   Orcinus orca [Orca]
emb|CAO03348.2|  ERGIC and golgi 3                                    88.2    9e-19   Homo sapiens [man]
ref|XP_004014575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   
ref|XP_010939627.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   
ref|NP_001029525.2|  endoplasmic reticulum-Golgi intermediate com...  92.0    9e-19   
ref|XP_005900090.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  92.0    9e-19   
ref|XP_008810998.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.3    1e-18   
ref|XP_011398711.1|  Endoplasmic reticulum-Golgi intermediate com...  92.0    1e-18   
gb|KHN26081.1|  Endoplasmic reticulum-Golgi intermediate compartm...  91.7    1e-18   
ref|XP_005774403.1|  hypothetical protein EMIHUDRAFT_430522           92.0    1e-18   
ref|XP_004975824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.7    1e-18   
ref|XP_004504780.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.7    1e-18   
gb|ACJ84247.1|  unknown                                               91.7    1e-18   
gb|ELR53293.1|  Endoplasmic reticulum-Golgi intermediate compartm...  91.7    1e-18   
emb|CDX87479.1|  BnaA07g33940D                                        91.7    1e-18   
gb|KEH31231.1|  endoplasmic reticulum vesicle transporter             91.7    1e-18   
ref|XP_006351793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.7    1e-18   
ref|XP_003707803.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.7    1e-18   
ref|XP_006416221.1|  hypothetical protein EUTSA_v10007894mg           91.7    1e-18   
ref|XP_011087876.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.7    1e-18   
gb|ABF57305.1|  serologically defined breast cancer antigen 84        91.3    1e-18   
ref|XP_010908611.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.3    1e-18   
emb|CDY38236.1|  BnaC05g17530D                                        91.3    1e-18   
ref|XP_006369339.1|  hypothetical protein POPTR_0001s21370g           90.9    2e-18   
ref|XP_002299683.2|  hypothetical protein POPTR_0001s21370g           90.9    2e-18   
ref|XP_008559681.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.3    2e-18   
ref|XP_009386733.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.3    2e-18   
ref|XP_008810997.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  91.3    2e-18   
ref|XP_009822633.1|  hypothetical protein H257_01233                  90.9    2e-18   
ref|XP_011012659.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.9    2e-18   
ref|XP_792057.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  91.3    2e-18   
ref|XP_008808176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.9    2e-18   
ref|XP_004514266.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.9    2e-18   
ref|XP_004030780.1|  hypothetical protein IMG5_153610                 90.1    3e-18   
ref|XP_009338859.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    3e-18   
ref|XP_009338858.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    3e-18   
gb|KDO29037.1|  hypothetical protein SPRG_06092                       90.5    3e-18   
gb|KDP27371.1|  hypothetical protein JCGZ_20195                       90.1    3e-18   
gb|EFX74535.1|  hypothetical protein DAPPUDRAFT_226626                90.5    3e-18   
ref|XP_003487234.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.5    3e-18   
gb|KJB79684.1|  hypothetical protein B456_013G061900                  90.1    3e-18   
ref|XP_003579883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.5    3e-18   
gb|KFK42194.1|  hypothetical protein AALP_AA2G223600                  90.1    4e-18   
gb|KJB79682.1|  hypothetical protein B456_013G061900                  90.5    4e-18   
ref|XP_006385226.1|  hypothetical protein POPTR_0003s01780g           87.8    4e-18   
ref|XP_010477480.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.1    4e-18   
ref|XP_010498683.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.1    4e-18   
ref|XP_008613265.1|  hypothetical protein SDRG_09129                  90.1    4e-18   
ref|XP_002602383.1|  hypothetical protein BRAFLDRAFT_63528            90.5    4e-18   
ref|XP_393819.4|  PREDICTED: endoplasmic reticulum-Golgi intermed...  90.1    4e-18   
ref|XP_007159091.1|  hypothetical protein PHAVU_002G207900g           90.1    4e-18   
ref|NP_001031077.1|  Endoplasmic reticulum vesicle transporter pr...  89.4    5e-18   
ref|XP_011055609.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.7    5e-18   
ref|XP_009009462.1|  hypothetical protein HELRODRAFT_105492           89.7    5e-18   
ref|XP_009106456.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.1    5e-18   
ref|XP_002893216.1|  hypothetical protein ARALYDRAFT_472456           89.7    5e-18   
ref|XP_003524744.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.5    6e-18   
gb|KFK44311.1|  hypothetical protein AALP_AA1G241700                  89.7    6e-18   
gb|AAG48265.1|AF308298_1  serologically defined breast cancer ant...  88.2    7e-18   
ref|NP_564162.1|  Endoplasmic reticulum vesicle transporter protein   89.7    7e-18   
gb|EMS52396.1|  hypothetical protein TRIUR3_27593                     89.7    7e-18   
ref|XP_006746977.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    7e-18   
ref|XP_011055607.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    7e-18   
ref|XP_003692037.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    7e-18   
ref|XP_006614090.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    7e-18   
ref|XP_008053668.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_007932793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_006202670.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_006188640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
emb|CDY46631.1|  BnaA07g10650D                                        89.4    8e-18   
ref|XP_009145365.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_006188641.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_007932792.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_006202669.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
ref|XP_008053667.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.4    8e-18   
dbj|BAJ86415.1|  predicted protein                                    89.0    9e-18   
gb|KHG11605.1|  Endoplasmic reticulum-Golgi intermediate compartm...  89.4    9e-18   
ref|XP_008877521.1|  hypothetical protein, variant                    89.4    9e-18   
ref|XP_008877522.1|  hypothetical protein H310_12295                  89.4    1e-17   
dbj|BAJ87561.1|  predicted protein                                    89.0    1e-17   
gb|EDL06162.1|  ERGIC and golgi 3, isoform CRA_b                      88.2    1e-17   
ref|XP_010959105.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.0    1e-17   
ref|XP_010959104.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.0    1e-17   
ref|XP_008861655.1|  hypothetical protein, variant 2                  89.0    1e-17   
gb|EPS64954.1|  hypothetical protein M569_09826                       86.3    1e-17   
ref|XP_011162404.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.0    1e-17   
ref|XP_010676904.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.0    1e-17   
gb|EEC75148.1|  hypothetical protein OsI_11348                        88.6    1e-17   
ref|XP_009767797.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  89.0    1e-17   
ref|XP_006144123.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    1e-17   
gb|ELW69597.1|  Endoplasmic reticulum-Golgi intermediate compartm...  88.6    1e-17   
ref|XP_006144122.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    1e-17   
ref|XP_005650551.1|  DUF1692-domain-containing protein                88.6    1e-17   
ref|XP_004155757.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    1e-17   
ref|XP_003558026.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    2e-17   
emb|CDO97460.1|  unnamed protein product                              88.6    2e-17   
ref|XP_006650004.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    2e-17   
ref|XP_008373201.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    2e-17   
gb|ABF95668.1|  Serologically defined breast cancer antigen NY-BR...  88.6    2e-17   
ref|XP_004430531.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    2e-17   
ref|XP_008861654.1|  hypothetical protein, variant 1                  88.6    2e-17   
ref|XP_004430532.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.6    2e-17   
ref|XP_002916455.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_006921817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_003983624.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_008861653.1|  hypothetical protein H310_00594                  88.6    2e-17   
ref|XP_006723868.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    2e-17   
ref|XP_851879.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  88.2    2e-17   
ref|XP_006089522.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004393168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
gb|EFB21643.1|  hypothetical protein PANDA_004535                     88.2    2e-17   
ref|XP_864582.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  88.2    2e-17   
ref|XP_005604807.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_006089521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004746602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
gb|ACC68956.1|  serologically defined breast cancer antigen 84 is...  88.2    2e-17   
gb|ELK29631.1|  Endoplasmic reticulum-Golgi intermediate compartm...  88.2    2e-17   
ref|NP_001270982.1|  endoplasmic reticulum-Golgi intermediate com...  88.2    2e-17   
ref|XP_008568883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004393167.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_008568816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004668176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_001929457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004668177.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_005329944.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_001098982.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_011376631.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004612591.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|NP_001126130.1|  endoplasmic reticulum-Golgi intermediate com...  88.2    2e-17   
ref|NP_057050.1|  endoplasmic reticulum-Golgi intermediate compar...  88.2    2e-17   
ref|XP_004612590.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_005084715.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_002747286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_001098885.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_001929458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004370458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_004482494.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    2e-17   
ref|XP_004370457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_006881542.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_007522703.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_004687302.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_006881541.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
ref|XP_006875767.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    2e-17   
ref|XP_006875766.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  88.2    2e-17   
dbj|BAC11054.1|  unnamed protein product                              88.2    2e-17   
ref|NP_938408.1|  endoplasmic reticulum-Golgi intermediate compar...  88.2    2e-17   
ref|XP_003501188.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_006500064.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_005329943.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
gb|ACQ63006.1|  serologically defined breast cancer antigen 84 is...  87.8    3e-17   
ref|XP_002747285.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_005568912.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|NP_001164802.1|  endoplasmic reticulum-Golgi intermediate com...  87.8    3e-17   
ref|XP_004585820.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_003273622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004630919.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|NP_079792.1|  endoplasmic reticulum-Golgi intermediate compar...  87.8    3e-17   
ref|XP_007522702.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004687301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004585821.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_006988325.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004630918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004888660.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_003467839.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_005568911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_011238033.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|NP_001100003.1|  endoplasmic reticulum-Golgi intermediate com...  87.8    3e-17   
ref|XP_004888661.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
gb|EHB05461.1|  Endoplasmic reticulum-Golgi intermediate compartm...  87.8    3e-17   
emb|CAI42843.1|  ERGIC and golgi 3                                    87.8    3e-17   
gb|EYU23218.1|  hypothetical protein MIMGU_mgv1a007992mg              87.8    3e-17   
emb|CDS13876.1|  hypothetical protein LRAMOSA06050                    87.8    3e-17   
ref|XP_003411726.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_004698301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_010562891.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  87.0    3e-17   
ref|XP_005363119.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    3e-17   
gb|EHH19745.1|  Serologically defined breast cancer antigen NY-BR-84  87.8    3e-17   
ref|XP_004035301.1|  hypothetical protein IMG5_101180                 87.0    3e-17   
ref|XP_005002790.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.8    3e-17   
ref|XP_005363118.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|XP_010094175.1|  hypothetical protein L484_017219                 87.0    4e-17   
ref|XP_004090166.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|XP_005363117.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|XP_003788179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|NP_001242045.1|  uncharacterized protein LOC100781612             87.4    4e-17   
ref|XP_003788180.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|XP_008838971.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
ref|XP_008838972.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    4e-17   
gb|KIZ00977.1|  putative endoplasmic reticulum-Golgi intermediate...  86.3    4e-17   
ref|XP_009349444.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    5e-17   
gb|KDR82789.1|  hypothetical protein GALMADRAFT_238323                87.8    5e-17   
ref|XP_009337894.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    5e-17   
ref|XP_009103253.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.0    5e-17   
ref|XP_002735646.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.7    5e-17   
ref|XP_007042992.1|  Endoplasmic reticulum vesicle transporter pr...  87.0    5e-17   
ref|XP_001371602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.0    5e-17   
dbj|BAG62548.1|  unnamed protein product                              86.3    6e-17   
ref|XP_001371575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.0    6e-17   
ref|XP_009827211.1|  hypothetical protein, variant                    86.3    6e-17   
ref|XP_011151993.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.7    7e-17   
ref|XP_006235376.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  87.4    7e-17   
ref|XP_008037749.1|  endoplasmic reticulum-derived transport vesi...  87.4    7e-17   
gb|EMT09873.1|  hypothetical protein F775_29350                       87.4    7e-17   
ref|XP_010530623.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.7    8e-17   
gb|EPS71395.1|  hypothetical protein M569_03362                       86.7    8e-17   
gb|ETP38852.1|  hypothetical protein, variant                         85.5    9e-17   
ref|XP_010638254.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.3    9e-17   
ref|XP_010638253.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.3    1e-16   
ref|XP_005384848.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.3    1e-16   
emb|CDO69997.1|  hypothetical protein BN946_scf184973.g7              86.7    1e-16   
ref|XP_007073687.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.3    1e-16   
ref|XP_005384847.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  86.3    1e-16   
ref|XP_008802686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.5    1e-16   
ref|XP_009827210.1|  hypothetical protein H257_04402                  85.9    2e-16   
ref|XP_010105897.1|  hypothetical protein L484_021555                 85.9    2e-16   
ref|XP_004946985.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.9    2e-16   
ref|XP_011501635.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.5    2e-16   
ref|XP_004946984.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.9    2e-16   
ref|XP_008382039.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.5    2e-16   
ref|NP_001055898.1|  Os05g0490200                                     85.5    2e-16   
gb|ETP38851.1|  hypothetical protein F442_13655                       85.5    2e-16   
gb|AAX46646.1|  serologically defined breast cancer antigen 84 is...  84.7    2e-16   
ref|XP_010934993.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  85.1    3e-16   



>emb|CDP16085.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGALVSIVGLVIMATLF+HELRYYLTTN VHQMAV
Sbjct  1    MGVKQAIKNLDAFPRAEEHLLQKTQSGALVSIVGLVIMATLFIHELRYYLTTNIVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPCDVLSVDAID+SGKHEVDLDTNIWKLRL+RDGYI+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCDVLSVDAIDLSGKHEVDLDTNIWKLRLNRDGYIIGTEYL  120

Query  501  SDLVEKEHSDHKHG  542
            SDLVEKEH+ H+HG
Sbjct  121  SDLVEKEHTAHEHG  134



>ref|XP_010245571.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010245576.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
Length=349

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQA+K+IDAFPRAEEHLLQKT+SGA+VS++GLVIMATLFLHEL+YYLTT TVHQM+V
Sbjct  1    MGIKQALKSIDAFPRAEEHLLQKTQSGAVVSVIGLVIMATLFLHELKYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLR++++G I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRINQNGDIIGTEYI  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKEH+ HKH  D+E
Sbjct  121  SDLVEKEHTAHKHDGDKE  138



>ref|XP_010245563.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Nelumbo nucifera]
Length=384

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQA+K+IDAFPRAEEHLLQKT+SGA+VS++GLVIMATLFLHEL+YYLTT TVHQM+V
Sbjct  36   MGIKQALKSIDAFPRAEEHLLQKTQSGAVVSVIGLVIMATLFLHELKYYLTTYTVHQMSV  95

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLR++++G I+GTEY+
Sbjct  96   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRINQNGDIIGTEYI  155

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKEH+ HKH  D+E
Sbjct  156  SDLVEKEHTAHKHDGDKE  173



>gb|KDP30124.1| hypothetical protein JCGZ_18119 [Jatropha curcas]
Length=348

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 132/155 (85%), Gaps = 17/155 (11%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGALVSI+GLVIMATLFLHEL YYLTT TVHQM+V
Sbjct  1    MGVKQAIKRLDAFPRAEEHLLQKTQSGALVSIIGLVIMATLFLHELTYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYI  120

Query  501  SDLVEKEHSDHKH-----------------GFDQE  554
            SDLVEKEH+ HKH                 GFDQE
Sbjct  121  SDLVEKEHTAHKHDDDKNHHEESETKLDAQGFDQE  155



