BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026K18

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620036.1|  PREDICTED: 40S ribosomal protein S5                259   2e-84   Nicotiana tomentosiformis
ref|XP_004250715.1|  PREDICTED: 40S ribosomal protein S5                258   1e-83   Solanum lycopersicum
ref|XP_011078788.1|  PREDICTED: 40S ribosomal protein S5                256   4e-83   Sesamum indicum [beniseed]
ref|XP_006363855.1|  PREDICTED: 40S ribosomal protein S5-like           254   2e-82   Solanum tuberosum [potatoes]
emb|CDP14297.1|  unnamed protein product                                252   1e-81   Coffea canephora [robusta coffee]
emb|CDP00895.1|  unnamed protein product                                251   3e-81   Coffea canephora [robusta coffee]
ref|XP_009606047.1|  PREDICTED: 40S ribosomal protein S5-like           250   8e-81   Nicotiana tomentosiformis
gb|EYU20673.1|  hypothetical protein MIMGU_mgv1a013814mg                246   4e-79   Erythranthe guttata [common monkey flower]
ref|XP_006362288.1|  PREDICTED: 40S ribosomal protein S5-like           245   5e-79   
ref|XP_004249155.1|  PREDICTED: 40S ribosomal protein S5                245   9e-79   Solanum lycopersicum
gb|AFW90603.1|  40S ribosomal protein S5                                245   1e-78   Solanum tuberosum [potatoes]
gb|AAR89617.1|  40S ribosomal protein S5                                244   3e-78   Capsicum annuum
gb|EYU22730.1|  hypothetical protein MIMGU_mgv1a013661mg                239   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_006481676.1|  PREDICTED: 40S ribosomal protein S5-2-like i...    229   1e-72   Citrus sinensis [apfelsine]
ref|XP_006429966.1|  hypothetical protein CICLE_v10012779mg             229   2e-72   Citrus clementina [clementine]
ref|XP_006429994.1|  hypothetical protein CICLE_v10012772mg             229   2e-72   Citrus clementina [clementine]
gb|KDO70778.1|  hypothetical protein CISIN_1g028585mg                   228   2e-72   Citrus sinensis [apfelsine]
ref|XP_010058569.1|  PREDICTED: 40S ribosomal protein S5                229   2e-72   Eucalyptus grandis [rose gum]
ref|XP_008447165.1|  PREDICTED: 40S ribosomal protein S5-like iso...    228   6e-72   Cucumis melo [Oriental melon]
ref|XP_008447164.1|  PREDICTED: 40S ribosomal protein S5-like iso...    228   6e-72   Cucumis melo [Oriental melon]
ref|XP_004139812.1|  PREDICTED: 40S ribosomal protein S5-1-like         227   8e-72   Cucumis sativus [cucumbers]
gb|AFK39266.1|  unknown                                                 227   9e-72   Lotus japonicus
ref|XP_008463640.1|  PREDICTED: 40S ribosomal protein S5                227   1e-71   Cucumis melo [Oriental melon]
ref|XP_010105084.1|  40S ribosomal protein S5                           226   1e-71   Morus notabilis
ref|XP_007149885.1|  hypothetical protein PHAVU_005G107000g             226   2e-71   Phaseolus vulgaris [French bean]
ref|XP_004139502.1|  PREDICTED: 40S ribosomal protein S5-1-like i...    226   2e-71   
ref|XP_008456864.1|  PREDICTED: 40S ribosomal protein S5-like           227   3e-71   Cucumis melo [Oriental melon]
ref|XP_004140419.1|  PREDICTED: 40S ribosomal protein S5-1-like i...    225   4e-71   Cucumis sativus [cucumbers]
ref|XP_004151715.1|  PREDICTED: 40S ribosomal protein S5-1-like         224   6e-71   
gb|AGV54378.1|  40S ribosomal protein S5-like protein                   225   7e-71   Phaseolus vulgaris [French bean]
ref|XP_002534312.1|  40S ribosomal protein S5, putative                 225   7e-71   Ricinus communis
ref|XP_007029135.1|  Ribosomal protein 5A                               224   1e-70   Theobroma cacao [chocolate]
ref|XP_008778205.1|  PREDICTED: 40S ribosomal protein S5-like           223   2e-70   Phoenix dactylifera
ref|XP_008391547.1|  PREDICTED: 40S ribosomal protein S5                224   2e-70   Malus domestica [apple tree]
ref|XP_003519018.1|  PREDICTED: 40S ribosomal protein S5-like           223   3e-70   Glycine max [soybeans]
ref|XP_008391999.1|  PREDICTED: 40S ribosomal protein S5                223   3e-70   Malus domestica [apple tree]
ref|XP_008387136.1|  PREDICTED: 40S ribosomal protein S5-like           223   3e-70   Malus domestica [apple tree]
ref|XP_007204730.1|  hypothetical protein PRUPE_ppa011341mg             223   3e-70   Prunus persica
gb|KGN64964.1|  40S ribosomal protein S5                                223   4e-70   Cucumis sativus [cucumbers]
ref|XP_009362661.1|  PREDICTED: 40S ribosomal protein S5-like           223   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_009379661.1|  PREDICTED: 40S ribosomal protein S5-like           223   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_010100501.1|  40S ribosomal protein S5                           223   4e-70   Morus notabilis
ref|XP_003533901.1|  PREDICTED: 40S ribosomal protein S5-like           223   4e-70   
ref|NP_001276300.1|  40S ribosomal protein S5-like                      223   4e-70   
ref|XP_006662936.1|  PREDICTED: 40S ribosomal protein S5-like           223   4e-70   Oryza brachyantha
ref|XP_008219748.1|  PREDICTED: 40S ribosomal protein S5                223   4e-70   Prunus mume [ume]
ref|XP_007223418.1|  hypothetical protein PRUPE_ppa011314mg             223   4e-70   Prunus persica
ref|XP_004303416.1|  PREDICTED: 40S ribosomal protein S5                223   4e-70   Fragaria vesca subsp. vesca
ref|XP_010464938.1|  PREDICTED: 40S ribosomal protein S5-2 isofor...    223   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008391548.1|  PREDICTED: 40S ribosomal protein S5                223   5e-70   Malus domestica [apple tree]
ref|XP_010908271.1|  PREDICTED: 40S ribosomal protein S5-like           222   6e-70   Elaeis guineensis
ref|XP_008359524.1|  PREDICTED: 40S ribosomal protein S5                222   6e-70   Malus domestica [apple tree]
ref|XP_009379663.1|  PREDICTED: 40S ribosomal protein S5-like           222   7e-70   Pyrus x bretschneideri [bai li]
ref|XP_009383828.1|  PREDICTED: 40S ribosomal protein S5                221   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778214.1|  PREDICTED: 40S ribosomal protein S5-like           221   9e-70   Phoenix dactylifera
ref|XP_009412721.1|  PREDICTED: 40S ribosomal protein S5-like           221   9e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010519996.1|  PREDICTED: 40S ribosomal protein S5-1-like         222   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_010557962.1|  PREDICTED: 40S ribosomal protein S5-1              222   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_006298557.1|  hypothetical protein CARUB_v10014641mg             222   1e-69   Capsella rubella
gb|KJB15005.1|  hypothetical protein B456_002G154300                    222   1e-69   Gossypium raimondii
ref|XP_002531594.1|  40S ribosomal protein S5, putative                 221   1e-69   
gb|ADR71287.1|  40S ribosomal protein S5B                               221   1e-69   Hevea brasiliensis [jebe]
ref|XP_008380691.1|  PREDICTED: 40S ribosomal protein S5-like           221   2e-69   Malus domestica [apple tree]
ref|NP_187800.1|  40S ribosomal protein S5A                             221   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|ADR71286.1|  40S ribosomal protein S5A                               221   2e-69   Hevea brasiliensis [jebe]
ref|XP_010910415.1|  PREDICTED: 40S ribosomal protein S5-like           221   2e-69   Elaeis guineensis
ref|XP_002281550.1|  PREDICTED: 40S ribosomal protein S5                221   2e-69   Vitis vinifera
ref|XP_004967892.1|  PREDICTED: 40S ribosomal protein S5-like           221   2e-69   Setaria italica
ref|XP_010534372.1|  PREDICTED: 40S ribosomal protein S5-1              221   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_010464937.1|  PREDICTED: 40S ribosomal protein S5-2 isofor...    221   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009385470.1|  PREDICTED: 40S ribosomal protein S5-like           220   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006481653.1|  PREDICTED: 40S ribosomal protein S5-like           221   2e-69   Citrus sinensis [apfelsine]
ref|XP_009121046.1|  PREDICTED: 40S ribosomal protein S5-1-like         221   2e-69   Brassica rapa
ref|XP_004290841.1|  PREDICTED: 40S ribosomal protein S5                221   3e-69   Fragaria vesca subsp. vesca
ref|XP_002266736.1|  PREDICTED: 40S ribosomal protein S5                220   3e-69   Vitis vinifera
ref|XP_009411843.1|  PREDICTED: 40S ribosomal protein S5-like           220   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257626.1|  PREDICTED: 40S ribosomal protein S5                220   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009348626.1|  PREDICTED: 40S ribosomal protein S5-like           221   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_009609310.1|  PREDICTED: 40S ribosomal protein S5-like           221   3e-69   
ref|XP_009141642.1|  PREDICTED: 40S ribosomal protein S5-1              220   4e-69   Brassica rapa
emb|CDY55439.1|  BnaA04g29230D                                          220   4e-69   Brassica napus [oilseed rape]
gb|ABK23207.1|  unknown                                                 220   4e-69   Picea sitchensis
ref|XP_008241140.1|  PREDICTED: 40S ribosomal protein S5-like           220   4e-69   Prunus mume [ume]
gb|KHG22024.1|  40S ribosomal S5                                        220   4e-69   Gossypium arboreum [tree cotton]
ref|XP_008792965.1|  PREDICTED: 40S ribosomal protein S5                220   4e-69   Phoenix dactylifera
ref|XP_007202555.1|  hypothetical protein PRUPE_ppa011243mg             221   4e-69   Prunus persica
ref|XP_010671292.1|  PREDICTED: 40S ribosomal protein S5                220   5e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001067900.1|  Os11g0482000                                       220   5e-69   
gb|KDP21916.1|  hypothetical protein JCGZ_03054                         220   5e-69   Jatropha curcas