>ref|XP_010656946.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI31774.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 17/155 (11%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQ IK++ AFPRAEEHLLQKT+SGA+VSI+GLVIMATLFLHELRYYLTT TVHQM+V
Sbjct  1    MGVKQFIKSLHAFPRAEEHLLQKTQSGAVVSIIGLVIMATLFLHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+RDG+I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNRDGFIIGTEYL  120

Query  501  SDLVEKEHSD-----------------HKHGFDQE  554
            SDLVEKEH+D                 H H FDQ+
Sbjct  121  SDLVEKEHADHKHDHNKDHHGDSDQKLHAHSFDQD  155



>ref|XP_009787019.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=350

 Score =   245 bits (626),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M VKQA++AIDAFPRAE+HLLQKTKSGALVS+VGLVIMATLFLHEL YYL  +TVHQMAV
Sbjct  1    MRVKQALRAIDAFPRAEDHLLQKTKSGALVSVVGLVIMATLFLHELSYYLNIDTVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHIIGTEYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEH  HKH
Sbjct  121  SDLVEKEHEAHKH  133



>ref|XP_009608372.1| PREDICTED: probable endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Nicotiana tomentosiformis]
Length=264

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++AIDAFPRAE+HLLQKTKSGALVS+VGLVIMATLFLHEL YYL  +TVHQMAV
Sbjct  1    MGVKQALRAIDAFPRAEDHLLQKTKSGALVSVVGLVIMATLFLHELSYYLNIDTVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I+GTEYL
Sbjct  61   DLRRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHIIGTEYL  120

Query  501  SDLVEKEH  524
            SDLVEKEH
Sbjct  121  SDLVEKEH  128



>gb|KJB40581.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40582.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40583.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
Length=351

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGALVSIVGLVIM TLF HEL YYL+T TVHQM+V
Sbjct  1    MGVKQAIKNLDAFPRAEEHLLQKTQSGALVSIVGLVIMTTLFFHELTYYLSTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKEH+ HKH  + E
Sbjct  121  SDLVEKEHAAHKHDDENE  138



>ref|XP_006481288.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006481289.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Citrus sinensis]
Length=351

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQA+K++DAFPRAEEHLLQKT+SGALVSI+GLVIMA+LF+HELRYY+TT TVHQM+V
Sbjct  1    MGLKQALKSLDAFPRAEEHLLQKTQSGALVSIIGLVIMASLFMHELRYYITTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            +DLVEKEH +HKH  +++
Sbjct  121  TDLVEKEHEEHKHDHNKD  138



>ref|XP_007048888.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOX93045.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=351

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAEEHLLQKT+SGALVSIVGLVIMA LF HEL YYLTT TVHQM+V
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQSGALVSIVGLVIMAALFFHELTYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G IVGTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSLGQIVGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKEH+ HKH  ++E
Sbjct  121  SDLVEKEHAAHKHDDEKE  138



>ref|XP_011074286.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
 ref|XP_011074287.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
Length=351

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 2/139 (1%)
 Frame = +3

Query  141  MG-VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MG +KQA+K++DAFPRAEEHLLQKTKSGA+VSIVGL+IMATLFLHEL YYL+T TVHQMA
Sbjct  1    MGNLKQALKSLDAFPRAEEHLLQKTKSGAIVSIVGLIIMATLFLHELTYYLSTYTVHQMA  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL++DG IVGTEY
Sbjct  61   VDLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNKDGQIVGTEY  120

Query  498  LSDLVEKEHSDHKHGFDQE  554
            LSDLVEKEH+ H HG D++
Sbjct  121  LSDLVEKEHA-HGHGDDKD  138



>gb|EPS71314.1| hypothetical protein M569_03444, partial [Genlisea aurea]
Length=357

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  141  MG-VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MG +KQ +K+IDAFPR E+HLL+KTKSGALVSIVGLV++ATLF+HEL YYLTT TVHQM+
Sbjct  6    MGNLKQVLKSIDAFPRTEDHLLRKTKSGALVSIVGLVVIATLFVHELTYYLTTYTVHQMS  65

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL++DG+I+GTEY
Sbjct  66   VDLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNKDGHIIGTEY  125

Query  498  LSDLVEKEHSDHKHGFDQE  554
            LSDLVEKEH+DH H  D+E
Sbjct  126  LSDLVEKEHTDHGHDHDKE  144



>ref|XP_008463181.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
 ref|XP_008463182.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
Length=346

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%), Gaps = 14/151 (9%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK++DAFPRAEEHLLQKT++GA VS+VGLVIMATLFLHELRYYL+T TVHQM+V
Sbjct  1    MGLKQTIKSLDAFPRAEEHLLQKTQTGAFVSVVGLVIMATLFLHELRYYLSTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYL  120

Query  501  SDLVEKEH--------------SDHKHGFDQ  551
            SDLVEKEH                H HGFDQ
Sbjct  121  SDLVEKEHVDHKHDHDHDKEKDHPHIHGFDQ  151



>gb|KGN51067.1| hypothetical protein Csa_5G426440 [Cucumis sativus]
Length=346

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 14/151 (9%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK++DAFPRAEEHLLQKT++GA VS+VGLVIMATLFLHELRYYL+T TVHQM+V
Sbjct  1    MGLKQTIKSLDAFPRAEEHLLQKTQTGAFVSVVGLVIMATLFLHELRYYLSTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G I+GTEYL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGQIIGTEYL  120

Query  501  SDLVEKEH--------------SDHKHGFDQ  551
            SDLVEKEH                H HGFDQ
Sbjct  121  SDLVEKEHVDHKHDHDHDKEKDHPHIHGFDQ  151



>ref|XP_008229748.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Prunus mume]
Length=351

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAEEHLLQKT++GA+VS+VGL+IMATLF+HELRYYLTT TVHQM+V
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQTGAVVSVVGLLIMATLFVHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHINITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEHS HKH
Sbjct  121  SDLVEKEHS-HKH  132



>ref|XP_007215619.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
 gb|EMJ16818.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
Length=351

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAEEHLLQKT++GA+VS+VGL+IMATLF+HELRYYLTT TVHQM+V
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQTGAVVSVVGLLIMATLFVHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHINITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVE+EHS HKH
Sbjct  121  SDLVEREHS-HKH  132



>ref|XP_006605681.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Glycine max]
 ref|XP_006605682.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Glycine max]
 gb|KHN48838.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=347

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPRAE+HLLQKT+SGALVS++GL+IMATLF+HEL YYLTT TVHQM+V
Sbjct  1    MGMKQVIKNLDAFPRAEDHLLQKTQSGALVSVIGLIIMATLFVHELGYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYI  120

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEH+ HKH
Sbjct  121  SDLVEKEHTHHKH  133



>ref|XP_007048889.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
 gb|EOX93046.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
Length=352

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALV-SIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MGVKQA+K++DAFPRAEEHLLQKT+SGALV SIVGLVIMA LF HEL YYLTT TVHQM+
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQSGALVVSIVGLVIMAALFFHELTYYLTTYTVHQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G IVGTEY
Sbjct  61   VDLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSLGQIVGTEY  120

Query  498  LSDLVEKEHSDHKHGFDQE  554
            LSDLVEKEH+ HKH  ++E
Sbjct  121  LSDLVEKEHAAHKHDDEKE  139



>gb|ACU19028.1| unknown [Glycine max]
Length=347

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPRAE+HLLQKT+SGALVS++GL+IMATLF+HEL YYLTT TVHQM+V
Sbjct  1    MGMKQVIKNLDAFPRAEDHLLQKTQSGALVSVIGLIIMATLFVHELGYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYV  120

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEH+ HKH
Sbjct  121  SDLVEKEHTHHKH  133



>ref|XP_009591169.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
 ref|XP_009591170.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
Length=348

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 14/152 (9%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQ +KA+DAFPRAE+HLLQKTKSGA VSIVGLVIMATLFLHEL YYL+TNTVHQMAV
Sbjct  1    MGVKQVLKALDAFPRAEDHLLQKTKSGAFVSIVGLVIMATLFLHELSYYLSTNTVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I GTEYL
Sbjct  61   DLRRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHITGTEYL  120

Query  501  SDLV--------------EKEHSDHKHGFDQE  554
            SDLV              + E+  H  GFDQ+
Sbjct  121  SDLVEKEHKHDDHKDHHEDSENKTHLQGFDQD  152



>ref|XP_009771009.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
 ref|XP_009771010.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=348

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (85%), Gaps = 14/152 (9%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ +KA+DAFPRAE+HLLQKTKSGA VSIVGLVIMATLFLHEL YYL+TNTVHQMAV
Sbjct  1    MGLKQVLKALDAFPRAEDHLLQKTKSGAFVSIVGLVIMATLFLHELSYYLSTNTVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+RDG+I GTEYL
Sbjct  61   DLRRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNRDGHITGTEYL  120

Query  501  SDLV--------------EKEHSDHKHGFDQE  554
            SDLV              + ++  H  GFDQ+
Sbjct  121  SDLVEKEHKHDDHKDHHEDSDNKTHLQGFDQD  152



>ref|XP_008380042.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=371

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 128/133 (96%), Gaps = 1/133 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M V+QA+K++DAFPRAEEHLLQKT+SGALVS+VGL+IMATLF+HELRYYLTT TVHQM+V
Sbjct  20   MRVRQALKSLDAFPRAEEHLLQKTQSGALVSVVGLLIMATLFVHELRYYLTTYTVHQMSV  79

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  80   DLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYL  139

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEHS HKH
Sbjct  140  SDLVEKEHS-HKH  151



>ref|XP_008342279.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=352

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAEEHLLQKT+SGALVS+VGL+IMATLF+HELRYYLTT TVHQM+ 
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQSGALVSVVGLLIMATLFVHELRYYLTTYTVHQMSA  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYV  120

Query  501  SDLVEKEHS  527
            SDLVEKEHS
Sbjct  121  SDLVEKEHS  129



>ref|XP_010112882.1| hypothetical protein L484_017718 [Morus notabilis]
 gb|EXC35017.1| hypothetical protein L484_017718 [Morus notabilis]
Length=348

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGV+QA+K++DAFPRAEEHLLQKT+SGALVSIVGLVIMA LF+HELRYYLTT TVHQM+V
Sbjct  1    MGVRQALKSLDAFPRAEEHLLQKTRSGALVSIVGLVIMAMLFMHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G I+GTEYL
Sbjct  61   DLKRGETLPIHINVTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGQIIGTEYL  120

Query  501  SDLVEKEHS  527
            SDLVEKEH+
Sbjct  121  SDLVEKEHA  129



>ref|XP_009407709.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  MGVK-QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MG+K Q+++  DAFPRAEEHLLQKT+SGA+VSI+GL+IMATLF+HEL+YYLTT TVHQM+
Sbjct  1    MGLKLQSLRNFDAFPRAEEHLLQKTRSGAVVSIIGLIIMATLFVHELKYYLTTYTVHQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VD+KRGETLPIHINM+FPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL+R+G+I GTEY
Sbjct  61   VDVKRGETLPIHINMTFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLTREGHITGTEY  120

Query  498  LSDLVEKEHSDHKHG  542
            LSDLVEKEHS HKHG
Sbjct  121  LSDLVEKEHSAHKHG  135



>ref|XP_004303918.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Fragaria vesca subsp. vesca]
Length=347

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAE+HLLQKT+SGA VS+VGLVIMATLFLHEL YYL++ TVHQM+V
Sbjct  1    MGVKQALKSLDAFPRAEDHLLQKTQSGAFVSVVGLVIMATLFLHELTYYLSSYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+IVGTEYL
Sbjct  61   DLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIVGTEYL  120

Query  501  SDLVEKEHSDHKHG  542
            SDLVEKEH  H  G
Sbjct  121  SDLVEKEHHKHDDG  134



>ref|XP_009135799.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 ref|XP_009135800.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 emb|CDX92937.1| BnaA03g36590D [Brassica napus]
Length=353

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 129/140 (92%), Gaps = 2/140 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEKE--HSDHKHGFDQE  554
            SDLVEKE  HS HKH   +E
Sbjct  121  SDLVEKEHDHSSHKHDGKEE  140



>ref|XP_006858296.1| hypothetical protein AMTR_s00064p00067290 [Amborella trichopoda]
 gb|ERN19763.1| hypothetical protein AMTR_s00064p00067290 [Amborella trichopoda]
Length=354

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG  Q +K++DAFPRAEEHLLQKT+SGA+VSI+GLVIMATLF+HEL+YYL T TVHQM+V
Sbjct  1    MGRLQVLKSLDAFPRAEEHLLQKTQSGAVVSIMGLVIMATLFVHELKYYLATYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FP+LPC+VLSVDAIDMSGKHEVDLDTNIWKLRL+ DGYI+G E++
Sbjct  61   DLKRGETLPIHINMTFPALPCEVLSVDAIDMSGKHEVDLDTNIWKLRLNNDGYIIGHEFI  120

Query  501  SDLVEKEHSDHKHG  542
            SDLVEKEH  HKHG
Sbjct  121  SDLVEKEHESHKHG  134



>ref|XP_006351995.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006351996.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Solanum tuberosum]
Length=350

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++AIDAFPRAEEHLLQKTK GA VSIVGL+IM TLFLHEL YYL   TVHQM+V
Sbjct  1    MGVKQALRAIDAFPRAEEHLLQKTKFGAFVSIVGLLIMVTLFLHELSYYLNIYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D +RGE LPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I GTEYL
Sbjct  61   DSRRGENLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHITGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKEH  HKH   +E
Sbjct  121  SDLVEKEHEVHKHDAHKE  138



>emb|CDY24301.1| BnaC03g42740D [Brassica napus]
Length=353

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEKE--HSDHKH  539
            SDLVEKE  HS HKH
Sbjct  121  SDLVEKEHDHSSHKH  135



>ref|XP_006298011.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 ref|XP_006298012.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30909.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30910.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
Length=356

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEK----EHSDHKHGFDQE  554
            SDLVEK     HS HKH   +E
Sbjct  121  SDLVEKGHEHGHSSHKHDGKEE  142



>ref|XP_007145973.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
 gb|ESW17967.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
Length=348

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPRAE+HLLQKT+SGALVS++GL+IMATLF+HELRYYLTT TVHQM+V
Sbjct  1    MGMKQVIKNLDAFPRAEDHLLQKTQSGALVSVIGLIIMATLFVHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHIIGTEYI  120

Query  501  SDLVEK  518
            SDLVEK
Sbjct  121  SDLVEK  126



>dbj|BAB17274.1| unnamed protein product [Arabidopsis thaliana]
Length=333

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEK----EHSDHKHGFDQE  554
            SDLVEK     HS HKH   +E
Sbjct  121  SDLVEKGHEHGHSPHKHDGKEE  142



>ref|XP_004243621.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=348

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 126/152 (83%), Gaps = 14/152 (9%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQ ++A+DAFPRAEEHLLQKTKSGA VSIVGLVIM+TLFLHEL YYL T TVHQMAV
Sbjct  1    MGVKQVLRAMDAFPRAEEHLLQKTKSGAFVSIVGLVIMSTLFLHELSYYLNTITVHQMAV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I GTEYL
Sbjct  61   DLRRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHITGTEYL  120

Query  501  SDLV--------------EKEHSDHKHGFDQE  554
            SDLV              + ++  H  GFDQE
Sbjct  121  SDLVEKEHKHDDHKDHHDDSDNKTHMQGFDQE  152



>ref|XP_002883352.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59611.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEK----EHSDHKHGFDQE  554
            SDLVEK     HS HKH   +E
Sbjct  121  SDLVEKGHEHGHSPHKHDGKEE  142



>ref|NP_188868.2| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
 gb|AAK43988.1|AF370173_1 unknown protein [Arabidopsis thaliana]
 dbj|BAD43192.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43746.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43970.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44059.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94071.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76618.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
Length=354

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEK----EHSDHKHGFDQE  554
            SDLVEK     HS HKH   +E
Sbjct  121  SDLVEKGHEHGHSPHKHDGKEE  142



>ref|XP_008794432.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794434.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
Length=352

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 127/134 (95%), Gaps = 1/134 (1%)
 Frame = +3

Query  141  MGVK-QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MGV+ Q+++ IDAFPRAEEHLL+KT SGA+VSI+GL IMATLF+HEL+YYLTT TVHQM+
Sbjct  1    MGVRLQSLRNIDAFPRAEEHLLKKTHSGAIVSIIGLTIMATLFVHELKYYLTTYTVHQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FP+LPC+VLSVDAIDMSGKHEVDLDTNIW LR+S++G+I+GTEY
Sbjct  61   VDLKRGETLPIHINMTFPALPCEVLSVDAIDMSGKHEVDLDTNIWMLRMSKEGHIIGTEY  120

Query  498  LSDLVEKEHSDHKH  539
            LSDLVEKEHS HKH
Sbjct  121  LSDLVEKEHSAHKH  134



>ref|XP_010532527.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Tarenaya hassleriana]
Length=353

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 2/140 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++++DAFPRAE+HLLQKT+SGA+VSI+GLVIMATLFLHEL YYL T TVH+++V
Sbjct  1    MGVKQALRSLDAFPRAEDHLLQKTQSGAIVSIIGLVIMATLFLHELSYYLNTITVHKLSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D+KRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DVKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNAHGHIIGTEYI  120

Query  501  SDLVEKE--HSDHKHGFDQE  554
            SDLVEKE  HS HKH   +E
Sbjct  121  SDLVEKEHDHSSHKHDGKEE  140



>ref|XP_011008533.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGALVS++GLVIMATLF HEL YYLTT TVHQM+V
Sbjct  1    MGVKQAIKRLDAFPRAEEHLLQKTQSGALVSVIGLVIMATLFYHELAYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGE LPIH+N++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I GTEYL
Sbjct  61   DLQRGEILPIHVNITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHITGTEYL  120

Query  501  SDLVEKEHSDHK  536
            SDLVEKEH  H 
Sbjct  121  SDLVEKEHEAHN  132



>gb|KEH35189.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=355

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPR E+HLLQKT+SGALVSI+GL+IMATLFLHEL YYLTT TVHQM+V
Sbjct  1    MGMKQVIKNLDAFPRTEDHLLQKTQSGALVSIIGLIIMATLFLHELGYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGQIIGTEYI  120

Query  501  SDLVEKEHS-DHKHG  542
            SDLVEK H  DH HG
Sbjct  121  SDLVEKGHEHDHDHG  135



>ref|XP_011467640.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Fragaria vesca subsp. vesca]
Length=348

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQ-MA  317
            MGVKQA+K++DAFPRAE+HLLQKT+SGA VS+VGLVIMATLFLHEL YYL++ TVHQ M+
Sbjct  1    MGVKQALKSLDAFPRAEDHLLQKTQSGAFVSVVGLVIMATLFLHELTYYLSSYTVHQQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+IVGTEY
Sbjct  61   VDLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIVGTEY  120

Query  498  LSDLVEKEHSDHKHG  542
            LSDLVEKEH  H  G
Sbjct  121  LSDLVEKEHHKHDDG  135



>ref|XP_003542168.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Glycine max]
 gb|KHN19824.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=351

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPRAE+HLLQKT+SGALVS++GL+IMATLF+HEL YYLTT TVH+M+V
Sbjct  1    MGMKQVIKNLDAFPRAEDHLLQKTQSGALVSVIGLIIMATLFVHELGYYLTTYTVHKMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYI  120

Query  501  SDLVEKEHSDHK  536
            SDLVEKEH++ +
Sbjct  121  SDLVEKEHTNQE  132



>emb|CDY37404.1| BnaC05g30260D [Brassica napus]
Length=350

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL IMATLFL EL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLFIMATLFLSELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEKE--HSDHKH  539
            SDLVEKE  HS HKH
Sbjct  121  SDLVEKEHDHSSHKH  135



>ref|XP_010036056.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Eucalyptus grandis]
 gb|KCW47581.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
 gb|KCW47582.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
Length=355

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 130/158 (82%), Gaps = 21/158 (13%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGV+QA+K++DAFPRAEEHLLQKT+SGALVS++GL IMATLFLHELRYY+TT TVHQM+V
Sbjct  1    MGVRQALKSLDAFPRAEEHLLQKTQSGALVSVIGLTIMATLFLHELRYYITTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+ P+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL++ G I+GTEYL
Sbjct  61   DLKRGETLPIHINMTLPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNKYGQIIGTEYL  120

Query  501  SDLVE-------------------KEHSD--HKHGFDQ  551
            SDLVE                   KE S+  H HGFD+
Sbjct  121  SDLVEKGHEHHGHDHKHDDGKDHNKESSEKTHSHGFDE  158



>ref|XP_011010108.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGALVS++GLVIMATLF HEL Y+LTT TVHQM+V
Sbjct  1    MGVKQAIKRLDAFPRAEEHLLQKTQSGALVSVIGLVIMATLFYHELAYFLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL+RGE LPIH+N++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I GTEYL
Sbjct  61   DLQRGEILPIHVNITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHITGTEYL  120

Query  501  SDLVEKEHSDHK  536
            SDLVEKEH  H 
Sbjct  121  SDLVEKEHEAHN  132



>ref|XP_011040642.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
 ref|XP_011004481.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 124/153 (81%), Gaps = 17/153 (11%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQAIK +DAFPRAEEHLLQKT+SGALVSI+GLV MATLF HEL YYLTT TVHQM+V
Sbjct  1    MGMKQAIKKLDAFPRAEEHLLQKTQSGALVSIIGLVTMATLFYHELAYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL RGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I GTEYL
Sbjct  61   DLTRGETLPIHINITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHITGTEYL  120

Query  501  SDLVEKEH-----------------SDHKHGFD  548
            SDLVEKEH                   H HGFD
Sbjct  121  SDLVEKEHEAHNHDHNKDHHEDSHAKQHMHGFD  153



>ref|XP_010313686.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=350

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++AIDAFPRAEEHLL KTK GA VSIVGL+IM TLFLHEL YYL   TVHQM+V
Sbjct  1    MGVKQALRAIDAFPRAEEHLLLKTKFGAFVSIVGLLIMVTLFLHELSYYLNIYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D +RGE LPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I GTEYL
Sbjct  61   DSRRGENLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHITGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKE   HKH   +E
Sbjct  121  SDLVEKEREAHKHDVHKE  138



>ref|XP_010511216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010511224.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488250.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488252.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYL  120

Query  501  SDLVEK  518
            SDLVEK
Sbjct  121  SDLVEK  126



>ref|XP_010466507.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010466508.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IMATLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMATLFLHELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEYL
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYL  120

Query  501  SDLVEK  518
            SDLVEK
Sbjct  121  SDLVEK  126



>ref|XP_002307923.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
 gb|EEE91446.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
Length=351

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 124/153 (81%), Gaps = 17/153 (11%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQAIK +DAFPRAEEHLLQKT+SGALVSI+GLV MATLF HEL YYLTT TVHQM+V
Sbjct  1    MGMKQAIKKLDAFPRAEEHLLQKTQSGALVSIIGLVTMATLFYHELAYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DL RGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDT+IWKLRL+  G+I GTEYL
Sbjct  61   DLTRGETLPIHINITFPSLPCDVLSVDAIDMSGKHEVDLDTSIWKLRLNSYGHITGTEYL  120

Query  501  SDLVEKEH-----------------SDHKHGFD  548
            SDLVEKEH                   H HGFD
Sbjct  121  SDLVEKEHEAHNHDHNKDHHEDSHAKQHTHGFD  153



>ref|XP_010688789.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688790.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688791.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
Length=381

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK +DAFPRAEEHLLQKT+SGA+VSI+GLVIMATLF+HELRYYL+T TV+QM+V
Sbjct  1    MGVKQAIKKLDAFPRAEEHLLQKTQSGAIVSIIGLVIMATLFIHELRYYLSTYTVNQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGE LPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDT IWKLRLS DG+I+GTE+L
Sbjct  61   DLKRGEILPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTTIWKLRLSNDGHIIGTEFL  120

Query  501  SDLVEK  518
            +DLVEK
Sbjct  121  TDLVEK  126



>ref|XP_009145393.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brassica rapa]
 emb|CDY10632.1| BnaA05g17300D [Brassica napus]
Length=350

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+++IDAFPRAE+HLLQKT+SGA+VSIVGL+IM  LFL EL YYL T TVHQM+V
Sbjct  1    MGVKQALRSIDAFPRAEDHLLQKTQSGAVVSIVGLLIMVILFLSELSYYLNTLTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYI  120

Query  501  SDLVEKE--HSDHKH  539
            SDLVEKE  HS HKH
Sbjct  121  SDLVEKEHDHSSHKH  135



>ref|XP_010314961.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=350

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++AIDAFPRAEEHLL KTK GA VSIVGL+IM TLFL EL YYL   TVHQM+V
Sbjct  1    MGVKQALRAIDAFPRAEEHLLLKTKFGAFVSIVGLLIMVTLFLRELSYYLNIYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D +RGE LPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+ DG+I GTEYL
Sbjct  61   DSRRGENLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSDGHITGTEYL  120

Query  501  SDLVEKEHSDHKHGFDQE  554
            SDLVEKE   HKH   +E
Sbjct  121  SDLVEKEREAHKHDVHKE  138



>ref|XP_004502082.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cicer arietinum]
Length=351

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ IK +DAFPRAE+HLL KT+SGALVS++GL+IMATLFLHEL YYLTT TVH+M+V
Sbjct  1    MGMKQLIKNLDAFPRAEDHLLHKTQSGALVSVIGLIIMATLFLHELGYYLTTYTVHEMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G I+GTEY+
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGQIIGTEYI  120

Query  501  SDLVEKEH  524
            SDLVEKEH
Sbjct  121  SDLVEKEH  128



>gb|KJB75345.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=322

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  1    MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  121  SDLVENKHTTRNH  133



>gb|KJB75346.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=347

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  1    MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  121  SDLVENKHTTRNH  133



>gb|KJB75343.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=350

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  1    MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  61   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  120

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  121  SDLVENKHTTRNH  133



>ref|XP_010525179.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Tarenaya hassleriana]
Length=355

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 20/157 (13%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++++DAFPRAE+HLLQKT+SGA+VS++GLV+M TLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSLDAFPRAEDHLLQKTQSGAIVSVIGLVVMVTLFLHELSYYLNTVTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINVTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNGHGHIIGTEYI  120

Query  501  SDLVEK---------------EHSDHKH-----GFDQ  551
            SDLVEK               EH DH       GFDQ
Sbjct  121  SDLVEKEHDHSSSHHKHDGKEEHKDHTETFNFLGFDQ  157



>gb|KJB75347.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=385

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  39   MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  98

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  99   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  158

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  159  SDLVENKHTTRNH  171



>gb|KJB75344.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=388

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  39   MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  98

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  99   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  158

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  159  SDLVENKHTTRNH  171



>ref|XP_010923701.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
 ref|XP_010923702.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
Length=350

 Score =   225 bits (573),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  141  MGVK-QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MGV+ Q+++  DAFPRAEEHLL+KT SGA+VSI+GLVIM TLF+HEL+YYLTT TVHQM+
Sbjct  1    MGVRLQSLRNFDAFPRAEEHLLKKTHSGAIVSIIGLVIMFTLFVHELKYYLTTYTVHQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FP+LPC+VLSVDAIDMSGKHEVDLDT+IWKLR++++G ++GTEY
Sbjct  61   VDLKRGETLPIHINMTFPALPCEVLSVDAIDMSGKHEVDLDTSIWKLRMNKEGQVIGTEY  120

Query  498  LSDLVEKEHSDHKHGFDQ  551
            LSDLVEKEHS  KH  D 
Sbjct  121  LSDLVEKEHSGLKHDSDH  138



>gb|KJB75349.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=406

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+KQ I+++DAFPR EEHLLQKT+SGALVS+VGLVIMATLF+HEL YYLTT TVH+M+V
Sbjct  39   MGLKQTIRSLDAFPRTEEHLLQKTQSGALVSVVGLVIMATLFIHELTYYLTTYTVHEMSV  98

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT+YL
Sbjct  99   DLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGTKYL  158

Query  501  SDLVEKEHSDHKH  539
            SDLVE +H+   H
Sbjct  159  SDLVENKHTTRNH  171



>ref|XP_010923699.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010923700.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
Length=351

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = +3

Query  141  MGVK-QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMA  317
            MGV+ Q+++  DAFPRAEEHLL+KT SGA+VSI+GLVIM TLF+HEL+YYLTT TVHQM+
Sbjct  1    MGVRLQSLRNFDAFPRAEEHLLKKTHSGAIVSIIGLVIMFTLFVHELKYYLTTYTVHQMS  60

Query  318  VDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY  497
            VDLKRGETLPIHINM+FP+LPC+VLSVDAIDMSGKHEVDLDT+IWKLR++++G ++GTEY
Sbjct  61   VDLKRGETLPIHINMTFPALPCEVLSVDAIDMSGKHEVDLDTSIWKLRMNKEGQVIGTEY  120

Query  498  LSDLVEKEHSDHKH  539
            LSDLVEKEHS  KH
Sbjct  121  LSDLVEKEHSGLKH  134



>ref|XP_010525178.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010525180.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 21/158 (13%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA++++DAFPRAE+HLLQKT+SGA+VS++GLV+M TLFLHEL YYL T TVHQM+V
Sbjct  1    MGVKQALRSLDAFPRAEDHLLQKTQSGAIVSVIGLVVMVTLFLHELSYYLNTVTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHINVTFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNGHGHIIGTEYI  120

Query  501  SDLVE----------------KEHSDHKH-----GFDQ  551
            SDLVE                +EH DH       GFDQ
Sbjct  121  SDLVEKEHDHSSSHHKHEDGKEEHKDHTETFNFLGFDQ  158



>ref|XP_009408557.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=350

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG  Q++++ DAFPRAEEHLL+KT SGA+VSI+GL +M TLF+HEL+YYLTT TVHQM+V
Sbjct  1    MGRLQSLRSFDAFPRAEEHLLKKTHSGAVVSIIGLAVMGTLFVHELKYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPI+INM+FPSLPC+VLSVDAIDMSGKHEVDLDTNIWKLRL+++G I GTEYL
Sbjct  61   DLKRGETLPIYINMTFPSLPCEVLSVDAIDMSGKHEVDLDTNIWKLRLNKEGQITGTEYL  120