ref|XP_008241141.1|  PREDICTED: 40S ribosomal protein S5-like           220   5e-69   Prunus mume [ume]
ref|XP_007145745.1|  hypothetical protein PHAVU_007G264200g             220   5e-69   Phaseolus vulgaris [French bean]
ref|XP_010498291.1|  PREDICTED: 40S ribosomal protein S5-2-like         220   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009135197.1|  PREDICTED: 40S ribosomal protein S5-1-like         219   7e-69   Brassica rapa
ref|XP_006858974.1|  hypothetical protein AMTR_s00068p00119380          219   9e-69   Amborella trichopoda
gb|KGN62801.1|  hypothetical protein Csa_2G373440                       222   9e-69   Cucumis sativus [cucumbers]
ref|XP_010516988.1|  PREDICTED: 40S ribosomal protein S5-1-like         219   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010276362.1|  PREDICTED: 40S ribosomal protein S5-like           218   1e-68   Nelumbo nucifera [Indian lotus]
gb|KHG01795.1|  40S ribosomal S5                                        219   1e-68   Gossypium arboreum [tree cotton]
gb|AAM66936.1|  40S ribosomal protein S5                                219   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351539.1|  PREDICTED: 40S ribosomal protein S5-like           223   2e-68   
ref|NP_181264.1|  40S ribosomal protein S5-1                            219   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|ACG24566.1|  40S ribosomal protein S5                                218   2e-68   Zea mays [maize]
ref|NP_001131862.1|  40S ribosomal protein S5                           218   2e-68   Zea mays [maize]
ref|XP_010486867.1|  PREDICTED: 40S ribosomal protein S5-2-like         218   2e-68   
pdb|3J60|F  Chain F, Localization Of The Small Subunit Ribosomal ...    218   2e-68   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001041738.1|  Os01g0100700                                       218   2e-68   
sp|O65731.1|RS5_CICAR  RecName: Full=40S ribosomal protein S5           218   2e-68   Cicer arietinum [garbanzo]
ref|XP_006294898.1|  hypothetical protein CARUB_v10023948mg             219   2e-68   
gb|KHG03307.1|  40S ribosomal S5                                        218   2e-68   Gossypium arboreum [tree cotton]
ref|XP_004486053.1|  PREDICTED: 40S ribosomal protein S5-like           218   3e-68   
ref|XP_009133144.1|  PREDICTED: 40S ribosomal protein S5-1-like         218   3e-68   Brassica rapa
gb|ACJ83953.1|  unknown                                                 218   3e-68   Medicago truncatula
ref|XP_004486054.1|  PREDICTED: 40S ribosomal protein S5-like           218   3e-68   Cicer arietinum [garbanzo]
ref|XP_010505306.1|  PREDICTED: 40S ribosomal protein S5-1-like         218   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006407392.1|  hypothetical protein EUTSA_v10021528mg             218   5e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006839043.1|  hypothetical protein AMTR_s00090p00050460          217   5e-68   Amborella trichopoda
gb|ACG24474.1|  40S ribosomal protein S5                                217   6e-68   Zea mays [maize]
ref|XP_001753712.1|  predicted protein                                  217   6e-68   
ref|XP_010509358.1|  PREDICTED: 40S ribosomal protein S5-1              217   6e-68   Camelina sativa [gold-of-pleasure]
gb|ACG48499.1|  40S ribosomal protein S5                                217   7e-68   Zea mays [maize]
ref|XP_006410908.1|  hypothetical protein EUTSA_v10017239mg             217   7e-68   
ref|XP_004504517.1|  PREDICTED: 40S ribosomal protein S5-like           216   1e-67   Cicer arietinum [garbanzo]
ref|XP_009777627.1|  PREDICTED: 40S ribosomal protein S5-like           215   2e-67   Nicotiana sylvestris
gb|KHN00016.1|  40S ribosomal protein S5                                216   2e-67   Glycine soja [wild soybean]
emb|CDX91349.1|  BnaC04g08010D                                          216   2e-67   
ref|XP_003568787.1|  PREDICTED: 40S ribosomal protein S5-like           216   2e-67   Brachypodium distachyon [annual false brome]
emb|CDM81323.1|  unnamed protein product                                215   3e-67   Triticum aestivum [Canadian hard winter wheat]
gb|KEH41731.1|  40S ribosomal protein S5-2                              216   3e-67   Medicago truncatula
gb|EMT07494.1|  40S ribosomal protein S5-1                              215   3e-67   
gb|KJB62023.1|  hypothetical protein B456_009G396400                    216   3e-67   Gossypium raimondii
ref|XP_004979230.1|  PREDICTED: 40S ribosomal protein S5-like           215   4e-67   Setaria italica
gb|AFK48366.1|  unknown                                                 215   4e-67   Medicago truncatula
gb|ACJ85959.1|  unknown                                                 215   5e-67   Medicago truncatula
gb|AFK40877.1|  unknown                                                 215   5e-67   Medicago truncatula
gb|KFK38559.1|  hypothetical protein AALP_AA3G129300                    215   5e-67   Arabis alpina [alpine rockcress]
ref|XP_002881500.1|  ATRPS5B                                            214   7e-67   
ref|XP_003638095.1|  40S ribosomal protein S5-1                         213   7e-67   
ref|XP_003638103.1|  40S ribosomal protein S5-1                         213   7e-67   
ref|XP_006481856.1|  PREDICTED: 40S ribosomal protein S5-like           215   8e-67   Citrus sinensis [apfelsine]
ref|NP_001235614.1|  uncharacterized protein LOC100499758               214   9e-67   Glycine max [soybeans]
ref|XP_009770521.1|  PREDICTED: 40S ribosomal protein S5-2-like         211   1e-66   Nicotiana sylvestris
ref|XP_003578829.1|  PREDICTED: 40S ribosomal protein S5                213   1e-66   Brachypodium distachyon [annual false brome]
ref|NP_001238419.1|  uncharacterized protein LOC100305898               213   2e-66   
ref|XP_003638089.1|  40S ribosomal protein S5                           214   3e-66   
dbj|BAJ86032.1|  predicted protein                                      213   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEF98549.1|  Ribosomal protein S5/S7, eukaryotic/archaeal           212   4e-66   Ostreococcus tauri
ref|XP_011047107.1|  PREDICTED: 40S ribosomal protein S5-like           211   2e-65   Populus euphratica
ref|XP_002322748.2|  40S ribosomal protein S5                           210   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_011039529.1|  PREDICTED: 40S ribosomal protein S5 isoform X1     210   3e-65   Populus euphratica
ref|XP_011039530.1|  PREDICTED: 40S ribosomal protein S5 isoform X2     210   4e-65   Populus euphratica
ref|XP_002309278.1|  40S ribosomal protein S5-2                         210   5e-65   Populus trichocarpa [western balsam poplar]
ref|XP_003062276.1|  predicted protein                                  208   2e-64   Micromonas pusilla CCMP1545
ref|XP_001418582.1|  Ribosomal protein S5, component of cytosolic...    208   2e-64   Ostreococcus lucimarinus CCE9901
ref|XP_002982486.1|  hypothetical protein SELMODRAFT_228853             208   2e-64   Selaginella moellendorffii
ref|XP_002981007.1|  hypothetical protein SELMODRAFT_271466             207   3e-64   Selaginella moellendorffii
ref|XP_002501578.1|  predicted protein                                  206   6e-64   Micromonas commoda
ref|XP_011095643.1|  PREDICTED: 40S ribosomal protein S5-like           205   9e-64   
ref|XP_002961831.1|  hypothetical protein SELMODRAFT_164593             206   2e-63   Selaginella moellendorffii
gb|KFH70431.1|  40S ribosomal protein S5                                203   2e-62   Mortierella verticillata NRRL 6337
ref|XP_005648374.1|  ribosomal protein S5 component of cytosolic ...    203   2e-62   Coccomyxa subellipsoidea C-169
ref|XP_002946634.1|  component of cytosolic 80S ribosome and 40S ...    202   2e-62   Volvox carteri f. nagariensis
gb|ERZ98087.1|  hypothetical protein GLOINDRAFT_289070                  202   4e-62   
ref|XP_005704631.1|  40S ribosomal protein S5e                          201   5e-62   Galdieria sulphuraria
ref|XP_001695400.1|  ribosomal protein S5, component of cytosolic...    201   6e-62   Chlamydomonas reinhardtii
gb|EXX60100.1|  ribosomal 40S subunit protein S5                        201   9e-62   Rhizophagus irregularis DAOM 197198w
gb|EPS72966.1|  hypothetical protein M569_01791                         197   1e-61   Genlisea aurea
gb|KHN04278.1|  40S ribosomal protein S5                                201   1e-61   Glycine soja [wild soybean]
gb|EWC43427.1|  40S ribosomal protein S5                                202   1e-61   Drechslerella stenobrocha 248
gb|KJB28207.1|  hypothetical protein B456_005G034200                    198   2e-61   Gossypium raimondii
ref|XP_006678213.1|  hypothetical protein BATDEDRAFT_87732              201   2e-61   Batrachochytrium dendrobatidis JAM81
ref|XP_008350249.1|  PREDICTED: 40S ribosomal protein S5                200   2e-61   
ref|XP_001909825.1|  hypothetical protein                               200   3e-61   Podospora anserina S mat+
emb|CAJ45370.1|  40S ribosomal protein S5                               199   5e-61   Chlamydomonas sp. ICE-L
gb|AAP80699.1|  40S ribosome protein S5                                 199   6e-61   Griffithsia japonica
gb|ABK93154.1|  unknown                                                 197   7e-61   Populus trichocarpa [western balsam poplar]
gb|KJB16490.1|  hypothetical protein B456_002G232600                    199   8e-61   Gossypium raimondii
ref|XP_011396407.1|  40S ribosomal protein S5-2                         198   1e-60   Auxenochlorella protothecoides
ref|XP_004351577.1|  ribosomal protein S7p/S5e, putative                198   1e-60   Acanthamoeba castellanii str. Neff
ref|XP_005712066.1|  unnamed protein product                            200   2e-60   Chondrus crispus [carageen]
ref|XP_963230.2|  40s ribosomal protein s5                              198   2e-60   Neurospora crassa OR74A
gb|KHG10064.1|  40S ribosomal S5                                        198   2e-60   Gossypium arboreum [tree cotton]