Query  501  SDLVEKEHS  527
            SDLVEKEHS
Sbjct  121  SDLVEKEHS  129



>ref|XP_002322569.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
 gb|ABK93267.1| unknown [Populus trichocarpa]
 gb|EEF04330.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
Length=366

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 15/147 (10%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQAIK++DAFPRAEEHLLQKT+SGALVS++GLVIMATLF HEL YYLTT TVHQM+V
Sbjct  1    MGVKQAIKSLDAFPRAEEHLLQKTQSGALVSVIGLVIMATLFYHELAYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWK---------------  455
            DL+RGE LPIH+N++FPSLPCDVLSVDAIDMSGKHEVDLDTNIWK               
Sbjct  61   DLQRGEILPIHVNITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKKLLFGMLLTRIEFLQ  120

Query  456  LRLSRDGYIVGTEYLSDLVEKEHSDHK  536
            LRL+  G+I GTEYLSDLVEKEH  H 
Sbjct  121  LRLNSHGHITGTEYLSDLVEKEHEAHN  147



>ref|XP_009377930.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Pyrus x bretschneideri]
Length=355

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 2/133 (2%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MGVKQA+K++DAFPRAEEHLLQKT+SGALVS+VGL+IMATLF+HELRYYLTT TVHQM+V
Sbjct  1    MGVKQALKSLDAFPRAEEHLLQKTQSGALVSVVGLLIMATLFVHELRYYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHI   F  L   VLSVDA+DMSGKHEVDLDTNIWKLRL+  G+I+GTEY+
Sbjct  61   DLKRGETLPIHIIFGFQRL-IAVLSVDAVDMSGKHEVDLDTNIWKLRLNSHGHIIGTEYV  119

Query  501  SDLVEKEHSDHKH  539
            SDLVEKEHS HKH
Sbjct  120  SDLVEKEHS-HKH  131



>ref|NP_001051473.1| Os03g0784400 [Oryza sativa Japonica Group]
 gb|AAK72889.1|AC091123_8 unknown protein [Oryza sativa Japonica Group]
 gb|ABF99217.1| Serologically defined breast cancer antigen NY-BR-84, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13387.1| Os03g0784400 [Oryza sativa Japonica Group]
 dbj|BAG96099.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60050.1| hypothetical protein OsJ_12848 [Oryza sativa Japonica Group]
Length=350

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I GL+IM TLF HEL++YLTT TVHQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTIFGLIIMVTLFAHELKFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYL  120

Query  501  SDLVEKEHSDHK  536
            +DLVEKEH  H 
Sbjct  121  NDLVEKEHGTHN  132



>gb|EEC76283.1| hypothetical protein OsI_13786 [Oryza sativa Indica Group]
Length=350

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL KT SGA+V+I GL+IM TLF HEL++YLTT TVHQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLPKTYSGAIVTIFGLIIMVTLFAHELKFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYL  120

Query  501  SDLVEKEHSDHK  536
            +DLVEKEH  H 
Sbjct  121  NDLVEKEHGTHN  132



>ref|XP_006650685.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=351

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I GL+IM TLF+HEL++YLTT TVHQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTIFGLIIMITLFVHELKFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYL  120

Query  501  SDLVEKEH  524
            +DLVEKEH
Sbjct  121  NDLVEKEH  128



>ref|XP_004959338.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=297

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M    ++K+++AFP AEEHLL+KT SGA+V+I+GL+IM TLF+HEL++YLTT TVHQM+V
Sbjct  1    MARIPSLKSLNAFPHAEEHLLKKTYSGAIVTILGLIIMFTLFVHELQFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL R G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDRYGHIIGTEYL  120

Query  501  SDLVEK  518
            SDLVEK
Sbjct  121  SDLVEK  126



>ref|XP_004982677.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=350

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 16/154 (10%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M    ++K+++AFP AEEHLL+KT SGA+V+I+GL+IM TLF+HEL++YLTT TVHQM+V
Sbjct  1    MARIPSLKSLNAFPHAEEHLLKKTYSGAIVTILGLIIMFTLFVHELQFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL R G+I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDRYGHIIGTEYL  120

Query  501  SDLVEK----------------EHSDHKHGFDQE  554
            SDLVEK                E   H+H F+++
Sbjct  121  SDLVEKEHGAHHDHDHGHEHNDEQKKHEHTFNED  154



>ref|XP_003558212.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brachypodium distachyon]
Length=349

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I GL+IM TLF+HEL++YLTT T+HQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTIFGLIIMFTLFVHELKFYLTTYTMHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G I+GTEYL
Sbjct  61   DLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGTIIGTEYL  120

Query  501  SDLVEKEH  524
            SDLVEKEH
Sbjct  121  SDLVEKEH  128



>ref|XP_008654279.1| PREDICTED: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein isoform X1 [Zea mays]
 gb|ACF88129.1| unknown [Zea mays]
 gb|ACG25763.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|ACG31724.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|AFW84737.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=350

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  156  AIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG  335
            ++K+++AFP AEEHLL+KT SGA+V+I GL+IM TLF+HEL++YLTT TVHQM+VDLKRG
Sbjct  6    SLKSLNAFPHAEEHLLKKTYSGAVVTIFGLLIMITLFVHELQFYLTTYTVHQMSVDLKRG  65

Query  336  ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLVE  515
            ETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYLSDLVE
Sbjct  66   ETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYLSDLVE  125

Query  516  KEHS  527
            K H 
Sbjct  126  KGHG  129



>ref|XP_001754824.1| predicted protein [Physcomitrella patens]
 gb|EDQ80278.1| predicted protein [Physcomitrella patens]
Length=347

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q IK +DAFPRAEEHLLQKT SGA VS +GL IM  LF HELR+YL T TVH+M+VD+KR
Sbjct  7    QVIKNLDAFPRAEEHLLQKTSSGAAVSAIGLFIMGVLFFHELRFYLETVTVHEMSVDVKR  66

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLV  512
            GE LPIHINM+FP+LPC+VLS+DAIDMSGKHEVDLDTNIWKLR+ RDGY++G+E+++DLV
Sbjct  67   GEKLPIHINMTFPALPCEVLSLDAIDMSGKHEVDLDTNIWKLRIHRDGYVLGSEFVNDLV  126

Query  513  EKEH  524
            E EH
Sbjct  127  EGEH  130



>ref|XP_002458688.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
 gb|EES03808.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
Length=350

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  156  AIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG  335
            ++K+++AFP AEEHLL+KT SGA+V+I+GL++M TLF+HEL++YLTT TVHQM+VDLKRG
Sbjct  6    SLKSLNAFPHAEEHLLKKTYSGAVVTILGLLVMITLFVHELQFYLTTYTVHQMSVDLKRG  65

Query  336  ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLVE  515
            ETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYLSDLVE
Sbjct  66   ETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYLSDLVE  125

Query  516  K  518
            K
Sbjct  126  K  126



>dbj|BAJ84787.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   201 bits (512),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I+GL++M TLF HEL +YLTT T+HQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTILGLIVMVTLFAHELTFYLTTYTMHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN+SFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G I+GTEYL
Sbjct  61   DLKRGETLPIHINVSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGQIIGTEYL  120

Query  501  SDLVEKE  521
            SDLVEKE
Sbjct  121  SDLVEKE  127



>gb|EMT22267.1| hypothetical protein F775_30192 [Aegilops tauschii]
Length=393

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I+GL++M TLF HEL +YLTT T+HQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTILGLIVMVTLFAHELTFYLTTYTMHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN+SFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYL
Sbjct  61   DLKRGETLPIHINVSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYL  120

Query  501  SDLVEKE  521
            SDLVEKE
Sbjct  121  SDLVEKE  127



>gb|EMS49840.1| hypothetical protein TRIUR3_11686 [Triticum urartu]
Length=532

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG   ++K  +AFP AE+HLL+KT SGA+V+I+GL++M TLF HEL +YLTT T+HQM+V
Sbjct  1    MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTILGLIVMVTLFAHELTFYLTTYTMHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            DLKRGETLPIHIN+SFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GTEYL
Sbjct  61   DLKRGETLPIHINVSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGTEYL  120

Query  501  SDLVEKE  521
            SDLVEKE
Sbjct  121  SDLVEKE  127



>ref|XP_002993277.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
 ref|XP_002994225.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ04730.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ05698.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
Length=333

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+K  +K I+AF  A+EHL QKT SGA+++IVG+ I+  LF +E ++YL+TN VHQM+V
Sbjct  1    MGLK--MKNINAFAHADEHLTQKTVSGAILTIVGVSIILVLFAYEFKFYLSTNVVHQMSV  58

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D  RG+ LPIHIN++FPSLPC +LSVDAIDMSGKHEVDLDTNIWKLRL +DG+I+G+EYL
Sbjct  59   DTTRGQNLPIHINITFPSLPCQILSVDAIDMSGKHEVDLDTNIWKLRLHKDGHILGSEYL  118

Query  501  SDLVEKEHS  527
            SDLVEKEH+
Sbjct  119  SDLVEKEHA  127



>ref|NP_001145501.1| uncharacterized protein LOC100278902 [Zea mays]
 gb|ACG48040.1| hypothetical protein [Zea mays]
Length=110

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M    ++K+++AFP AEEHLL+KT SGA+V+I+GL+IM TLF+HEL++YLTT TVHQM+V
Sbjct  1    MARIPSLKSLNAFPHAEEHLLKKTYSGAVVTILGLLIMITLFVHELQFYLTTYTVHQMSV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLS  467
            DLKRGETLPIH+NMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWK+  S
Sbjct  61   DLKRGETLPIHVNMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKVTSS  109



>ref|XP_006406186.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47639.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=312

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 14/114 (12%)
 Frame = +3

Query  252  MATLFLHELRYYLTTNTVHQMAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEV  431
            MATLFLHEL YYL T TVHQM+VDLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEV
Sbjct  1    MATLFLHELSYYLNTLTVHQMSVDLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEV  60

Query  432  DLDTNIWKLRLSRDGYIVGTEYLSDLVEKE--HSDHKH------------GFDQ  551
            DLDTNIWKLRL+  G+I+GTEY+SDLVEKE  HS HKH            GFDQ
Sbjct  61   DLDTNIWKLRLNSHGHIIGTEYISDLVEKEHDHSTHKHEHKNETEALNVLGFDQ  114



>ref|XP_006406187.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47640.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=313

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 94/115 (82%), Gaps = 15/115 (13%)
 Frame = +3

Query  252  MATLFLHELRYYLTTNTVHQMAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEV  431
            MATLFLHEL YYL T TVHQM+VDLKRGETLPIH+NM+FPSLPCDVLS+DAIDMSGKHEV
Sbjct  1    MATLFLHELSYYLNTLTVHQMSVDLKRGETLPIHVNMTFPSLPCDVLSMDAIDMSGKHEV  60

Query  432  DLDTNIWKLRLSRDGYIVGTEYLSDLVEKE--HSDHKH-------------GFDQ  551
            DLDTNIWKLRL+  G+I+GTEY+SDLVEKE  HS HKH             GFDQ
Sbjct  61   DLDTNIWKLRLNSHGHIIGTEYISDLVEKEHDHSTHKHEEHKNETEALNVLGFDQ  115



>ref|XP_004140296.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis sativus]
Length=388

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 113/193 (59%), Gaps = 56/193 (29%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLV---------IMATLFLHELRYYLT  293
            MG+KQ IK++DAFPRAEEHLLQKT++GA  ++ G+          I A   +  L  Y +
Sbjct  1    MGLKQTIKSLDAFPRAEEHLLQKTQTGAFGNMRGICCWISHNGHTISARTEILSLHIYCS  60

Query  294  TNTVHQM---------------------------------AVDLKRGETLPIHINMSFPS  374
            +    QM                                 +VDLKRGETLPIHINM+FPS
Sbjct  61   SVGKQQMWPLFFLYLRIIPLDWGEGMSDFGDPVLWKGFHMSVDLKRGETLPIHINMTFPS  120

Query  375  LPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLVEKEH----------  524
            LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G I+GTEYLSDLVEKEH          
Sbjct  121  LPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSHGQIIGTEYLSDLVEKEHVDHKHDHDHD  180

Query  525  ----SDHKHGFDQ  551
                  H HGFDQ
Sbjct  181  KEKDHPHIHGFDQ  193



>gb|KDO64245.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=158

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  312  MAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            M+VDLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GT
Sbjct  1    MSVDLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGT  60

Query  492  EYLSDLVEKEHSDHKHGFDQE  554
            EYL+DLVEKEH +HKH  +++
Sbjct  61   EYLTDLVEKEHEEHKHDHNKD  81



>gb|KDO64244.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=201

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  312  MAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            M+VDLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GT
Sbjct  1    MSVDLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGT  60

Query  492  EYLSDLVEKEHSDHKHGFDQE  554
            EYL+DLVEKEH +HKH  +++
Sbjct  61   EYLTDLVEKEHEEHKHDHNKD  81



>gb|KDO64243.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=294

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  312  MAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            M+VDLKRGETLPIHINM+FP+LPCDVLSVDAIDMSGKHEVDLDTNIWKLRL+  G+I+GT
Sbjct  1    MSVDLKRGETLPIHINMTFPALPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGT  60

Query  492  EYLSDLVEKEHSDHKHGFDQE  554
            EYL+DLVEKEH +HKH  +++
Sbjct  61   EYLTDLVEKEHEEHKHDHNKD  81



>ref|NP_001131002.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF79423.1| unknown [Zea mays]
 gb|AFW84738.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=293

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  312  MAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            M+VDLKRGETLPIHINMSFPSLPC+VLSVDAIDMSGKHEVDL TNIWKLRL + G+I+GT
Sbjct  1    MSVDLKRGETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLRLDKYGHIIGT  60

Query  492  EYLSDLVEKEHS  527
            EYLSDLVEK H 
Sbjct  61   EYLSDLVEKGHG  72



>gb|KJB75348.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=293

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  312  MAVDLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            M+VDLKRGETLPIHINM+FPSLPCDV S+DAID+SGKHEVDLDTNIWKLRL+  G+I+GT
Sbjct  1    MSVDLKRGETLPIHINMTFPSLPCDVASIDAIDLSGKHEVDLDTNIWKLRLNSHGHIIGT  60

Query  492  EYLSDLVEKEHSDHKH  539
            +YLSDLVE +H+   H
Sbjct  61   KYLSDLVENKHTTRNH  76



>ref|XP_002948747.1| hypothetical protein VOLCADRAFT_80399 [Volvox carteri f. nagariensis]
 gb|EFJ50127.1| hypothetical protein VOLCADRAFT_80399 [Volvox carteri f. nagariensis]
Length=392

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G    +KA+DA+P+  E    KT SG +++IV  V+M  LFL ELR Y+TT +VH+++VD
Sbjct  7    GFLSKLKALDAYPKINEDFFTKTMSGGIITIVASVVMVLLFLSELRLYMTTQSVHELSVD  66

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            + RGE + IH +++FP +PC  LS+DA+D+SG+  +DLD +++K RLS +G
Sbjct  67   VGRGEKIQIHFDLTFPKVPCSWLSLDAMDISGELHLDLDHDVYKQRLSANG  117



>ref|XP_004169627.1| PREDICTED: uncharacterized protein LOC101223739, partial [Cucumis 
sativus]
Length=57

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQ  311
            MG+KQ IK++DAFPRAEEHLLQKT++GA VS+VGLVIMATLFLHELRYYL+T TVHQ
Sbjct  1    MGLKQTIKSLDAFPRAEEHLLQKTQTGAFVSVVGLVIMATLFLHELRYYLSTYTVHQ  57



>gb|KIZ05378.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Monoraphidium neglectum]
Length=421

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G   A++A+D FP+  E   QKT SG ++++V    M  LFL E R YL T+T H++ VD
Sbjct  9    GALGALRALDMFPKVNEDFFQKTTSGGVITVVAYSFMMLLFLTETRLYLATHTTHELVVD  68

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGET+ I ++++FP +PC  LS+DA+D+SG+  +D++ +++K RLS+ G  V
Sbjct  69   SSRGETISIDVDVTFPRMPCAWLSLDAMDVSGEMHLDVEHDVYKQRLSKAGVPV  122



>ref|XP_004340798.1| golgi family protein, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR18746.1| golgi family protein, putative [Acanthamoeba castellanii str. 
Neff]
Length=383

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            + +K+ DA+P+  E    +T SGA VSI+  +I+  LF  EL +YL+T+   ++ VD  R
Sbjct  7    KKLKSFDAYPKTLEDFRVRTVSGAAVSIISGLIITWLFFSELSFYLSTDVQPELFVDTSR  66

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            GE L I+++++FP LPC  LSVDA+D+SG+H++D++ NI+K RL+ DG  +G E
Sbjct  67   GEKLRINMDVTFPDLPCGYLSVDAMDVSGEHQLDVEHNIFKKRLAADGRPLGIE  120



>gb|KFM75669.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Stegodyphus mimosarum]
Length=125

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            + + I+  DA+P+  E    KT SGA ++IV  V++  LF+ EL YYL      ++ VD+
Sbjct  7    IAEHIRKFDAYPKTLEDFRVKTFSGAAITIVSAVVIVLLFISELNYYLAPEVTEELFVDV  66

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
             R E L I+I+++FP L C+ LSVDA+D+SG+ ++++D NI+K RL   G
Sbjct  67   SRSEKLRINIDVTFPKLCCEFLSVDAMDVSGEQQINVDHNIYKRRLDEAG  116



>ref|XP_010901818.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Esox lucius]
Length=383

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT SGA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCSGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I+++FP++PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLKINIDVTFPNMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTTE  118



>ref|XP_010901817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Esox lucius]
Length=388

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT SGA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCSGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I+++FP++PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLKINIDVTFPNMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTTE  118



>ref|XP_006126747.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Pelodiscus sinensis]
Length=340

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTIISGLIMLLLFFSELQYYLTKEVYPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLRINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTTE  118



>ref|XP_006126746.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pelodiscus sinensis]
Length=383

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTIISGLIMLLLFFSELQYYLTKEVYPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLRINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTTE  118



>emb|CDQ64042.1| unnamed protein product [Oncorhynchus mykiss]
Length=388

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+IN+ FP++PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLKININVIFPNMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNSVTTE  118



>ref|NP_001158869.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Salmo salar]
 gb|ACN10649.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Salmo salar]
Length=388

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+IN+ FP++PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  67   KLKININVIFPNMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTTE  118



>ref|XP_001693564.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08818.1| predicted protein [Chlamydomonas reinhardtii]
Length=388

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G    +KA+DA+P+  E    KT SG +++IV  V+M  LFL ELR +LTT++ H+++VD
Sbjct  5    GFLGKLKALDAYPKINEDFFTKTMSGGIITIVSSVVMVLLFLSELRLFLTTSSAHELSVD  64

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKL  458
            + RGE + IH +++FP +PC  LS+DA+D+SG+  +DL   ++ L
Sbjct  65   VGRGEKIKIHFDVTFPKVPCAWLSLDAMDISGELHLDLVVELYTL  109



>ref|XP_006434016.1| hypothetical protein CICLE_v10001505mg [Citrus clementina]
 gb|ESR47256.1| hypothetical protein CICLE_v10001505mg [Citrus clementina]
Length=379

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            +   I+++DA+P+  E    +T SG ++++V  ++M  LF  ELR YL   T  ++ VD 
Sbjct  4    IMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDT  63

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             RGETL I+ +++FP+LPC +LSVDA+D+SG+  +D+  +I+K RL   G ++
Sbjct  64   SRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVI  116



>ref|XP_005986794.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Latimeria chalumnae]
Length=385

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA+V+IV  +IM  LF  EL+YYLT     ++ VD  RGE
Sbjct  7    LKQFDAYPKTLEDFRVKTCGGAIVTIVSGLIMLLLFFSELQYYLTKEVHPELYVDKSRGE  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V +E
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKPVTSE  118



>ref|XP_006472628.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Citrus sinensis]
 gb|KDO80919.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
Length=386

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            +   I+++DA+P+  E    +T SG ++++V  ++M  LF  ELR YL   T  ++ VD 
Sbjct  4    IMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDT  63

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             RGETL I+ +++FP+LPC +LSVDA+D+SG+  +D+  +I+K RL   G ++
Sbjct  64   SRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVI  116



>ref|XP_005986793.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Latimeria chalumnae]
Length=390

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA+V+IV  +IM  LF  EL+YYLT     ++ VD  RGE
Sbjct  7    LKQFDAYPKTLEDFRVKTCGGAIVTIVSGLIMLLLFFSELQYYLTKEVHPELYVDKSRGE  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V +E
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKPVTSE  118



>ref|XP_009050136.1| hypothetical protein LOTGIDRAFT_142052 [Lottia gigantea]
 gb|ESO99176.1| hypothetical protein LOTGIDRAFT_142052 [Lottia gigantea]
Length=387

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            V + I+  DA+P+  E    KT  GA V++V  VIM  LF+ E+ YYLT     ++ VD 
Sbjct  6    VFERIRQFDAYPKTLEDFRVKTFGGAAVTVVSGVIMLILFVSEINYYLTKEIQPELFVDT  65

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             RG+ L I+I+ +FP LPC  LS+DA+D+SG+ ++D+D +++K RL +DG  V
Sbjct  66   TRGQKLKINIDATFPKLPCSYLSIDAMDVSGEQQIDVDHHLFKHRLDKDGAAV  118



>ref|XP_005294108.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X4 [Chrysemys picta bellii]
Length=321

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAFPKTLEDFRVKTCGGALVTIISGLIMLLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTPE  118



>ref|XP_003058372.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56827.1| predicted protein [Micromonas pusilla CCMP1545]
Length=399

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            MG+   +K  DA+ + E HL +KT +G  V++  L++MA +F+ ELR YL T  V    V
Sbjct  1    MGLAARVKLFDAYHKPERHLTKKTAAGGAVTLSSLLLMAFVFVFELRSYLATERVTTTGV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            D+ R E L I+++++F SLPC  LS+DA+D SGKH+ D+   + K R+ R G  + T
Sbjct  61   DVTRDEMLAINVDVTFTSLPCQTLSLDALDASGKHDQDVGGELHKTRVDRFGRAIAT  117



>ref|XP_005294106.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Chrysemys picta bellii]
Length=388

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAFPKTLEDFRVKTCGGALVTIISGLIMLLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTPE  118



>ref|XP_005294107.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Chrysemys picta bellii]
Length=383

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAFPKTLEDFRVKTCGGALVTIISGLIMLLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGNPVTPE  118



>dbj|GAM20914.1| hypothetical protein SAMD00019534_040890 [Acytostelium subglobosum 
LB1]
Length=376

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M + Q +K+ DA+P+  +    KT SGALVS+V  + +  LF  +L  YLTT+T H++ V
Sbjct  1    MSLIQRLKSFDAYPKTIDDFRIKTYSGALVSLVSGIFILWLFFSQLSIYLTTDTHHELFV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            D  RG+ L I+++++F  LPC  LS+DA+D+SG+H+ D+  NI+K RLS  G
Sbjct  61   DTNRGDKLAINMDITFHHLPCTFLSLDAMDVSGEHQFDVAHNIFKKRLSPTG  112



>ref|XP_006266817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Alligator mississippiensis]
Length=383

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVISGLIMLVLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGSRVTPE  118



>ref|XP_007429094.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Python bivittatus]
Length=383

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMFFLFFSELQYYLTKEVNPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLRINIDIVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKHVTPE  118



>ref|NP_957309.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 isoform 2 [Danio rerio]
 sp|Q803I2.1|ERGI3_DANRE RecName: Full=Endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Danio rerio]
 gb|AAH44474.1| ERGIC and golgi 3 [Danio rerio]
 gb|AAI64701.1| Ergic3 protein [Danio rerio]
Length=383

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ V
Sbjct  1    MDALNKLKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  61   DTSRGDKLRINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGQPVTTE  118



>ref|NP_001028277.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 isoform 1 [Danio rerio]
 gb|AAI00126.1| ERGIC and golgi 3 [Danio rerio]
Length=388

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ V
Sbjct  1    MDALNKLKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V TE
Sbjct  61   DTSRGDKLRINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGQPVTTE  118



>ref|XP_007258562.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Astyanax mexicanus]
Length=383

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V +E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKPVSSE  118



>ref|XP_007258561.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Astyanax mexicanus]
Length=388

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V +E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKPVSSE  118



>ref|XP_003220520.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Anolis carolinensis]
Length=383

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVISGLIMFLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLRINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKHVTPE  118



>gb|EKC31342.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Crassostrea gigas]
Length=397

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            + ++  DA+P+  E    KT  GALV+++  ++M  LF+ EL YYLT +   ++ VD  R
Sbjct  8    ERLRQFDAYPKTLEDFRVKTFGGALVTVISSLLMVILFISELNYYLTKDVQPELFVDTTR  67

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            G+ L I+I++ FP +PC  LS+DA+D+SG+ ++D+D +++K RL+ DG
Sbjct  68   GQKLRINIDIDFPKVPCAYLSIDAMDVSGEQQLDVDHHLFKQRLNADG  115



>ref|XP_011434519.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Crassostrea gigas]
Length=389

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            + ++  DA+P+  E    KT  GALV+++  ++M  LF+ EL YYLT +   ++ VD  R
Sbjct  8    ERLRQFDAYPKTLEDFRVKTFGGALVTVISSLLMVILFISELNYYLTKDVQPELFVDTTR  67

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            G+ L I+I++ FP +PC  LS+DA+D+SG+ ++D+D +++K RL+ DG
Sbjct  68   GQKLRINIDIDFPKVPCAYLSIDAMDVSGEQQLDVDHHLFKQRLNADG  115



>ref|XP_003220521.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Anolis carolinensis]
Length=388

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVISGLIMFLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG  V  E
Sbjct  67   KLRINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGKHVTPE  118



>ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris]
 gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris]
Length=386

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++   +IM  LF  ELR YL + T  ++ VD
Sbjct  3    GIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIIMLLLFFSELRLYLQSVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++ T
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDSHGNVIET  118



>gb|EFA85803.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Polysphondylium pallidum PN500]
Length=388

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q +K+ DA+P+  +    KT +GA+VSIV  + +  LFL ++  Y+TT T H++ VD  R
Sbjct  3    QKLKSFDAYPKTVDDFRVKTYAGAIVSIVSSIFIIWLFLSQISIYMTTETHHELFVDTNR  62

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLV  512
             E L I+I++ F  LPC  LS+DA+D+SG+H+ D+  NI+K RLS  G     E++ D  
Sbjct  63   AEKLKINIDVVFHHLPCAYLSLDAMDVSGEHQFDVAHNIFKRRLSPTG-----EFIPDAP  117

Query  513  EKE  521
            ++E
Sbjct  118  KRE  120



>ref|XP_004085560.2| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Oryzias latipes]
Length=126

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+Y+LT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYFLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D   V  E
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKRRLDKDLKAVSME  118



>ref|XP_001764962.1| predicted protein [Physcomitrella patens]
 gb|EDQ70178.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M V   +K +DA+P+  E    +T SG ++++V  V M  LF+ E+  YL+  T +Q+ V
Sbjct  1    MAVFNKLKQLDAYPKISEDFYSRTLSGGVITLVSTVFMFVLFVTEISLYLSAQTQNQLVV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            D  RGETL I+++++FP+L C ++S+DA+D+SG+  +++  NI+K RL   G +V
Sbjct  61   DTSRGETLQINLDITFPALACSMVSLDAMDISGEQHLNVRHNIFKKRLDVHGKVV  115



>gb|KDP41359.1| hypothetical protein JCGZ_15766 [Jatropha curcas]
Length=322

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG +++I   ++M  LF+ ELR YL   T  ++ VD
Sbjct  3    GMMSKLRSLDAYPKINEDFYSRTFSGGVITIASSIVMLLLFISELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDSHGNVI  116



>ref|XP_010538949.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Tarenaya hassleriana]
Length=386

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GIINKLRNLDAYPKINEDFYSRTLSGGVITLISSVVMFLLFFSELRLYLHTVTETELVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FPSL C +LSVDA+D+SG+  +D+  +I K R+   G I+
Sbjct  63   TSRGETLRINFDVTFPSLACSILSVDAMDISGEQHLDVKHDIIKRRIDSHGNII  116



>ref|XP_003642492.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoformX2 [Gallus gallus]
 ref|XP_003642500.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoformX2 [Gallus gallus]
Length=388

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_003642491.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoformX1 [Gallus gallus]
 ref|XP_003642499.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoformX1 [Gallus gallus]
Length=383

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>emb|CDQ62105.1| unnamed protein product [Oncorhynchus mykiss]
Length=277

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELFV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            D  RG+ L I+I++ FP++PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  61   DTSRGDKLKINIDVIFPNMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKESNPVTTE  118



>ref|XP_007429095.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Python bivittatus]
Length=372

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMFFLFFSELQYYLTKEVNPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D
Sbjct  67   KLRINIDIVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKD  111



>gb|KJE90687.1| Ergic3 protein [Capsaspora owczarzaki ATCC 30864]
Length=401

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 84/141 (60%), Gaps = 11/141 (8%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG-  335
            +K +DA+ +  E +  KT  GA+VSIV  +IMA LF+ EL Y+LTT T H++ VD  R  
Sbjct  19   LKQLDAYAKTTEDVRIKTYGGAIVSIVCALIMAALFVSELNYFLTTETHHELLVDTTRAG  78

Query  336  -ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV---------  485
             + L I+IN++FP LPC  +S+D +D++G+H++D+   + K RLS  G +V         
Sbjct  79   EQKLRININVTFPRLPCAYMSIDVMDVAGEHQLDVLHTLVKTRLSASGEVVREPTPVEAL  138