emb|CCJ30839.1|  unnamed protein product                                197   3e-60   Pneumocystis jirovecii
ref|XP_005539558.1|  40S ribosomal protein S5                           197   3e-60   Cyanidioschyzon merolae strain 10D
ref|XP_001228475.1|  40S ribosomal protein S5                           197   4e-60   Chaetomium globosum CBS 148.51
ref|XP_002109401.1|  40S ribosomal protein S5                           197   5e-60   Trichoplax adhaerens
gb|KDD76112.1|  ribosomal protein S7p/S5e                               196   6e-60   Helicosporidium sp. ATCC 50920
ref|XP_003667290.1|  hypothetical protein MYCTH_2312962                 196   9e-60   Thermothelomyces thermophila ATCC 42464
ref|XP_505167.1|  40S ribosomal protein S5                              196   1e-59   Yarrowia lipolytica CLIB122
gb|ACI23255.1|  ribosomal protein S5                                    196   1e-59   
ref|XP_003351162.1|  40S ribosomal protein S5                           196   1e-59   Sordaria macrospora k-hell
ref|XP_001389720.1|  40S ribosomal protein S5                           196   2e-59   Aspergillus niger CBS 513.88
ref|XP_011108201.1|  hypothetical protein H072_2214                     197   2e-59   
ref|XP_003658186.1|  40S ribosomal protein S5                           196   2e-59   Thielavia terrestris NRRL 8126
ref|XP_002430077.1|  40S ribosomal protein S5, putative                 196   2e-59   Pediculus humanus corporis [human body lice]
ref|XP_006692042.1|  40S ribosomal protein s5-like protein              196   2e-59   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_002844558.1|  40S ribosomal protein S5                           196   2e-59   Microsporum canis CBS 113480
ref|XP_009159509.1|  40S ribosomal protein S5                           196   2e-59   Exophiala dermatitidis NIH/UT8656
emb|CDS08967.1|  Putative 40S ribosomal protein S5                      195   2e-59   Lichtheimia ramosa
gb|KDR08378.1|  40S ribosomal protein S5a                               196   2e-59   Zootermopsis nevadensis
ref|XP_011152199.1|  PREDICTED: 40S ribosomal protein S5                196   2e-59   Harpegnathos saltator
gb|KDR18597.1|  40S ribosomal protein S5a                               196   2e-59   Zootermopsis nevadensis
gb|KIX02490.1|  40S ribosomal protein S5                                196   2e-59   Rhinocladiella mackenziei CBS 650.93
ref|NP_001264173.1|  40S ribosomal protein S5 isoform 2                 194   2e-59   Rattus norvegicus [brown rat]
emb|CDS02852.1|  Putative 40S ribosomal protein S5                      195   2e-59   Lichtheimia ramosa
ref|XP_011151778.1|  PREDICTED: 40S ribosomal protein S5-like           196   3e-59   Harpegnathos saltator
emb|CDS13855.1|  Putative 40S ribosomal protein S5                      195   3e-59   Lichtheimia ramosa
ref|XP_011169142.1|  PREDICTED: 40S ribosomal protein S5                195   3e-59   Solenopsis invicta [imported red fire ant]
ref|XP_007648302.1|  PREDICTED: 40S ribosomal protein S5 isoform X1     195   3e-59   Cricetulus griseus [Chinese hamsters]
gb|KIV89485.1|  40S ribosomal protein S5                                195   3e-59   Exophiala mesophila
ref|XP_011266719.1|  PREDICTED: 40S ribosomal protein S5                195   4e-59   Camponotus floridanus
ref|XP_011052375.1|  PREDICTED: 40S ribosomal protein S5                195   4e-59   Acromyrmex echinatior
ref|XP_003696661.1|  PREDICTED: 40S ribosomal protein S5-like           195   4e-59   
emb|CAH04316.1|  S5e ribosomal protein                                  194   4e-59   Dascillus cervinus
gb|KHE83352.1|  hypothetical protein GE21DRAFT_3745                     195   4e-59   Neurospora crassa
gb|EYE99010.1|  putative 40S ribosomal protein S5                       195   5e-59   Aspergillus ruber CBS 135680
ref|XP_005312284.1|  PREDICTED: 40S ribosomal protein S5                194   5e-59   Chrysemys picta bellii
ref|XP_003969321.1|  PREDICTED: 40S ribosomal protein S5-like           194   5e-59   Takifugu rubripes [tiger puffer]
ref|NP_001264172.1|  40S ribosomal protein S5 isoform 1                 194   5e-59   Rattus norvegicus [brown rat]
ref|NP_001000.2|  40S ribosomal protein S5                              194   5e-59   Homo sapiens [man]
ref|NP_033121.2|  40S ribosomal protein S5                              194   5e-59   Mus musculus [mouse]
ref|XP_011331368.1|  PREDICTED: 40S ribosomal protein S5-like           195   5e-59   Ooceraea biroi
ref|XP_010855936.1|  PREDICTED: 40S ribosomal protein S5                194   5e-59   Bison bison bison
ref|XP_001210932.1|  40S ribosomal protein S5                           195   5e-59   Aspergillus terreus NIH2624
ref|XP_008159315.1|  PREDICTED: 40S ribosomal protein S5                194   5e-59   Eptesicus fuscus
sp|P97461.3|RS5_MOUSE  RecName: Full=40S ribosomal protein S5; Co...    194   5e-59   Mus musculus [mouse]
gb|AAX43400.1|  ribosomal protein S5                                    194   5e-59   synthetic construct
ref|XP_007722583.1|  40S ribosomal protein S5                           194   5e-59   Capronia coronata CBS 617.96
ref|XP_004647791.1|  PREDICTED: 40S ribosomal protein S5                194   5e-59   Octodon degus
ref|XP_003491320.1|  PREDICTED: 40S ribosomal protein S5a-like          194   5e-59   Bombus impatiens
ref|XP_007955198.1|  PREDICTED: 40S ribosomal protein S5                194   5e-59   Orycteropus afer afer
ref|XP_003707267.1|  PREDICTED: 40S ribosomal protein S5a-like          194   5e-59   Megachile rotundata
ref|XP_010271573.1|  PREDICTED: 40S ribosomal protein S5-like           194   6e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007062326.1|  PREDICTED: 40S ribosomal protein S5-like           194   6e-59   Chelonia mydas [green seaturtle]
dbj|BAJ94184.1|  predicted protein                                      194   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACD65097.1|  putative 40S ribosomal protein RPS5                     192   6e-59   Novocrania anomala
ref|XP_005431414.1|  PREDICTED: 40S ribosomal protein S5-like           194   6e-59   Geospiza fortis
dbj|BAD96826.1|  ribosomal protein S5 variant                           194   6e-59   Homo sapiens [man]
ref|XP_007799008.1|  putative 40s ribosomal protein s5 protein          194   6e-59   
ref|XP_005234126.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    194   7e-59   Falco peregrinus [peregrine]
gb|KIW48463.1|  40S ribosomal protein S5                                194   7e-59   Exophiala oligosperma
ref|XP_007508472.1|  40S ribosomal protein S5                           194   7e-59   Bathycoccus prasinos
ref|XP_003171002.1|  40S ribosomal protein S5                           194   8e-59   Nannizzia gypsea CBS 118893
gb|EMP33494.1|  40S ribosomal protein S5                                194   8e-59   Chelonia mydas [green seaturtle]
ref|XP_006759039.1|  PREDICTED: 40S ribosomal protein S5                193   8e-59   Myotis davidii
ref|XP_008616084.1|  40S ribosomal protein S5                           193   8e-59   Saprolegnia diclina VS20
ref|XP_002373376.1|  40S ribosomal protein S5                           194   8e-59   Aspergillus flavus NRRL3357
ref|XP_011313627.1|  PREDICTED: 40S ribosomal protein S5                194   9e-59   Fopius arisanus
ref|XP_006877391.1|  PREDICTED: 40S ribosomal protein S5-like           194   9e-59   Chrysochloris asiatica
ref|XP_005838790.1|  small subunit ribosomal protein S5e, cytopla...    193   9e-59   Guillardia theta CCMP2712
gb|EPY90091.1|  40S ribosomal protein S5-like protein                   194   9e-59   Camelus ferus
ref|XP_009144114.1|  PREDICTED: 40S ribosomal protein S5                193   1e-58   Brassica rapa
gb|KIM96434.1|  hypothetical protein OIDMADRAFT_205099                  194   1e-58   Oidiodendron maius Zn
gb|ELV11462.1|  40S ribosomal protein S5                                195   1e-58   Tupaia chinensis
ref|XP_006903089.1|  PREDICTED: 40S ribosomal protein S5-like           193   1e-58   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001279878.1|  ribosomal protein S5                               193   1e-58   Callorhinchus milii [Australian ghost shark]
ref|XP_004888379.1|  PREDICTED: 40S ribosomal protein S5-like iso...    194   1e-58   
ref|XP_003011889.1|  hypothetical protein ARB_01869                     194   1e-58   Trichophyton benhamiae CBS 112371
gb|ABZ04257.1|  ribosomal protein rps5                                  193   1e-58   Lineus viridis
gb|AGH70189.1|  40S ribosomal protein S5                                192   1e-58   Placozoa sp. H4
gb|EPE07553.1|  40s ribosomal protein s5                                194   1e-58   Ophiostoma piceae UAMH 11346
gb|KFO36449.1|  40S ribosomal protein S5                                194   1e-58   Fukomys damarensis [Damara mole rat]
ref|XP_005534444.1|  PREDICTED: 40S ribosomal protein S5-like           192   1e-58   
emb|CBJ48704.1|  conserved unknown protein                              194   2e-58   Ectocarpus siliculosus
ref|XP_008329432.1|  PREDICTED: 40S ribosomal protein S5                193   2e-58   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001264255.1|  40S ribosomal protein S5                           193   2e-58   Aspergillus fischeri NRRL 181
ref|XP_007835576.1|  40S ribosomal protein S5                           193   2e-58   Pestalotiopsis fici W106-1
ref|XP_004073824.1|  PREDICTED: 40S ribosomal protein S5                193   2e-58   
ref|XP_011124500.1|  hypothetical protein AOL_s00097g365                193   2e-58   Arthrobotrys oligospora ATCC 24927
ref|XP_011343302.1|  PREDICTED: 40S ribosomal protein S5                193   2e-58   
ref|XP_010385257.1|  PREDICTED: 40S ribosomal protein S5                194   2e-58   Rhinopithecus roxellana
gb|KIW19762.1|  40S ribosomal protein S5                                193   2e-58   Exophiala spinifera
gb|ABJ98603.1|  40S ribosomal protein S5                                191   2e-58   Scophthalmus maximus
gb|AAP20199.1|  40S ribosomal protein S5                                192   2e-58   Pagrus major [red tail]
gb|ACO57597.1|  40S ribosomal protein S5                                192   2e-58   Gillichthys mirabilis
emb|CDH58049.1|  40s ribosomal protein s5                               192   2e-58   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001187070.1|  40S ribosomal protein S5                           192   2e-58   Ictalurus punctatus
ref|XP_003452472.1|  PREDICTED: 40S ribosomal protein S5-like           192   2e-58   Oreochromis niloticus
ref|XP_005796481.1|  PREDICTED: 40S ribosomal protein S5-like           192   2e-58   Xiphophorus maculatus
gb|AFM87973.1|  ribosomal protein S5                                    192   2e-58   Callorhinchus milii [Australian ghost shark]
emb|CAH04317.1|  S5e ribosomal protein                                  193   2e-58   
gb|ADN83482.1|  ribosomal protein S5                                    192   2e-58   
ref|XP_003709365.1|  40S ribosomal protein S5                           193   2e-58   
ref|XP_011502376.1|  PREDICTED: 40S ribosomal protein S5                193   3e-58   
ref|XP_005998177.1|  PREDICTED: 40S ribosomal protein S5-like           192   3e-58   
ref|XP_009098628.1|  PREDICTED: 40S ribosomal protein S5                193   3e-58   
ref|XP_967571.1|  PREDICTED: 40S ribosomal protein S5                   192   3e-58   
ref|XP_007910436.1|  PREDICTED: 40S ribosomal protein S5                193   3e-58   
ref|XP_001599075.1|  PREDICTED: 40S ribosomal protein S5                192   3e-58   
ref|XP_009227207.1|  40S ribosomal protein S5                           192   3e-58   
ref|XP_006429991.1|  hypothetical protein CICLE_v10013690mg             191   3e-58   
ref|XP_006262901.1|  PREDICTED: 40S ribosomal protein S5-like           192   3e-58   
ref|NP_001079800.1|  ribosomal protein S5                               192   3e-58   
ref|XP_004866613.1|  PREDICTED: 40S ribosomal protein S5 isoform X3     193   3e-58   
gb|KIH89199.1|  small subunit ribosomal protein S5e                     192   3e-58   
ref|XP_009231542.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    192   4e-58   
ref|XP_003217928.1|  PREDICTED: 40S ribosomal protein S5                192   4e-58   
ref|XP_007758093.1|  40S ribosomal protein S5                           192   4e-58   
ref|XP_001268752.1|  40S ribosomal protein S5                           192   4e-58   
gb|KIW55864.1|  40S ribosomal protein S5                                192   4e-58   
gb|ENN76674.1|  hypothetical protein YQE_06740                          192   4e-58   
gb|KEF61846.1|  40S ribosomal protein S5                                192   4e-58   
emb|CDH53759.1|  40s ribosomal protein s5                               192   5e-58   
ref|XP_003395376.1|  PREDICTED: 40S ribosomal protein S5                194   5e-58   
ref|XP_007427823.1|  PREDICTED: 40S ribosomal protein S5                192   5e-58   
gb|EFX06569.1|  40S ribosomal protein s5                                192   5e-58   
ref|XP_004405742.1|  PREDICTED: 40S ribosomal protein S5 isoform 1      193   5e-58   
gb|ELK18822.1|  40S ribosomal protein S5                                193   5e-58   
ref|XP_002582363.1|  40S ribosomal protein S5                           191   5e-58   
ref|XP_009481979.1|  PREDICTED: 40S ribosomal protein S5                191   5e-58   
gb|ADV03032.1|  ribosomal protein S5                                    191   5e-58   
ref|XP_007873185.1|  hypothetical protein PNEG_01262                    192   5e-58   
ref|XP_003855038.1|  40S ribosomal protein S5                           192   5e-58   
gb|ACQ58953.1|  40S ribosomal protein S5                                192   5e-58   
ref|NP_001153991.1|  40S ribosomal protein S5                           192   6e-58   
gb|AEE62411.1|  unknown                                                 192   6e-58   
gb|ADN83531.1|  ribosomal protein S5                                    191   6e-58   
emb|CCG83459.1|  putative 40S ribosomal protein S5                      192   6e-58   
ref|XP_007239777.1|  PREDICTED: 40S ribosomal protein S5-like           192   6e-58   
gb|AFR77444.1|  ribosomal protein S5                                    191   6e-58   
ref|XP_007735408.1|  40S ribosomal protein S5                           192   6e-58   
gb|ADX97209.1|  40S ribosomal protein s5                                191   6e-58   
ref|XP_009465409.1|  PREDICTED: 40S ribosomal protein S5                192   6e-58   
ref|XP_001639298.1|  predicted protein                                  192   7e-58   
gb|AFN84873.1|  ribosomal protein S5                                    191   7e-58   
ref|XP_003068863.1|  40S ribosomal protein S5                           192   7e-58   
gb|ERS96585.1|  40S ribosomal protein S5                                191   8e-58   
ref|XP_001243864.1|  40S ribosomal protein S5                           191   9e-58   
gb|ACD65138.1|  putative 40S ribosomal protein RPS5                     191   9e-58   
tpe|CBF88674.1|  TPA: hypothetical protein similar to ribosomal p...    191   9e-58   
gb|AFN84874.1|  ribosomal protein S5                                    191   9e-58   
gb|AEY63312.1|  ribosomal protein S5                                    191   1e-57   
ref|XP_009018646.1|  hypothetical protein HELRODRAFT_185659             191   1e-57   
ref|NP_001016992.1|  ribosomal protein S5                               191   1e-57   
ref|XP_005843972.1|  40S ribosomal protein S5                           191   1e-57   
gb|ADN83441.1|  ribosomal protein S5                                    191   1e-57   
emb|CDQ68967.1|  unnamed protein product                                192   1e-57   
emb|CCI41968.1|  unnamed protein product                                191   1e-57   
ref|NP_001291022.1|  40S ribosomal protein S5                           191   1e-57   
gb|ACY71282.1|  ribosomal protein S5                                    191   1e-57   
ref|XP_008543417.1|  PREDICTED: 40S ribosomal protein S5                191   1e-57   
gb|KFY53266.1|  hypothetical protein V496_07747                         191   1e-57   
ref|XP_008879809.1|  40S ribosomal protein                              190   1e-57   
ref|XP_008184848.1|  PREDICTED: 40S ribosomal protein S5                191   1e-57   
emb|CCF75802.1|  unnamed protein product                                190   1e-57   
ref|XP_004483296.1|  PREDICTED: 40S ribosomal protein S5-like iso...    191   2e-57   
gb|AFQ55348.1|  ribosomal protein S5                                    190   2e-57   
ref|XP_004087303.1|  PREDICTED: 40S ribosomal protein S5-like           191   2e-57   
ref|NP_001284621.1|  40S ribosomal protein S5                           191   2e-57   
gb|ACI68452.1|  40S ribosomal protein S5                                190   2e-57   
gb|ACI68342.1|  40S ribosomal protein S5                                190   2e-57   
ref|XP_002366763.1|  40S ribosomal protein S5, putative                 190   2e-57   
gb|AIE11743.1|  ribosomal protein S5                                    189   2e-57   
ref|XP_007918245.1|  putative 40s ribosomal protein s5 protein          191   2e-57   
gb|EFX68204.1|  hypothetical protein DAPPUDRAFT_301516                  190   2e-57   
ref|NP_001280446.1|  40S ribosomal protein S5                           191   2e-57   
gb|AGS31932.1|  ribosomal protein S5                                    190   2e-57   
gb|KEQ97425.1|  hypothetical protein AUEXF2481DRAFT_63653               190   2e-57   
gb|ADN83662.1|  ribosomal protein S5                                    189   2e-57   
gb|AAX62424.1|  ribosomal protein S5 isoform A                          191   2e-57   
gb|AEL87481.1|  ribosomal protein S5                                    187   2e-57   
gb|AAH59443.1|  Ribosomal protein S5                                    190   2e-57   
gb|AAN77889.1|  ribosomal protein S5                                    189   2e-57   
emb|CEG66610.1|  Putative 40S ribosomal protein S5                      190   3e-57   
gb|ADN83471.1|  ribosomal protein S5                                    190   3e-57   
gb|KGK39097.1|  hypothetical protein JL09_g1716                         191   3e-57   
ref|XP_007804307.1|  40S ribosomal protein S5                           190   3e-57   
gb|AEI26616.1|  ribosomal protein S5                                    189   3e-57   
ref|NP_775339.1|  40S ribosomal protein S5                              190   3e-57   
gb|KFY29057.1|  hypothetical protein V493_02579                         190   3e-57   
gb|ELR02883.1|  40S ribosomal protein S5                                190   3e-57   
gb|AIS93629.1|  ribosomal protein S5                                    190   3e-57   
emb|CEG65376.1|  Putative 40S ribosomal protein S5                      189   3e-57   
ref|NP_001038898.2|  ribosomal protein S5-like                          190   3e-57   
emb|CCA24195.1|  40S ribosomal protein S52 putative                     189   3e-57   
gb|AAX62467.1|  ribosomal protein S5 isoform A                          190   3e-57   
gb|ACZ27665.1|  ribosomal protein S5                                    189   3e-57   
gb|AEL87515.1|  ribosomal protein S5                                    189   3e-57   
gb|AFC61591.1|  ribosomal protein S5                                    189   4e-57   
gb|AAA85658.1|  ribosomal protein S5                                    189   4e-57   
ref|XP_004349841.2|  ribosomal protein S5 isoform A                     189   4e-57   
gb|AHB18326.1|  ribosomal protein S5                                    190   4e-57   
gb|AAX48881.1|  S5                                                      189   4e-57   
gb|AEI26603.1|  ribosomal protein S5                                    189   4e-57   
gb|ADN83470.1|  ribosomal protein S5                                    189   4e-57   
gb|EME47528.1|  hypothetical protein DOTSEDRAFT_124240                  190   4e-57   