Query  486  GTEYLSDLVEKEHSDHKHGFD  548
            G +  SD  E+   D+    D
Sbjct  139  GQQPPSDAAERRDLDNSKCGD  159



>ref|XP_004364824.1| Ergic3 protein [Capsaspora owczarzaki ATCC 30864]
Length=392

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 84/141 (60%), Gaps = 11/141 (8%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG-  335
            +K +DA+ +  E +  KT  GA+VSIV  +IMA LF+ EL Y+LTT T H++ VD  R  
Sbjct  10   LKQLDAYAKTTEDVRIKTYGGAIVSIVCALIMAALFVSELNYFLTTETHHELLVDTTRAG  69

Query  336  -ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV---------  485
             + L I+IN++FP LPC  +S+D +D++G+H++D+   + K RLS  G +V         
Sbjct  70   EQKLRININVTFPRLPCAYMSIDVMDVAGEHQLDVLHTLVKTRLSASGEVVREPTPVEAL  129

Query  486  GTEYLSDLVEKEHSDHKHGFD  548
            G +  SD  E+   D+    D
Sbjct  130  GQQPPSDAAERRDLDNSKCGD  150



>ref|XP_005147588.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Melopsittacus undulatus]
Length=388

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMVVLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGKRVTPE  118



>ref|XP_005147587.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Melopsittacus undulatus]
Length=383

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV++V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTVVSGLIMVVLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGKRVTPE  118



>gb|KJB59934.1| hypothetical protein B456_009G281900 [Gossypium raimondii]
Length=343

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   I+ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GIMNKIRNLDAYPKINEDFYSRTLSGGVITVVSSVVMFLLFFSELRLYLHAATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C ++SVDA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALACSIVSVDAMDISGEQHLDVKHDIIKKRLDAHGNVI  116



>ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
 gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
Length=386

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++   ++M  LF+ ELR Y+   T  ++AVD
Sbjct  3    GIMNKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFISELRLYIHAVTETKLAVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDSHGNVI  116



>emb|CDY41876.1| BnaA08g06230D [Brassica napus]
Length=386

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL + T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFLLFFSELRLYLHSVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +M+FP+L C +LSVDA+D+SG+  +D+  ++ K RL   G I+
Sbjct  63   TSRGETLRINFDMTFPALACSILSVDAMDISGELHLDVKHDVIKRRLDSHGNII  116



>ref|XP_009107911.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brassica rapa]
Length=386

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL + T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFLLFFSELRLYLHSVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +M+FP+L C +LSVDA+D+SG+  +D+  ++ K RL   G I+
Sbjct  63   TSRGETLRINFDMTFPALACSILSVDAMDISGELHLDVKHDVVKRRLDSHGNII  116



>gb|KJB59936.1| hypothetical protein B456_009G281900 [Gossypium raimondii]
Length=386

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   I+ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GIMNKIRNLDAYPKINEDFYSRTLSGGVITVVSSVVMFLLFFSELRLYLHAATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C ++SVDA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALACSIVSVDAMDISGEQHLDVKHDIIKKRLDAHGNVI  116



>gb|KHG13361.1| Endoplasmic reticulum-Golgi intermediate compartment 3 [Gossypium 
arboreum]
Length=386

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   I+ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GIMNKIRNLDAYPKINEDFYSRTLSGGVITVVSSVVMFLLFFSELRLYLHAATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C ++SVDA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALACSIVSVDAMDISGEQHLDVKHDIIKKRLDAHGNVI  116



>ref|XP_002977139.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
 ref|XP_002992135.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ06790.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ21748.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
Length=386

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M + + ++ +DA+P+  E    +T SG ++++V  + MA LF+ EL+ +L   T  ++ V
Sbjct  1    MQMLKKLQQLDAYPKINEDFHSRTLSGGVITVVSSIFMAILFITELKLFLLPGTTSELLV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYL  500
            D  RGETL I+ +++FP+L C V+S+DA+D+SG+  +D+  NI+K RL   G +V     
Sbjct  61   DTSRGETLQINFDITFPALACSVISLDAMDVSGEQHLDVKHNIFKKRLDPSGKVVQPPVQ  120

Query  501  SDL  509
             D+
Sbjct  121  EDI  123



>ref|XP_007513569.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16094.1| predicted protein [Bathycoccus prasinos]
Length=409

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  156  AIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG  335
            ++ ++DA+ + E+HL+ +T SGA+VS++G+ +M  L   E+  Y+T   V QMAVD  + 
Sbjct  16   SLSSLDAYKKIEDHLMVRTTSGAIVSLLGIALMCILGASEILNYITPPVVKQMAVDGTQN  75

Query  336  ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            E + + ++++FP +PC VLSVDA D SGK++ D+   + K RL++DG  +G+
Sbjct  76   ELMTVRMDITFPRVPCSVLSVDAYDQSGKNDQDVRGELHKERLNKDGKSLGS  127



>ref|XP_001754958.1| predicted protein [Physcomitrella patens]
 gb|EDQ80412.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 74/115 (64%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M +   +K +DA P+  E    +T SG ++++V  + M  LF+ E R YL+  T +Q+ V
Sbjct  1    MAIFNKLKQLDAHPKISEDFYSRTLSGGVITLVSSIFMFLLFVTEFRIYLSAQTQNQLVV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            D  RGETL I+++++FP+L C V+S+DA+D+SG+  +D+  NI+K RL   G  V
Sbjct  61   DTSRGETLQINLDITFPALACSVVSLDAMDISGELHLDVRHNIYKKRLDVHGKAV  115



>ref|XP_003976750.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform 2 [Takifugu rubripes]
Length=389

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  V+M  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVLMLILFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+IN+ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKININIVFPHMPCVYLSIDAMDVAGEQQLDVEHNLFKQRLDKNLQPVSTE  118



>ref|XP_003976749.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform 1 [Takifugu rubripes]
Length=384

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  V+M  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVLMLILFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+IN+ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKININIVFPHMPCVYLSIDAMDVAGEQQLDVEHNLFKQRLDKNLQPVSTE  118



>gb|KJB59933.1| hypothetical protein B456_009G281900 [Gossypium raimondii]
Length=401

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   I+ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GIMNKIRNLDAYPKINEDFYSRTLSGGVITVVSSVVMFLLFFSELRLYLHAATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C ++SVDA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALACSIVSVDAMDISGEQHLDVKHDIIKKRLDAHGNVI  116



>ref|NP_001001226.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Xenopus (Silurana) tropicalis]
 sp|Q6NVS2.1|ERGI3_XENTR RecName: Full=Endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Xenopus (Silurana) tropicalis]
 gb|AAH67932.1| ERGIC and golgi 3 [Xenopus (Silurana) tropicalis]
Length=384

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GALV+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LRQFDAYPKTLEDFRVKTCGGALVTVISGLIMLILFFSELQYYLTKEIYPELFVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D   V +E
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDKKPVTSE  118



>ref|XP_010752864.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Larimichthys crocea]
Length=314

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D
Sbjct  61   DTSRGDKLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKD  111



>ref|XP_001759631.1| predicted protein [Physcomitrella patens]
 gb|EDQ75543.1| predicted protein [Physcomitrella patens]
Length=382

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q +K++DA+P+  E    +T SG +++I+    M  LF  EL+ YL     + + VD +R
Sbjct  3    QKLKSLDAYPKINEDFYSRTLSGGIITIISATFMVLLFFSELKLYLAAQVANDLVVDTER  62

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            G T+ I+++++FP+L C V+S+DA+D+SG+  +D+  NI+K RL  +G ++
Sbjct  63   GGTIQINLDVTFPALACSVVSLDAMDISGEAHLDVKHNIFKKRLDVNGKVI  113



>ref|XP_008282244.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Stegastes partitus]
Length=338

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D
Sbjct  61   DTSRGDKLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKD  111



>ref|XP_009595173.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Nicotiana tomentosiformis]
Length=376

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            I+ +DA+P+  E    +T SG ++++   +IM  LF+ ELR YL   T  ++ VD  RGE
Sbjct  8    IRNLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAVTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            TL I+ +++FP+LPC +LSVDA+D+SG+  +D+  +I K R+   G ++ T 
Sbjct  68   TLRINFDITFPALPCSILSVDAMDISGEQHLDIRHDIIKKRIDVHGNVIETR  119



>ref|XP_009595172.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009779132.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=386

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            I+ +DA+P+  E    +T SG ++++   +IM  LF+ ELR YL   T  ++ VD  RGE
Sbjct  8    IRNLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAVTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            TL I+ +++FP+LPC +LSVDA+D+SG+  +D+  +I K R+   G ++ T 
Sbjct  68   TLRINFDITFPALPCSILSVDAMDISGEQHLDIRHDIIKKRIDVHGNVIETR  119



>ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=386

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            I+++DA+P+  E    +T SG ++++   +IM  LF+ ELR YL   T  ++ VD  RGE
Sbjct  8    IRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            TL I+ +++FP++PC +LSVDA+D+SG+  +D+  +I K R+   G ++ T 
Sbjct  68   TLRINFDITFPAIPCSILSVDAMDISGEQHLDIRHDIIKKRIDVLGNVIETR  119



>ref|XP_002127888.2| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Ciona intestinalis]
Length=343

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 81/135 (60%), Gaps = 10/135 (7%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT SGA V+++   IM  LFL EL+YYLTT    ++ VD+ RG 
Sbjct  13   VKDFDAYPKTLEDFRIKTISGATVTLISGTIMLLLFLSELKYYLTTEVNSELFVDMSRGN  72

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGY----------IVG  488
             L I++N++FP +PC+ LS+D ID+SG+ ++D+   + K  L+ DG           +VG
Sbjct  73   KLSINMNVTFPLVPCEFLSLDMIDVSGQRDIDVQHTLVKQPLNSDGSWVAEAAEKVDLVG  132

Query  489  TEYLSDLVEKEHSDH  533
            T+ + +  E   +D+
Sbjct  133  TKPVLNATEPPPADY  147



>gb|KIZ06292.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Monoraphidium neglectum]
Length=443

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G   A+ A+DAFP+  E    KT SG ++++V    M  LFL E R YL     H++ VD
Sbjct  10   GALSALSALDAFPKVNEDFYHKTASGGVITVVAYAFMLLLFLTETRLYLAVQRTHELQVD  69

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
               G T+ I ++++FP +PC  LS+DA+D+SG+  +D++ +++K RLS+ G  V
Sbjct  70   STIGATISIDVDVTFPRMPCAWLSLDAMDVSGELHLDVEHDVYKQRLSQGGTPV  123



>ref|XP_009419691.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=384

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M +   ++ +DA+P+  E    +T SG+L++IV  V+M  LFL E+R YL + T  ++ V
Sbjct  1    MEILNRLRNLDAYPKINEDFYHRTLSGSLITIVSSVVMLFLFLSEIRMYLYSATETKLIV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            D  RGE L I+ +++FPSLPC +LSVD +D+SG+   D+  +I K+R+   G ++
Sbjct  61   DNSRGEMLRINFDVTFPSLPCSLLSVDTMDISGERHYDIRHDIVKIRMDHLGNVI  115



>ref|XP_007544069.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Poecilia formosa]
Length=389

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELKPVTTE  118



>ref|XP_008406425.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Poecilia reticulata]
Length=384

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELNPVTTE  118



>ref|XP_009860519.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Ciona intestinalis]
Length=385

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 81/135 (60%), Gaps = 10/135 (7%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT SGA V+++   IM  LFL EL+YYLTT    ++ VD+ RG 
Sbjct  13   VKDFDAYPKTLEDFRIKTISGATVTLISGTIMLLLFLSELKYYLTTEVNSELFVDMSRGN  72

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGY----------IVG  488
             L I++N++FP +PC+ LS+D ID+SG+ ++D+   + K  L+ DG           +VG
Sbjct  73   KLSINMNVTFPLVPCEFLSLDMIDVSGQRDIDVQHTLVKQPLNSDGSWVAEAAEKVDLVG  132

Query  489  TEYLSDLVEKEHSDH  533
            T+ + +  E   +D+
Sbjct  133  TKPVLNATEPPPADY  147



>ref|XP_007544071.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Poecilia formosa]
Length=384

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELKPVTTE  118



>ref|XP_008406424.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Poecilia reticulata]
Length=389

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELNPVTTE  118



>ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum tuberosum]
Length=386

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            I+++DA+P+  E    +T SG ++++   +IM  LF+ ELR YL   T  ++ VD  RGE
Sbjct  8    IRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLIVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
            TL I+ +++FP++PC +LSVDA+D+SG+  +D+  +I K R+   G ++ T 
Sbjct  68   TLRINFDITFPAIPCSILSVDAMDISGEQHLDIRHDIIKKRIDVLGNVIETR  119



>gb|ACF79024.1| unknown [Zea mays]
 gb|AFW82351.1| LOW QUALITY PROTEIN: DUF1692 domain, endoplasmic reticulum vescicle 
transporter protein [Zea mays]
Length=176

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  ++T  ++ VD  RGE
Sbjct  8    LKRLDAYPKVNEDFYKRTLSGGIVTLVAAVVMLLLFISETRSYFYSSTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL+  G ++
Sbjct  68   RLRVNFDITFPSIPCTLLSVDTTDISGEQHHDIRHDIEKRRLNSHGNVI  116



>gb|ELU18587.1| hypothetical protein CAPTEDRAFT_139951 [Capitella teleta]
Length=285

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            V  +++  DA+P+  E    KT  GA V+IV  ++M  LF+ E  YYLTT    ++ VD 
Sbjct  6    VFNSLRQFDAYPKTLEDFRVKTYGGAAVTIVSGILMFVLFVSEFNYYLTTEVHPELFVDT  65

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             RG+ L I+++M+FP++ C  L++DA+D+SG+ ++D+  +I+K RL  DG  V  E
Sbjct  66   ARGQKLKINVDMTFPTVGCSFLTLDAMDVSGEQQIDVLHDIFKQRLDLDGIEVKAE  121



>emb|CAF95749.1| unnamed protein product [Tetraodon nigroviridis]
Length=299

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDIVFPHMPCVYLSIDAMDVAGEQQLDVEHNLFKQRLDKNLKPVSTE  118



>ref|XP_006639728.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Lepisosteus oculatus]
Length=388

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELYVDTTRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++G  V  E
Sbjct  67   KLKINVDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKEGRPVTPE  118



>ref|XP_005534205.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pseudopodoces humilis]
Length=383

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_009097047.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Serinus canaria]
Length=383

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|NP_001091124.1| ERGIC and golgi 3 [Xenopus laevis]
 gb|AAI29573.1| LOC100036873 protein [Xenopus laevis]
Length=384

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GA+V+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LRQFDAYPKTLEDFRVKTCGGAVVTVISGLIMLILFFSELQYYLTKEIYPELFVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D   V +E
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDKKPVTSE  118



>ref|XP_005534206.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Pseudopodoces humilis]
Length=390

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_006639727.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Lepisosteus oculatus]
Length=383

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRIKTCGGATVTIISGLIMLILFFSELQYYLTKEVHPELYVDTTRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++G  V  E
Sbjct  67   KLKINVDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKEGRPVTPE  118



>ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa]
 gb|EEE93578.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa]
Length=386

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++   V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GLMSKLRNLDAYPKINEDFYSRTLSGGVITLASSVVMFLLFFSELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDFHGNVI  116