gb|AEI26687.1|  ribosomal protein S5                                    189   4e-57   
gb|KIW66980.1|  40S ribosomal protein S5                                190   4e-57   
gb|KFX93173.1|  hypothetical protein V490_04961                         190   4e-57   
gb|ADN83574.1|  ribosomal protein S5                                    189   4e-57   
ref|XP_008079915.1|  Ribosomal protein S7                               190   4e-57   
gb|AFC61629.1|  ribosomal protein S5                                    189   4e-57   
gb|AEI26670.1|  ribosomal protein S5                                    189   4e-57   
gb|AHC03281.1|  ribosomal protein subunit 5                             187   4e-57   
gb|ADN83661.1|  ribosomal protein S5                                    189   4e-57   
gb|AFQ55355.1|  ribosomal protein S5                                    189   4e-57   
emb|CCJ37574.1|  ribosomal protein 5S                                   189   5e-57   
gb|AEL87504.1|  ribosomal protein S5                                    189   5e-57   
gb|ADN83485.1|  ribosomal protein S5                                    189   5e-57   
gb|AHB18324.1|  ribosomal protein S5                                    188   5e-57   
gb|ACV44099.1|  ribosomal protein S5                                    189   5e-57   
gb|AHB18321.1|  ribosomal protein S5                                    187   5e-57   
emb|CCJ37580.1|  ribosomal protein 5S                                   189   5e-57   
gb|AEI26635.1|  ribosomal protein S5                                    189   5e-57   
gb|AIK19686.1|  ribosomal protein S5                                    188   5e-57   
gb|AFC00909.1|  ribosomal protein S5                                    189   5e-57   
gb|ABX57199.1|  ribosomal protein S5                                    189   5e-57   
gb|AGV00222.1|  ribosomal protein S5                                    189   5e-57   
gb|EPQ67600.1|  Protein component of the small (40S) ribosomal su...    189   5e-57   
gb|AEY63354.1|  ribosomal protein S5                                    189   5e-57   
gb|AFR77481.1|  ribosomal protein S5                                    189   5e-57   
gb|ADD52811.1|  ribosomal protein S5                                    189   5e-57   
gb|ABX57223.1|  ribosomal protein S5                                    189   5e-57   
gb|ADD52833.1|  ribosomal protein S5                                    189   5e-57   
gb|AFQ55371.1|  ribosomal protein S5                                    189   5e-57   
gb|AGV00231.1|  ribosomal protein S5                                    189   5e-57   
gb|ADN83592.1|  ribosomal protein S5                                    189   6e-57   
gb|ADN83532.1|  ribosomal protein S5                                    188   6e-57   
gb|AEP68701.1|  ribosomal protein S5                                    188   6e-57   
gb|AFC00911.1|  ribosomal protein S5                                    189   6e-57   
gb|AFC61688.1|  ribosomal protein S5                                    188   6e-57   
gb|AEI26623.1|  ribosomal protein S5                                    188   6e-57   
gb|AFQ55367.1|  ribosomal protein S5                                    189   6e-57   
gb|ADX62602.1|  ribosomal protein S5                                    189   6e-57   
gb|AFC61673.1|  ribosomal protein S5                                    188   6e-57   
gb|AFC61604.1|  ribosomal protein S5                                    189   6e-57   
gb|ADX62658.1|  ribosomal protein S5                                    189   6e-57   
ref|XP_007680500.1|  hypothetical protein BAUCODRAFT_78213              189   6e-57   
gb|ADX62632.1|  ribosomal protein S5                                    189   6e-57   
sp|P24050.3|RS5_RAT  RecName: Full=40S ribosomal protein S5; Cont...    189   6e-57   
gb|ADN83583.1|  ribosomal protein S5                                    188   6e-57   
gb|ABX75493.1|  40S ribosomal protein S5                                189   6e-57   
gb|ADM87875.1|  ribosomal protein S5                                    188   6e-57   
ref|XP_001542259.1|  40S ribosomal protein S5                           189   6e-57   
gb|AFR77453.1|  ribosomal protein S5                                    189   6e-57   
gb|AFC61671.1|  ribosomal protein S5                                    188   6e-57   
gb|AEP68700.1|  ribosomal protein S5                                    187   6e-57   
gb|ADM87830.1|  ribosomal protein S5                                    188   6e-57   
gb|ADN83666.1|  ribosomal protein S5                                    189   6e-57   
ref|XP_002569294.1|  Pc21g23270                                         189   6e-57   
gb|AEI26598.1|  ribosomal protein S5                                    188   6e-57   
gb|AEL87471.1|  ribosomal protein S5                                    189   6e-57   
gb|AEP02976.1|  ribosomal protein S5                                    188   6e-57   
gb|AAV66412.1|  ribosomal protein S5                                    187   6e-57   
ref|XP_003881991.1|  hypothetical protein NCLIV_017500                  188   7e-57   
gb|AFC61624.1|  ribosomal protein S5                                    188   7e-57   
gb|AFC61649.1|  ribosomal protein S5                                    188   7e-57   
gb|ACZ27707.1|  ribosomal protein S5                                    188   7e-57   
gb|AHG50726.1|  ribosomal protein S5                                    189   7e-57   
gb|ADN83416.1|  ribosomal protein S5                                    189   7e-57   
gb|ACB69681.1|  ribosomal protein S5                                    188   7e-57   
gb|ADN83421.1|  ribosomal protein S5                                    189   7e-57   
gb|ADX62646.1|  ribosomal protein S5                                    188   7e-57   
gb|AFC00912.1|  ribosomal protein S5                                    188   7e-57   
gb|ADN83582.1|  ribosomal protein S5                                    189   7e-57   
gb|AEP68697.1|  ribosomal protein S5                                    187   7e-57   
gb|AFC00901.1|  ribosomal protein S5                                    188   7e-57   
emb|CCJ37602.1|  ribosomal protein 5S                                   188   7e-57   
gb|ADN83625.1|  ribosomal protein S5                                    188   7e-57   
gb|AHA91570.1|  ribosomal protein S5                                    189   7e-57   
gb|ACZ27740.1|  ribosomal protein S5                                    188   7e-57   
gb|ADX62665.1|  ribosomal protein S5                                    188   7e-57   
emb|CCJ37605.1|  ribosomal protein 5S                                   188   7e-57   
gb|AEY63308.1|  ribosomal protein S5                                    188   7e-57   
gb|ADX62666.1|  ribosomal protein S5                                    188   7e-57   
gb|ACZ27679.1|  ribosomal protein S5                                    189   7e-57   
gb|AEP68685.1|  ribosomal protein S5                                    187   7e-57   
gb|ADX62664.1|  ribosomal protein S5                                    188   7e-57   
gb|AEJ22681.1|  ribosomal protein S5                                    189   7e-57   
gb|AFC00913.1|  ribosomal protein S5                                    188   7e-57   
ref|XP_007777493.1|  40S ribosomal protein S5                           189   7e-57   
gb|AEY63359.1|  ribosomal protein S5                                    188   7e-57   
gb|AEL87476.1|  ribosomal protein S5                                    188   7e-57   
gb|ACZ27658.1|  ribosomal protein S5                                    189   7e-57   
gb|ABX57253.1|  ribosomal protein S5                                    188   8e-57   
gb|AFC00904.1|  ribosomal protein S5                                    188   8e-57   
gb|ADN83645.1|  ribosomal protein S5                                    189   8e-57   
gb|ADN83547.1|  ribosomal protein S5                                    189   8e-57   
gb|ADN83580.1|  ribosomal protein S5                                    188   8e-57   
gb|AFQ55362.1|  ribosomal protein S5                                    189   8e-57   
gb|AEP68695.1|  ribosomal protein S5                                    187   8e-57   
gb|AFR77429.1|  ribosomal protein S5                                    189   8e-57   
gb|AEP68707.1|  ribosomal protein S5                                    187   8e-57   
gb|ADN83518.1|  ribosomal protein S5                                    188   8e-57   
gb|AFC61691.1|  ribosomal protein S5                                    188   8e-57   
gb|ADN83533.1|  ribosomal protein S5                                    189   8e-57   
gb|AEY63328.1|  ribosomal protein S5                                    188   8e-57   
gb|AGC24651.1|  ribosomal protein S5                                    189   8e-57   
gb|ADX62635.1|  ribosomal protein S5                                    188   8e-57   
gb|ADN83602.1|  ribosomal protein S5                                    188   8e-57   
gb|AFC61616.1|  ribosomal protein S5                                    189   8e-57   
gb|ADX62593.1|  ribosomal protein S5                                    189   8e-57   
gb|ACV44155.1|  ribosomal protein S5                                    187   8e-57   
gb|ADN83462.1|  ribosomal protein S5                                    188   8e-57   
gb|AFR77465.1|  ribosomal protein S5                                    188   8e-57   
gb|AGC24639.1|  ribosomal protein S5                                    188   8e-57   
gb|AFN84871.1|  ribosomal protein S5                                    188   8e-57   
gb|AEY63315.1|  ribosomal protein S5                                    189   8e-57   
gb|AFQ55349.1|  ribosomal protein S5                                    188   8e-57   
gb|AEI26626.1|  ribosomal protein S5                                    188   8e-57   
gb|AEP68686.1|  ribosomal protein S5                                    187   8e-57   