>ref|XP_005496545.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Zonotrichia albicollis]
Length=383

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_006826951.1| hypothetical protein AMTR_s00010p00188050 [Amborella trichopoda]
 gb|ERM94188.1| hypothetical protein AMTR_s00010p00188050 [Amborella trichopoda]
Length=385

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M V   ++ +DA+P+  E    +T SG L++I   + M  LF  ELR YL   T  ++ V
Sbjct  1    MDVLNKLRHLDAYPKINEDFYSRTLSGGLITIFSSIFMLLLFFSELRLYLHAATETKLMV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            D  RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K R+   G ++
Sbjct  61   DTSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRIDAHGNVI  115



>ref|XP_009097046.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Serinus canaria]
Length=390

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_005496546.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Zonotrichia albicollis]
Length=390

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G+ ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa]
 gb|EEE81559.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa]
Length=377

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++  DA+P+  E    +T SG ++++   ++M  LF  ELR YL   T  ++ VD
Sbjct  3    GLMSKLRNFDAYPKINEDFYSRTLSGGVITLASSIVMFLLFFSELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDSHGNVI  116



>ref|XP_005810880.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Xiphophorus maculatus]
Length=384

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGIIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELKPVTTE  118



>ref|XP_005810881.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Xiphophorus maculatus]
Length=389

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGIIMFVLFVSELQYYLTKEVHPELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++   V TE
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKELKPVTTE  118



>ref|XP_002891208.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67467.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_008319388.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Cynoglossus semilaevis]
Length=384

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGIIMLILFVSELQYYLTKEVHLELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKD  111



>ref|XP_001762360.1| predicted protein [Physcomitrella patens]
 gb|EDQ72827.1| predicted protein [Physcomitrella patens]
Length=380

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K +DA+P+  E    +T SG L+++V  V M  LF+ E R YL+  T +Q+ V
Sbjct  1    MSFFNKLKHLDAYPKISEDFYSRTLSGGLITLVSSVFMTLLFITEFRIYLSAQTQNQLVV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            D  RGETL I+++++F +L C V+S+DA+D+SG+  +++  NI+K RL   G
Sbjct  61   DTSRGETLQINLDITFSALACSVVSLDAMDISGEQHLNVRHNIFKKRLDVHG  112



>ref|NP_001154394.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
 gb|AAG52317.1|AC021666_6 unknown protein; 24499-21911 [Arabidopsis thaliana]
 gb|AAO24579.1| At1g36050 [Arabidopsis thaliana]
 dbj|BAF00066.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31841.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_010496064.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_006305051.1| hypothetical protein CARUB_v10009417mg [Capsella rubella]
 gb|EOA37949.1| hypothetical protein CARUB_v10009417mg [Capsella rubella]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|NP_001052965.2| Os04g0455900 [Oryza sativa Japonica Group]
 dbj|BAF14879.2| Os04g0455900 [Oryza sativa Japonica Group]
Length=253

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++   V+M  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +I+K R+   G ++ T+
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDIFKQRIDVHGNVIATK  119



>gb|KCW66745.1| hypothetical protein EUGRSUZ_F00498 [Eucalyptus grandis]
Length=354

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            GV   ++ +DA+P+  E    +T SG ++++V  V+MA LF+ ELR YL   T  ++ VD
Sbjct  3    GVFGKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMALLFISELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL  +G ++
Sbjct  63   TSRGEHLRINFDVTFPALACSMLSLDAMDVSGEQHLDVRHDIIKRRLDSNGQVI  116



>ref|XP_008319387.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Cynoglossus semilaevis]
Length=389

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+I+  +IM  LF+ EL+YYLT     ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTWGGATVTIISGIIMLILFVSELQYYLTKEVHLELYVDTSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL +D
Sbjct  67   KLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKD  111



>gb|KFK24003.1| hypothetical protein AALP_AAs67745U000100 [Arabis alpina]
Length=386

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL   G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSHG  113



>ref|XP_006654573.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=384

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G  Q +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  + T  ++ VD
Sbjct  3    GFLQKLKGLDAYPKVNEDFYKRTLSGGVVTLVASVVMLLLFVSETRSYFYSATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L ++ +++FPS+PC +LSVD +D+SG+   D+  +I K RL   G ++
Sbjct  63   TSRGERLRVNFDITFPSVPCTLLSVDTVDISGEQHHDIRHDIEKKRLDAHGNVI  116



>ref|XP_011013540.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=386

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++   ++M  LF  ELR YL   T  ++ VD
Sbjct  3    GLMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIVMFLLFFSELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALPCSILSLDAMDISGEQHLDVKHDIIKKRLDFHGNVI  116



>ref|XP_010060169.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Eucalyptus grandis]
 gb|KCW66743.1| hypothetical protein EUGRSUZ_F00498 [Eucalyptus grandis]
Length=386

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            GV   ++ +DA+P+  E    +T SG ++++V  V+MA LF+ ELR YL   T  ++ VD
Sbjct  3    GVFGKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMALLFISELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL  +G ++
Sbjct  63   TSRGEHLRINFDVTFPALACSMLSLDAMDVSGEQHLDVRHDIIKRRLDSNGQVI  116



>gb|KCW66744.1| hypothetical protein EUGRSUZ_F00498 [Eucalyptus grandis]
Length=387

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            GV   ++ +DA+P+  E    +T SG ++++V  V+MA LF+ ELR YL   T  ++ VD
Sbjct  3    GVFGKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMALLFISELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL  +G ++
Sbjct  63   TSRGEHLRINFDVTFPALACSMLSLDAMDVSGEQHLDVRHDIIKRRLDSNGQVI  116



>gb|AFW82354.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein, 
partial [Zea mays]
Length=202

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  ++T  ++ VD  RGE
Sbjct  8    LKRLDAYPKVNEDFYKRTLSGGIVTLVAAVVMLLLFISETRSYFYSSTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL+  G ++
Sbjct  68   RLRVNFDITFPSIPCTLLSVDTTDISGEQHHDIRHDIEKRRLNSHGNVI  116



>ref|XP_002191084.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform 1 [Taeniopygia guttata]
Length=383

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DAFP+  E    KT  GALV+ V  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LKRFDAFPKTLEDFRVKTCGGALVTAVSGLIMVLLFFSELQYYLTKEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I++++ FP +PC  LS+DA+D++G  ++D++ N++K RL + G  V  E
Sbjct  67   KLKINLDVIFPHMPCAYLSIDAMDVAGDQQLDVEHNLFKQRLDKAGNRVTPE  118



>ref|XP_010461344.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X3 [Camelina sativa]
Length=341

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLLINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_007907500.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Callorhinchus milii]
Length=391

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GALV+ +  +IM  LF  EL+YYLT     ++ VD  RGE
Sbjct  16   LRHFDAYPKTLEDFRVKTCGGALVTFISSLIMLVLFCSELQYYLTKEIHPELYVDTSRGE  75

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL   G +V  E
Sbjct  76   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDLAGNLVTLE  127



>ref|XP_010461342.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Camelina sativa]
Length=386

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLLINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_007907499.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Callorhinchus milii]
Length=396

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GALV+ +  +IM  LF  EL+YYLT     ++ VD  RGE
Sbjct  16   LRHFDAYPKTLEDFRVKTCGGALVTFISSLIMLVLFCSELQYYLTKEIHPELYVDTSRGE  75

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL   G +V  E
Sbjct  76   KLKINIDVVFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDLAGNLVTLE  127



>ref|XP_005111657.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Aplysia californica]
Length=303

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GA V++V  V+M  LF+ EL YYLT     ++ VD  RG+
Sbjct  10   LRRFDAYPKTLEDFRVKTYGGAAVTVVSAVLMCVLFVSELNYYLTKEVHPELFVDTSRGQ  69

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L I+I++ FP++ C  LS+DA+D+SG+ ++D+D N++K RL   G  V
Sbjct  70   KLRINIDIVFPNMACAFLSLDAMDVSGESQIDVDGNLFKQRLDLGGRPV  118



>ref|XP_006783096.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Neolamprologus brichardi]
Length=384

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_004548890.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Maylandia zebra]
 ref|XP_005724450.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pundamilia nyererei]
 ref|XP_005947006.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Haplochromis burtoni]
Length=389

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_003448415.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform 1 [Oreochromis niloticus]
Length=389

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_003448416.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform 2 [Oreochromis niloticus]
Length=384

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_004548891.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Maylandia zebra]
 ref|XP_005724451.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Pundamilia nyererei]
 ref|XP_005947007.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Haplochromis burtoni]
Length=384

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_001419260.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97553.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=310

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 1/112 (1%)
 Frame = +3

Query  168  IDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGETLP  347
            +DAF RA  HL ++T++GA VS+VG+V+   L L E+  +LT        VD  R  TL 
Sbjct  1    VDAFARAAPHLTKRTRAGACVSVVGVVLACALALVEITDFLTPTRAKTHGVDDARNATLR  60

Query  348  IHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLS  503
            I I+++FP +PC +L VDA D SGKHEVD    + K RL   G  +G EY S
Sbjct  61   IEIDVTFPRMPCQLLYVDAYDESGKHEVDARGLLLKTRLDASGRAIG-EYES  111



>ref|XP_006783095.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Neolamprologus brichardi]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M     +K  DA+P+  E    KT  GA V+I+  VIM  LF+ EL+YYLT     ++ V
Sbjct  1    MDTLNKLKQFDAYPKTLEDFRVKTWGGATVTIISGVIMLILFVSELQYYLTKEVHPELYV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRD  473
            D  RG+ L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL ++
Sbjct  61   DTSRGDKLKINIDIIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKE  111



>ref|XP_007018816.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=386

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  V+M  LF  ELR YL   T  ++ VD
Sbjct  3    GIMNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFFLFFSELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGETLRINFDVTFPALACSILSLDAMDISGEQHLDVRHDIIKKRLDAHGNVI  116



>emb|CDP01032.1| unnamed protein product [Coffea canephora]
Length=149

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            I+++DA+P+  E    +T SG ++++   ++M  LF  ELR YL   T  ++ VD  RGE
Sbjct  8    IRSLDAYPKINEDFYSRTLSGGVITLASSIVMFLLFFSELRLYLHAVTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+ +++FP+LPC +LS+DA+D+SG+  +D+  +I K R+   G ++ T 
Sbjct  68   RLRINFDVTFPALPCSMLSLDAMDISGEQHLDVRHDITKKRIDVHGNVIETR  119



>ref|XP_003568216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brachypodium distachyon]
Length=384

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G  Q +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E   YL + T  ++ VD
Sbjct  3    GFLQKLKGLDAYPKVNEDFYKRTLSGGVVTLVSAVVMLLLFISETSSYLNSATETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL+  G ++
Sbjct  63   TSRGERLRVNFDITFPSIPCTLLSVDTRDISGEQHQDIRHDIEKKRLNSHGNVI  116



>tpg|DAA37501.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=268

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++V   +M  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +++K R+   G ++ T
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDVFKQRIDAHGNVIAT  118



>ref|XP_010461343.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Camelina sativa]
Length=371

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G  +
Sbjct  63   TSRGETLLINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNGNTI  116



>ref|XP_002114205.1| hypothetical protein TRIADDRAFT_37998 [Trichoplax adhaerens]
 gb|EDV23295.1| hypothetical protein TRIADDRAFT_37998 [Trichoplax adhaerens]
Length=369

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 76/133 (57%), Gaps = 5/133 (4%)
 Frame = +3

Query  156  AIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRG  335
            +++  DAFP+  E    +T  GA ++IV  VIM  LF+ E+ YYL+     ++ VD  RG
Sbjct  9    SLRRYDAFPKTLEDFRIRTFGGATITIVSAVIMLLLFVSEMNYYLSVEVTSELFVDTSRG  68

Query  336  ETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEYLSDLVE  515
            E + I++N++FP + C +LSVD +D++G  ++D+  N+ K R+  +G   G     D V+
Sbjct  69   EKIKIYMNVTFPKMACAILSVDTMDVAGMQQLDIKQNLMKRRIDENGKPTG-----DAVQ  123

Query  516  KEHSDHKHGFDQE  554
            K  +     +  E
Sbjct  124  KNKTKCGSCYGAE  136



>ref|XP_011299088.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Fopius arisanus]
Length=387

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            +   ++ IDA+P+  E    KT SGALV+I+  +IMA LF  ELR YLT N   ++ VD 
Sbjct  5    ITDVLRQIDAYPKTLEDFRVKTFSGALVTIISSIIMALLFFSELRDYLTPNLNEELFVDT  64

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
             R   L I++++  P++ CD+LS+DA+D +G+  + ++ NI+K RL+ +G
Sbjct  65   SRSSKLRINLDVVIPTISCDLLSLDAMDTTGEQHLQIEHNIYKRRLNLEG  114



>ref|NP_001087591.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Xenopus laevis]
 sp|Q66KH2.1|ERGI3_XENLA RecName: Full=Endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Xenopus laevis]
 gb|AAH80394.1| MGC83277 protein [Xenopus laevis]
Length=389

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  DA+P+  E    KT  GA+V+++  +IM  LF  EL+YYLT     ++ VD  RG+
Sbjct  7    LRQFDAYPKTLEDFRVKTCGGAVVTVISGLIMLILFFSELQYYLTKEVYPELFVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+I++ FP +PC  LS+DA+D++G+ ++D++ N++K RL  D   V +E
Sbjct  67   KLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDLDKKPVTSE  118



>ref|XP_010535613.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Tarenaya hassleriana]
Length=387

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  ++M  LF  ELR YL   T  Q+ VD
Sbjct  3    GIMNRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLILFFSELRLYLHPVTATQLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGE L I+ +++FP+L C ++S+DA+D+SG+  +D+  +I K RL   G ++
Sbjct  63   TSRGEKLQINFDVTFPALACSIISLDAMDISGEQHLDVKHDIIKRRLDSHGNVI  116



>emb|CAE02574.2| OSJNBa0006M15.17 [Oryza sativa Japonica Group]
 emb|CAH67017.1| H0523F07.5 [Oryza sativa Indica Group]
 gb|EEC77387.1| hypothetical protein OsI_16129 [Oryza sativa Indica Group]
Length=386

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++   V+M  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +I+K R+   G ++ T+
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDIFKQRIDVHGNVIATK  119



>ref|XP_002439992.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
 gb|EES18422.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
Length=384

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 71/111 (64%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  + T  ++ VD  R
Sbjct  6    QRLKRLDAYPKVNEDFYKRTLSGGIVTLVAAVVMLLLFISETRSYFYSATETKLVVDTSR  65

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            GE L ++ +++FPS+PC +LSVD +D+SG+   D+  +I K RL   G ++
Sbjct  66   GERLRVNFDITFPSIPCTLLSVDTMDISGEQHHDIRHDIEKRRLDSHGNVI  116



>ref|NP_564467.5| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
 gb|AEE31840.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
Length=489

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++  V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_006403044.1| hypothetical protein EUTSA_v10003455mg [Eutrema salsugineum]
 gb|ESQ44497.1| hypothetical protein EUTSA_v10003455mg [Eutrema salsugineum]
Length=386