>ref|XP_009620036.1| PREDICTED: 40S ribosomal protein S5 [Nicotiana tomentosiformis]
 ref|XP_009782596.1| PREDICTED: 40S ribosomal protein S5 [Nicotiana sylvestris]
Length=209

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            Q+EK H+ ++LFNRWSYDDVQ++D+SV+DYITATAAKHPTYTPHTAGRYQAKRFRKAQCP
Sbjct  13   QQEKAHTDVMLFNRWSYDDVQISDISVEDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  72

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR
Sbjct  73   IVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  132

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  133  IGSAGVVRR  141



>ref|XP_004250715.1| PREDICTED: 40S ribosomal protein S5 [Solanum lycopersicum]
Length=211

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            PQ+EK H+ +LLFNRWSYDDVQ+ D+SV+DYITATA KHPTYTPHTAGRYQAKRFRKAQC
Sbjct  14   PQQEKPHTDVLLFNRWSYDDVQIADISVEDYITATANKHPTYTPHTAGRYQAKRFRKAQC  73

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT
Sbjct  74   PIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  133

Query  492  RIGSAGVVRR  521
            RIGSAGVVRR
Sbjct  134  RIGSAGVVRR  143



>ref|XP_011078788.1| PREDICTED: 40S ribosomal protein S5 [Sesamum indicum]
Length=205

 Score =   256 bits (653),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  EKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVV  320
            EKVHSG+LLFNRWSYD+VQ++D+SV+DYITAT AKHPTY PHTAGRYQAKRFRKAQCP+V
Sbjct  11   EKVHSGVLLFNRWSYDEVQISDISVEDYITATGAKHPTYMPHTAGRYQAKRFRKAQCPIV  70

Query  321  ERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG  500
            ERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG
Sbjct  71   ERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG  130

Query  501  SAGVVRR  521
            SAGVVRR
Sbjct  131  SAGVVRR  137



>ref|XP_006363855.1| PREDICTED: 40S ribosomal protein S5-like [Solanum tuberosum]
Length=210

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            Q+EK H+ +LLFNRWSYDDVQ++D+SV+DYITATA KHPTYTPHTAGRYQAKRFRKAQCP
Sbjct  14   QQEKPHTDVLLFNRWSYDDVQISDISVEDYITATANKHPTYTPHTAGRYQAKRFRKAQCP  73

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDL+PIQVIVDAVINSGPREDATR
Sbjct  74   IVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLDPIQVIVDAVINSGPREDATR  133

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  134  IGSAGVVRR  142



>emb|CDP14297.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++K+H+ +LLFNRWSYDDVQV+D+SVDDYITATAAKHPTY PHTAGRYQ KRFRKAQCP+
Sbjct  16   QDKIHTDVLLFNRWSYDDVQVSDISVDDYITATAAKHPTYMPHTAGRYQVKRFRKAQCPI  75

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQ+IVDAVINSGPREDATRI
Sbjct  76   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDSNPIQIIVDAVINSGPREDATRI  135

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  136  GSAGVVRR  143



>emb|CDP00895.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            +E+KVHS +LLFNRW+YDDVQV D+SVDDYITATAAKHP Y PHTAGRYQ KRFRKAQCP
Sbjct  7    EEKKVHSEVLLFNRWAYDDVQVGDISVDDYITATAAKHPVYLPHTAGRYQVKRFRKAQCP  66

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGPREDATR
Sbjct  67   IVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATR  126

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  127  IGSAGVVRR  135



>ref|XP_009606047.1| PREDICTED: 40S ribosomal protein S5-like [Nicotiana tomentosiformis]
 ref|XP_009609309.1| PREDICTED: 40S ribosomal protein S5-like [Nicotiana tomentosiformis]
Length=210

 Score =   250 bits (639),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            E KVHS ++LFNRW+YDDVQ+ND+SV+DYITATA+KHP Y PHTAGRYQAKRFRKAQCP+
Sbjct  15   ENKVHSDVMLFNRWTYDDVQINDISVEDYITATASKHPVYMPHTAGRYQAKRFRKAQCPI  74

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRI
Sbjct  75   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRI  134

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  135  GSAGVVRR  142



>gb|EYU20673.1| hypothetical protein MIMGU_mgv1a013814mg [Erythranthe guttata]
Length=209

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            P+ +KV +G++LFNRWSYD+VQ++D+SV+DYITATAAKHP Y PHTAGRYQAKRFRKAQC
Sbjct  12   PEADKVPTGVMLFNRWSYDEVQISDISVEDYITATAAKHPQYMPHTAGRYQAKRFRKAQC  71

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P++ERL NSLMMHGRNNGKKL+A RIVKHAMEIIHLLTD NPIQV+VDAVINSGPREDAT
Sbjct  72   PIIERLTNSLMMHGRNNGKKLLAARIVKHAMEIIHLLTDQNPIQVVVDAVINSGPREDAT  131

Query  492  RIGSAGVVRR  521
            RIGSAGVVRR
Sbjct  132  RIGSAGVVRR  141



>ref|XP_006362288.1| PREDICTED: 40S ribosomal protein S5-like, partial [Solanum tuberosum]
Length=203

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            +E K+H+ ++LFNRWSYD V++ND+SV+DYITATA KHP Y PHTAGRYQAKRFRKAQCP
Sbjct  7    KENKIHTDVMLFNRWSYDGVEINDMSVEDYITATANKHPVYMPHTAGRYQAKRFRKAQCP  66

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATR
Sbjct  67   IVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATR  126

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  127  IGSAGVVRR  135



>ref|XP_004249155.1| PREDICTED: 40S ribosomal protein S5 [Solanum lycopersicum]
Length=215

 Score =   245 bits (626),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            +E KVH+ ++LFNRWSYD V++ND+SV+DYITATA KHP Y PHTAGRYQAKRFRKAQCP
Sbjct  19   KENKVHTDVMLFNRWSYDGVEINDMSVEDYITATANKHPVYMPHTAGRYQAKRFRKAQCP  78

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATR
Sbjct  79   IVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATR  138

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  139  IGSAGVVRR  147



>gb|AFW90603.1| 40S ribosomal protein S5 [Solanum tuberosum]
Length=219

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            +E K+H+ ++LFNRWSYD V++ND+SV+DYITATA KHP Y PHTAGRYQAKRFRKAQCP
Sbjct  23   KENKIHTDVMLFNRWSYDGVEINDMSVEDYITATANKHPVYMPHTAGRYQAKRFRKAQCP  82

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATR
Sbjct  83   IVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATR  142

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  143  IGSAGVVRR  151



>gb|AAR89617.1| 40S ribosomal protein S5 [Capsicum annuum]
Length=212

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            E KVH+ ++LFNRWSYD V +ND+SV+DYITATA KHP Y PHTAGRYQAKRFRKAQCP+
Sbjct  17   ESKVHTDVMLFNRWSYDGVDINDMSVEDYITATANKHPVYMPHTAGRYQAKRFRKAQCPI  76

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRI
Sbjct  77   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRI  136

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  137  GSAGVVRR  144



>gb|EYU22730.1| hypothetical protein MIMGU_mgv1a013661mg [Erythranthe guttata]
Length=214

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++K HS I+LFNRWSYD V+V+D+SV+DYITATA+KHP + PHTAGRYQAKRFRKAQC +
Sbjct  19   DDKAHSEIMLFNRWSYDGVEVSDISVEDYITATASKHPIFMPHTAGRYQAKRFRKAQCAI  78

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRI
Sbjct  79   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRI  138

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  139  GSAGVVRR  146



>ref|XP_006481676.1| PREDICTED: 40S ribosomal protein S5-2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481677.1| PREDICTED: 40S ribosomal protein S5-2-like isoform X2 [Citrus 
sinensis]
 gb|KDO70777.1| hypothetical protein CISIN_1g028585mg [Citrus sinensis]
Length=207

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            AQS +P +   H  + LFNRW+++DVQVND+S+ DYI   AAKH TY PHTAGRY  KRF
Sbjct  7    AQSQDPSQP--HYDVKLFNRWTFEDVQVNDISLSDYIGVQAAKHATYVPHTAGRYSVKRF  64

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  65   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  124

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  125  REDATRIGSAGVVRR  139



>ref|XP_006429966.1| hypothetical protein CICLE_v10012779mg [Citrus clementina]
 ref|XP_006429967.1| hypothetical protein CICLE_v10012779mg [Citrus clementina]
 gb|ESR43206.1| hypothetical protein CICLE_v10012779mg [Citrus clementina]
 gb|ESR43207.1| hypothetical protein CICLE_v10012779mg [Citrus clementina]
Length=207

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            AQS +P +   H  + LFNRW+++DVQVND+S+ DYI   AAKH TY PHTAGRY  KRF
Sbjct  7    AQSQDPSQP--HYDVKLFNRWTFEDVQVNDISLSDYIGVQAAKHATYVPHTAGRYSVKRF  64

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  65   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  124

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  125  REDATRIGSAGVVRR  139



>ref|XP_006429994.1| hypothetical protein CICLE_v10012772mg [Citrus clementina]
 gb|ESR43234.1| hypothetical protein CICLE_v10012772mg [Citrus clementina]
Length=207

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            AQS +P + +    + LFNRW+++DVQVND+S+ DYI   AAKH TY PHTAGRY AKRF
Sbjct  7    AQSQDPSQPQY--DVKLFNRWTFEDVQVNDISLSDYIGVQAAKHATYVPHTAGRYSAKRF  64

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  65   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  124

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  125  REDATRIGSAGVVRR  139



>gb|KDO70778.1| hypothetical protein CISIN_1g028585mg [Citrus sinensis]
Length=190

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            AQS +P +   H  + LFNRW+++DVQVND+S+ DYI   AAKH TY PHTAGRY  KRF
Sbjct  7    AQSQDPSQP--HYDVKLFNRWTFEDVQVNDISLSDYIGVQAAKHATYVPHTAGRYSVKRF  64

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  65   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  124

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  125  REDATRIGSAGVVRR  139



>ref|XP_010058569.1| PREDICTED: 40S ribosomal protein S5 [Eucalyptus grandis]
 gb|KCW90379.1| hypothetical protein EUGRSUZ_A02519 [Eucalyptus grandis]
 gb|KCW90380.1| hypothetical protein EUGRSUZ_A02519 [Eucalyptus grandis]
Length=206

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLV  332
            S + LFNRWS+DDVQVNDLS++DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL 
Sbjct  16   SDVKLFNRWSFDDVQVNDLSLNDYIAVQPAKHATYVPHTAGRYSVKRFRKAQCPIVERLT  75

Query  333  NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGV  512
            NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGV
Sbjct  76   NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGV  135

Query  513  VRR  521
            VRR
Sbjct  136  VRR  138



>ref|XP_008447165.1| PREDICTED: 40S ribosomal protein S5-like isoform X2 [Cucumis 
melo]
Length=207

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +  + H  + LFNRW++DDVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKA
Sbjct  8    VNQELTQPHHDVKLFNRWTFDDVQVNDISLVDYIGVAPAKHATYVPHTAGRYSVKRFRKA  67

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPRED
Sbjct  68   QCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPRED  127

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  128  ATRIGSAGVVRR  139



>ref|XP_008447164.1| PREDICTED: 40S ribosomal protein S5-like isoform X1 [Cucumis 
melo]
Length=220

 Score =   228 bits (581),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +  + H  + LFNRW++DDVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKA
Sbjct  21   VNQELTQPHHDVKLFNRWTFDDVQVNDISLVDYIGVAPAKHATYVPHTAGRYSVKRFRKA  80

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPRED
Sbjct  81   QCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPRED  140

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  141  ATRIGSAGVVRR  152



>ref|XP_004139812.1| PREDICTED: 40S ribosomal protein S5-1-like [Cucumis sativus]
 ref|XP_004159046.1| PREDICTED: 40S ribosomal protein S5-1-like [Cucumis sativus]
 gb|KGN44229.1| hypothetical protein Csa_7G232530 [Cucumis sativus]
Length=207

 Score =   227 bits (579),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +  + H  + LFNRW++DDVQVND+S+ DY+    AKH TY PHTAGRY  KRFRKA
Sbjct  8    VNQELTQSHHDVKLFNRWTFDDVQVNDISLVDYVGVAPAKHATYVPHTAGRYSVKRFRKA  67

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNP+QVIVDAV+NSGPRED
Sbjct  68   QCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPVQVIVDAVVNSGPRED  127

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  128  ATRIGSAGVVRR  139



>gb|AFK39266.1| unknown [Lotus japonicus]
Length=204

 Score =   227 bits (578),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = +3

Query  108  EEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQA  287
            E  A  V+P + +V     LFNRWSYDDVQV D+S+ DY+   A+KH TY PHTAGRY  
Sbjct  3    ETVAVEVDPSQIEVK----LFNRWSYDDVQVTDISLADYVGVVASKHATYVPHTAGRYSV  58

Query  288  KRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVIN  467
            KRFRKAQCP++ERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNP+QVIVDAVIN
Sbjct  59   KRFRKAQCPIIERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPVQVIVDAVIN  118

Query  468  SGPREDATRIGSAGVVRR  521
            SGPREDATRIGSAGVVRR
Sbjct  119  SGPREDATRIGSAGVVRR  136



>ref|XP_008463640.1| PREDICTED: 40S ribosomal protein S5 [Cucumis melo]
Length=207

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRW++DDVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  16   HHDVKLFNRWTFDDVQVNDISLVDYIGVAPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  75

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  76   TNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  135

Query  510  VVRR  521
            VVRR
Sbjct  136  VVRR  139



>ref|XP_010105084.1| 40S ribosomal protein S5 [Morus notabilis]
 gb|EXC03822.1| 40S ribosomal protein S5 [Morus notabilis]
Length=204

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  13   HFDVKLFNRWSFDDVQVNDISLADYIGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  72

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  73   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  132

Query  510  VVRR  521
            VVRR
Sbjct  133  VVRR  136



>ref|XP_007149885.1| hypothetical protein PHAVU_005G107000g [Phaseolus vulgaris]
 gb|ESW21879.1| hypothetical protein PHAVU_005G107000g [Phaseolus vulgaris]
Length=207

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW++DDVQVND+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWNFDDVQVNDISLADYIGVVASKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  139



>ref|XP_004139502.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004139503.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 2 [Cucumis 
sativus]
Length=207

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRW++DDVQVND+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  16   HHDVKLFNRWTFDDVQVNDISLVDYVGVAPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  75

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  76   TNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  135

Query  510  VVRR  521
            VVRR
Sbjct  136  VVRR  139



>ref|XP_008456864.1| PREDICTED: 40S ribosomal protein S5-like [Cucumis melo]
Length=253

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +  + H  + LFNRW++DDVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKA
Sbjct  54   VNQELTQPHHDVKLFNRWTFDDVQVNDISLVDYIGVAPAKHATYVPHTAGRYSVKRFRKA  113

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPRED
Sbjct  114  QCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPRED  173

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  174  ATRIGSAGVVRR  185



>ref|XP_004140419.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004140420.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004140421.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004140422.1| PREDICTED: 40S ribosomal protein S5-1-like isoform 4 [Cucumis 
sativus]
 ref|XP_004171001.1| PREDICTED: 40S ribosomal protein S5-1-like [Cucumis sativus]
 gb|KGN50866.1| hypothetical protein Csa_5G292230 [Cucumis sativus]
Length=207

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +  + H  + LFNRW++DDVQVND+S+ DY+    AKH TY PHTAGRY  KRFRKA
Sbjct  8    VNQELIQPHHDVKLFNRWTFDDVQVNDISLVDYVGVAPAKHATYVPHTAGRYSVKRFRKA  67

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP++ERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPRED
Sbjct  68   QCPIIERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPRED  127

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  128  ATRIGSAGVVRR  139



>ref|XP_004151715.1| PREDICTED: 40S ribosomal protein S5-1-like, partial [Cucumis 
sativus]
Length=171

 Score =   224 bits (570),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  126  VNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            VN +    H  + LFNRW++DDVQVND+S+ DY+    AKH TY PHTAGRY  KRFRKA
Sbjct  8    VNQELTLPHHDVKLFNRWTFDDVQVNDISLVDYVGVAPAKHATYVPHTAGRYSVKRFRKA  67

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNP+QVIVDAV+NSGPRED
Sbjct  68   QCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPVQVIVDAVVNSGPRED  127

Query  486  ATRIGSAGVVRR  521
            ATRIGSAGVVRR
Sbjct  128  ATRIGSAGVVRR  139



>gb|AGV54378.1| 40S ribosomal protein S5-like protein [Phaseolus vulgaris]
Length=207

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW++DDVQVND+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWNFDDVQVNDISLADYIGVVASKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG+VRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGMVRR  139



>ref|XP_002534312.1| 40S ribosomal protein S5, putative [Ricinus communis]
 gb|EEF28068.1| 40S ribosomal protein S5, putative [Ricinus communis]
Length=209

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  108  EEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQA  287
            E  A  V+ +  + ++ + LFNRW+++DVQVND+S+ DYI    AKH TY PHTAGRY  
Sbjct  4    EVAAPLVSSEPMQPYNEVKLFNRWTFEDVQVNDISLSDYIGIQPAKHATYVPHTAGRYSV  63