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 71/111 (64%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++   V+M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLFSSVVMFLLFFSELRLYLHTVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL   G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSHG  113



>ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
 gb|EES12279.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
Length=386

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++   VIM  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGVITLASSVIMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +++K R+   G ++ T 
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDVFKQRIDAHGNVIATR  119



>gb|ELU18591.1| hypothetical protein CAPTEDRAFT_139954 [Capitella teleta]
Length=285

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            V  +++  DA+P+  E    KT  GA V+IV  ++M  LF+ E  YYL T    ++ VD 
Sbjct  6    VFNSLRQFDAYPKTFEDFRVKTYGGAAVTIVSGILMFVLFVSEFNYYLITEVHPELFVDT  65

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             RG+ L I+++M+FP++ C  L++DA+D+SG+ ++D+  +I+K RL  DG  V  E
Sbjct  66   ARGQKLKINVDMTFPTVGCSFLTLDAMDVSGEQQIDVLHDIFKQRLDLDGIEVKAE  121



>ref|XP_003283473.1| hypothetical protein DICPUDRAFT_52316 [Dictyostelium purpureum]
 gb|EGC39970.1| hypothetical protein DICPUDRAFT_52316 [Dictyostelium purpureum]
Length=383

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  +    KT +GA+VSIVG + +  LF  ++  Y +T+  H++ VD  RGE
Sbjct  7    LKKFDAYPKTVDDFRVKTFTGAIVSIVGGIFILWLFFSQVTLYFSTDIHHELFVDTTRGE  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
             L I+++++F  LPC  LS+DA+D+SG+H+ D+  NI+K RLS  G
Sbjct  67   KLKINMDITFHHLPCAYLSLDAMDVSGEHQFDVAHNIFKKRLSSTG  112



>ref|XP_010500060.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X3 [Camelina sativa]
Length=341

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++   +M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSFVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|XP_009390586.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=386

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            GV   ++ +DA+P+  E    +T SG +++IV  ++M  LF+ ELR YL   T  ++ VD
Sbjct  3    GVFGKLRNLDAYPKINEDFYSRTLSGGIITIVSSIVMFLLFISELRLYLHAVTETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
              RGE+L I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL   G ++ T
Sbjct  63   TSRGESLRINFDVTFPALSCSMLSLDAMDISGEEHLDVRHDIIKKRLDSHGNVIET  118



>ref|XP_629760.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium discoideum AX4]
 sp|Q54DW2.1|ERGI3_DICDI RecName: Full=Probable endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Dictyostelium discoideum]
 gb|EAL61357.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium discoideum AX4]
Length=383

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  +    KT +GA+VSI+G V +  LF  ++  Y +T+  H++ VD  RGE
Sbjct  6    LKKFDAYPKTVDDFRVKTYTGAIVSIIGGVFILWLFFSQVTLYFSTDIHHELFVDTTRGE  65

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
             L I+++++F  LPC  LS+DA+D+SG+H+ D+  NI+K RLS  G
Sbjct  66   KLKINMDITFHHLPCAYLSLDAMDVSGEHQFDVAHNIFKKRLSPTG  111



>gb|KEH28066.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=312

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            +   ++ +DA+P+  E    +T SG L++IV  ++M  LF  ELR YL   T  ++ VD 
Sbjct  4    IMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSELRLYLHAATETKLVVDT  63

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
             RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +I K R+   G ++ T
Sbjct  64   SRGETLRINFDVTFPALACSIVSLDAMDISGEQHLDVRHDIIKKRIDSHGNVIET  118



>gb|ACN35132.1| unknown [Zea mays]
 tpg|DAA37502.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=391

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++V   +M  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +++K R+   G ++ T
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDVFKQRIDAHGNVIAT  118



>ref|XP_010500058.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Camelina sativa]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++   +M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSFVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNG  113



>ref|NP_001148795.1| LOC100282412 [Zea mays]
 gb|ACF82571.1| unknown [Zea mays]
 gb|ACG32935.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 tpg|DAA37500.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++++DA+P+  E    +T SG ++++V   +M  LF+ ELR YL   T   + VD
Sbjct  3    GLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFVSELRLYLHAVTETTLRVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
              RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +++K R+   G ++ T 
Sbjct  63   TSRGETLRINFDVTFPALQCSIISLDAMDISGQEHLDVKHDVFKQRIDAHGNVIATR  119



>ref|XP_001634898.1| predicted protein [Nematostella vectensis]
 gb|EDO42835.1| predicted protein [Nematostella vectensis]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
              ++  DA+P+  E    KT  GA V+ +   +M  LF+ EL YYLTT    ++ VD  R
Sbjct  8    NTLRRFDAYPKTLEDFRIKTFGGAAVTFISGFLMFILFVSELNYYLTTEVNPELFVDTTR  67

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTEY-LSDL  509
             + L I++ + FP LPC  LS+DA+D+SG+ ++D+ +NI K R+  DG I+       DL
Sbjct  68   AQKLRINVEIVFPKLPCVYLSIDAMDVSGEQQIDVSSNILKRRVDLDGKIIDENAEKGDL  127

Query  510  VEKEH  524
             +K H
Sbjct  128  GDKSH  132



>gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Erythranthe guttata]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++ +DA+P+  E    +T SG ++++V  + +A LFL E R YL T T  ++ VD  RG 
Sbjct  8    LRNLDAYPKINEDFYSRTLSGGVITLVSSIFIALLFLSEFRLYLHTVTDSKLVVDTSRGG  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
             L I+ +++FPS+PC +LSVDA+D+SG+  +D+  +I+K R+   G ++ T
Sbjct  68   KLRINFDVTFPSVPCTLLSVDAMDISGERHMDIRHDIFKKRIDSHGNVIET  118



>ref|XP_002264644.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI29463.3| unnamed protein product [Vitis vinifera]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            V Q ++ +DA+P+  E    +T SG L++++  ++M  LF  ELR YL T T  ++ VD 
Sbjct  4    VFQRLRNLDAYPKINEDFYSRTFSGGLITLISSIVMLFLFFSELRLYLHTVTETKLVVDT  63

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             RG TL I+ +++FP++PC VL++DA+D+SG+   D+  +I K R+   G +V
Sbjct  64   SRGGTLRINFDVTFPAVPCSVLTLDAMDISGEQHHDIKHDIVKKRIDAHGNVV  116



>ref|XP_010500059.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Camelina sativa]
Length=371

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++++   +M  LF  ELR YL T T  ++ VD
Sbjct  3    GILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSFVMFLLFFSELRLYLHTVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C +LSVDA+D+SG+  +D+  +I K RL  +G  +
Sbjct  63   TSRGETLRINFDITFPALACSILSVDAMDISGELHLDVKHDIIKRRLDSNGNTI  116



>ref|XP_002157414.2| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Hydra vulgaris]
Length=311

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 0/117 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M +   +K  DA+P+  E    KT  GAL++ +  +IM  LFL E  YYLTT    ++ V
Sbjct  1    MDISTRLKQFDAYPKTLEDFRVKTYGGALITGISSIIMFALFLSEFNYYLTTEVHPELFV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
            D  R + L I+I++ FP++ C  LS+DA+D+SG+ + DL+ NI+K R    G  + T
Sbjct  61   DTTRHQKLRINIDVYFPNIGCAYLSIDAMDVSGEQQTDLEHNIFKKRYDEKGNPIDT  117



>ref|XP_004961675.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=384

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  + T  ++ VD  R
Sbjct  6    QKLKRLDAYPKVNEDFYKRTLSGGVVTLVAAVVMLLLFISETRSYFYSATETKLVVDTSR  65

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            GE L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL   G ++
Sbjct  66   GERLRVNFDVTFPSIPCTLLSVDTTDISGEQHHDIRHDIEKRRLDSHGNVI  116



>ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
[Medicago truncatula]
 gb|AES97982.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=386

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  VKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDL  326
            +   ++ +DA+P+  E    +T SG L++IV  ++M  LF  ELR YL   T  ++ VD 
Sbjct  4    IMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSELRLYLHAATETKLVVDT  63

Query  327  KRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGT  491
             RGETL I+ +++FP+L C ++S+DA+D+SG+  +D+  +I K R+   G ++ T
Sbjct  64   SRGETLRINFDVTFPALACSIVSLDAMDISGEQHLDVRHDIIKKRIDSHGNVIET  118



>ref|XP_009419975.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=386

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG +++IV  ++M  LF+ ELR YL   T  ++ VD
Sbjct  3    GLFGKLRNLDAYPKINEDFYSRTLSGGIITIVSSIVMFLLFISELRLYLHAVTETKLIVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL   G I+
Sbjct  63   TSRGETLRINFDVTFPALSCSMLSLDAMDISGEEHLDVRHDIIKKRLDSHGNII  116



>ref|NP_001132255.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF81030.1| unknown [Zea mays]
 gb|ACN28701.1| unknown [Zea mays]
 gb|AFW82352.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=384

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  ++T  ++ VD  RGE
Sbjct  8    LKRLDAYPKVNEDFYKRTLSGGIVTLVAAVVMLLLFISETRSYFYSSTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL+  G ++
Sbjct  68   RLRVNFDITFPSIPCTLLSVDTTDISGEQHHDIRHDIEKRRLNSHGNVI  116



>gb|AAI02327.1| ERGIC and golgi 3 [Bos taurus]
Length=231

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K  DA+P+  E    KT  GA V+IV  ++M  LFL EL+YYLTT    ++ VD  RG+
Sbjct  7    LKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGD  66

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIVGTE  494
             L I+IN+ FP +PC  LS+DA+D++G+ ++D++ N++K RL +DG+ V +E
Sbjct  67   KLKININVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGFPVSSE  118



>ref|XP_005651581.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27037.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=327

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 75/121 (62%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            ++     A+ RAE HL+Q+T  GA+V+++G+++   LF +ELR Y T  ++  M+VD  R
Sbjct  4    KSFNRFSAYARAESHLVQRTYFGAIVTVLGVILAIVLFANELREYTTPFSIQTMSVDTSR  63

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVD----LDTNIWKLRLSRDGYIVG-TEY  497
               + ++ N ++PS+PC VLS+DA DMSG+   D     +  I K+RL+  G  +G  EY
Sbjct  64   AHYIRMNFNFTYPSMPCQVLSLDATDMSGEKSGDSGHAANGEIHKVRLNEAGEKIGLGEY  123

Query  498  L  500
            +
Sbjct  124  I  124



>gb|AFW82353.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=398

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            +K +DA+P+  E   ++T SG +V++V  V+M  LF+ E R Y  ++T  ++ VD  RGE
Sbjct  8    LKRLDAYPKVNEDFYKRTLSGGIVTLVAAVVMLLLFISETRSYFYSSTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L ++ +++FPS+PC +LSVD  D+SG+   D+  +I K RL+  G ++
Sbjct  68   RLRVNFDITFPSIPCTLLSVDTTDISGEQHHDIRHDIEKRRLNSHGNVI  116



>ref|XP_005839166.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
 gb|EKX52186.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
Length=425

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++  D +P+  +    +T +GA+VSI+G +IM  L L E+  YLT  T H+++VD  RGE
Sbjct  40   LREFDIYPKTIQDFQVRTLAGAVVSILGFLIMFVLILGEINLYLTIQTDHELSVDTSRGE  99

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
             L I+ N++F ++PC ++S+D +D+SG+  +D+   ++K RL  DG ++
Sbjct  100  KLQINFNITFHAMPCTIISLDTMDISGEQHIDVHHEVYKQRLDVDGNVI  148



>ref|XP_008790816.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Phoenix dactylifera]
Length=386

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG ++++V  +IM  LF+ ELR YL   T  ++ VD
Sbjct  3    GLLGKLRNLDAYPKINEDFYSRTLSGGVITVVSSIIMFLLFISELRLYLHAVTESKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K R+   G ++
Sbjct  63   TSRGETLRINFDVTFPALSCSMLSLDAMDISGEEHLDVRHDIIKTRIDSHGNVI  116



>ref|XP_010261264.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nelumbo nucifera]
Length=385

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M +   ++ +DA+P+  E    +T SG ++++V  V+M  LF+ ELR YL   T  ++ V
Sbjct  1    MDIFNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMLLLFISELRLYLHAVTETKLVV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDG  476
            D  RGETL I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K RL   G
Sbjct  61   DTSRGETLRINFDVTFPALSCSILSLDAMDISGEQHLDVRHDIIKKRLDSHG  112



>ref|XP_010690474.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Beta vulgaris subsp. vulgaris]
Length=386

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  QAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKR  332
            Q ++ +DA+P+  E   ++T SG +V++V  +IM  LF  EL  YL T T   + VD  R
Sbjct  7    QKLRDLDAYPKINEDFYKRTFSGGVVTLVSTIIMFFLFFFELTSYLHTVTETTLVVDTSR  66

Query  333  GETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            G TL I+ N++FP +PC +LSVDA D+SG+   D+  +I K R+   G ++
Sbjct  67   GGTLHINFNVTFPEIPCTILSVDAEDISGERHFDIRHDIVKTRVDAHGRMI  117



>gb|KJB59091.1| hypothetical protein B456_009G238700 [Gossypium raimondii]
Length=306

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  GVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVD  323
            G+   ++ +DA+P+  E    +T SG  +++V  V+M  LF  E+R YL      ++ VD
Sbjct  3    GLMNKLRHLDAYPKVNEDFYSRTLSGGFITLVSSVVMLLLFFSEIRLYLHPVVETKLVVD  62

Query  324  LKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
              RGETL I+ +++FP++ C +LS+DAID+SG+  +D+  +I K RL  +G ++
Sbjct  63   SSRGETLRINFDVTFPAIACSILSLDAIDISGEQHLDVKHDIVKERLGVNGNVI  116



>ref|XP_010269217.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Nelumbo nucifera]
Length=355

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  IKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAVDLKRGE  338
            ++ +DA+P+  E    +T SG ++++   ++M  LF+ E R+YL + T  ++ VD  RGE
Sbjct  8    LRNLDAYPKINEDFYSRTLSGGVITLASSIVMFFLFISEFRFYLHSVTETKLVVDTSRGE  67

Query  339  TLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            TL I+ +++FP+L C +LS+DA+D+SG+  +D+  +I K R+  +G ++
Sbjct  68   TLRINFDVTFPALACSILSLDAMDISGEQHLDVRHDIIKKRIDANGNVI  116



>ref|XP_008804336.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X3 [Phoenix dactylifera]
Length=339

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  MGVKQAIKAIDAFPRAEEHLLQKTKSGALVSIVGLVIMATLFLHELRYYLTTNTVHQMAV  320
            M +   +K +DA+P+  E    +T SG L++I+  +IM  LF+ E R Y+ + T  ++ V
Sbjct  1    MEILNKLKNLDAYPKINEDFYSRTLSGGLITIISSIIMLLLFISEARLYIYSETETKLIV  60

Query  321  DLKRGETLPIHINMSFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLSRDGYIV  485
            D  RGE L I+ +++FPSL C ++SVD +D+SG+   D+  +I K RL   G ++
Sbjct  61   DTSRGERLRINFDITFPSLSCSLVSVDTMDISGEQHYDIRHDIIKKRLDHSGNVI  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760