Query  288  KRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVIN  467
            KRFRKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAV+N
Sbjct  64   KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVVN  123

Query  468  SGPREDATRIGSAGVVRR  521
            SGPREDATRIGSAGVVRR
Sbjct  124  SGPREDATRIGSAGVVRR  141



>ref|XP_007029135.1| Ribosomal protein 5A [Theobroma cacao]
 gb|EOY09637.1| Ribosomal protein 5A [Theobroma cacao]
Length=210

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            P+  + H  + LFNRWS+++VQV D+S+ DYI   AAKH TY PHTAGRY  KRFRKAQC
Sbjct  13   PEGTQPHFEVKLFNRWSFEEVQVTDISLSDYIGVQAAKHATYVPHTAGRYSVKRFRKAQC  72

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDAT
Sbjct  73   PIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAIINSGPREDAT  132

Query  492  RIGSAGVVRR  521
            RIGSAGVVRR
Sbjct  133  RIGSAGVVRR  142



>ref|XP_008778205.1| PREDICTED: 40S ribosomal protein S5-like [Phoenix dactylifera]
Length=195

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            V   + LFNRWS+++VQV+D+S++DYI  T AKH TY PHTAGRY  KRFRKAQCP+VER
Sbjct  3    VEQEVKLFNRWSFEEVQVSDISLNDYIAMTPAKHATYLPHTAGRYAVKRFRKAQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_008391547.1| PREDICTED: 40S ribosomal protein S5 [Malus domestica]
 ref|XP_009374318.1| PREDICTED: 40S ribosomal protein S5 [Pyrus x bretschneideri]
Length=208

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            +  + H  + LFNRWS+DDVQV+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP
Sbjct  12   EPTQAHYDVKLFNRWSFDDVQVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCP  71

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATR
Sbjct  72   IVERLTNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATR  131

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  132  IGSAGVVRR  140



>ref|XP_003519018.1| PREDICTED: 40S ribosomal protein S5-like [Glycine max]
Length=204

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++DV+VND+S+ DYI  + +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  18   LFNRWSFEDVEVNDMSLADYIGVSPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  77

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  78   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  136



>ref|XP_008391999.1| PREDICTED: 40S ribosomal protein S5 [Malus domestica]
Length=208

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNRWSFDDVQVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_008387136.1| PREDICTED: 40S ribosomal protein S5-like [Malus domestica]
Length=208

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNRWSFDDVQVSDISLADYIGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_007204730.1| hypothetical protein PRUPE_ppa011341mg [Prunus persica]
 gb|EMJ05929.1| hypothetical protein PRUPE_ppa011341mg [Prunus persica]
Length=214

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = +3

Query  78   AVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTY  257
            +VAV    P     Q+V P E   H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY
Sbjct  2    SVAVEPTAPTAPTVQTV-PIEP--HLDVKLFNRWSFDDVQVSDISLADYVGVVPAKHATY  58

Query  258  TPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNP  437
             PHTAGRY  KRFRKAQCP+VERL NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTD NP
Sbjct  59   VPHTAGRYSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDQNP  118

Query  438  IQVIVDAVINSGPREDATRIGSAGVVRR  521
            IQ+IVDAV+NSGPREDATRIGSAGVVRR
Sbjct  119  IQIIVDAVVNSGPREDATRIGSAGVVRR  146



>gb|KGN64964.1| 40S ribosomal protein S5 [Cucumis sativus]
Length=207

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRW++DDVQVND+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VER 
Sbjct  16   HHDVKLFNRWTFDDVQVNDISLVDYVGVAPAKHATYVPHTAGRYSVKRFRKAQCPIVERR  75

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  76   TNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  135

Query  510  VVRR  521
            VVRR
Sbjct  136  VVRR  139



>ref|XP_009362661.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
 ref|XP_009362662.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
Length=208

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNRWSFDDVQVSDISLADYIGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_009379661.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
 ref|XP_009379662.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
Length=208

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNRWSFDDVQVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_010100501.1| 40S ribosomal protein S5 [Morus notabilis]
 gb|EXB82635.1| 40S ribosomal protein S5 [Morus notabilis]
Length=204

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS++DVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  13   HFDVKLFNRWSFEDVQVNDISLADYIGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  72

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKL+AVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  73   TNSLMMHGRNNGKKLIAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  132

Query  510  VVRR  521
            VVRR
Sbjct  133  VVRR  136



>ref|XP_003533901.1| PREDICTED: 40S ribosomal protein S5-like [Glycine max]
 gb|KHM98955.1| 40S ribosomal protein S5 [Glycine soja]
Length=204

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDV+V D+S+ DYI  + +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  18   LFNRWSFDDVEVTDMSLADYIGVSPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  77

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  78   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  136



>ref|NP_001276300.1| 40S ribosomal protein S5-like [Glycine max]
 gb|ACU20529.1| unknown [Glycine max]
Length=201

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDV+V D+S+ DYI  + +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  18   LFNRWSFDDVEVTDMSLADYIGVSPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  77

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  78   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  136



>ref|XP_006662936.1| PREDICTED: 40S ribosomal protein S5-like [Oryza brachyantha]
Length=199

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 113/130 (87%), Gaps = 5/130 (4%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            PQ+E     + LF RWS++DVQVND+S+ DY+  +A KH TY PHTAGRY AKRFRKAQC
Sbjct  7    PQQE-----VKLFTRWSFEDVQVNDISLADYLAVSATKHATYLPHTAGRYSAKRFRKAQC  61

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKK+MAVRIVKHAMEIIHLLTD NPIQVI+DA+INSGPREDAT
Sbjct  62   PIVERLTNSLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIIDAIINSGPREDAT  121

Query  492  RIGSAGVVRR  521
            RIGSAG VRR
Sbjct  122  RIGSAGAVRR  131



>ref|XP_008219748.1| PREDICTED: 40S ribosomal protein S5 [Prunus mume]
Length=215

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  24   HHDVKLFNRWSFDDVQVSDISLADYVGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  83

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  84   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  143

Query  510  VVRR  521
            VVRR
Sbjct  144  VVRR  147



>ref|XP_007223418.1| hypothetical protein PRUPE_ppa011314mg [Prunus persica]
 gb|EMJ24617.1| hypothetical protein PRUPE_ppa011314mg [Prunus persica]
Length=215

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  24   HHDVKLFNRWSFDDVQVSDISLADYVGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  83

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  84   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  143

Query  510  VVRR  521
            VVRR
Sbjct  144  VVRR  147



>ref|XP_004303416.1| PREDICTED: 40S ribosomal protein S5 [Fragaria vesca subsp. vesca]
Length=209

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            A+ V    ++ H+ + LFN+W++DD+QV+D+S+ DYI  T +KH  Y PHTAGRY  KRF
Sbjct  7    AEPVQQLYQEPHNDVKLFNKWTFDDIQVSDISLGDYIGVTQSKHAIYVPHTAGRYSVKRF  66

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGP
Sbjct  67   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGP  126

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  127  REDATRIGSAGVVRR  141



>ref|XP_010464938.1| PREDICTED: 40S ribosomal protein S5-2 isoform X2 [Camelina sativa]
Length=207

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDVQV D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVQVADISLVDYIGVEAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            +ERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+D+NPIQVI+DA++NSGPREDATRI
Sbjct  72   IERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDMNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_008391548.1| PREDICTED: 40S ribosomal protein S5 [Malus domestica]
Length=208

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFN+WS+DDVQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNKWSFDDVQVSDISLADYIGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_010908271.1| PREDICTED: 40S ribosomal protein S5-like [Elaeis guineensis]
Length=195

 Score =   222 bits (565),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            V   + LFNRWS+++VQV+D+S++DYI  T AKH TY PHTAGRY  KRFRKAQCP+VER
Sbjct  3    VEQEVKLFNRWSFEEVQVSDISLNDYIAVTPAKHATYLPHTAGRYAVKRFRKAQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIV+A+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQVIVEAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_008359524.1| PREDICTED: 40S ribosomal protein S5 [Malus domestica]
Length=208

 Score =   222 bits (566),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFN+WS+DDVQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNKWSFDDVQVSDISLADYIGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_009379663.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
 ref|XP_009379665.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
 ref|XP_009379666.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
Length=208

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFN+WS+DDVQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNKWSFDDVQVSDISLADYIGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_009383828.1| PREDICTED: 40S ribosomal protein S5 [Musa acuminata subsp. malaccensis]
Length=195

 Score =   221 bits (564),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            +   + LFNRWS+DDV+V+D+S+ DYI  T  KH TY PHTAGRY AKRFRKAQCP++ER
Sbjct  3    IQQDVKLFNRWSFDDVEVSDISLADYIAVTPPKHATYLPHTAGRYSAKRFRKAQCPIIER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKH MEIIHLLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHTMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_008778214.1| PREDICTED: 40S ribosomal protein S5-like [Phoenix dactylifera]
Length=195

 Score =   221 bits (564),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            V   + LFNRWS+++VQV+D+S++DYI  T AKH TY PHTAGRY  KRFRKAQCP+VER
Sbjct  3    VEQEVKLFNRWSFEEVQVSDISLNDYIAVTPAKHATYLPHTAGRYAVKRFRKAQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHAMEIIYLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_009412721.1| PREDICTED: 40S ribosomal protein S5-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   221 bits (564),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  KVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVE  323
            ++   + LFNRWS+DDV+V+D+S+ DYI  T  KH TY PHTAGRY AKRFRKAQCP++E
Sbjct  2    EIQQDVKLFNRWSFDDVEVSDISLADYIAVTPPKHATYLPHTAGRYSAKRFRKAQCPIIE  61

Query  324  RLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGS  503
            RL NSLMMHGRNNGKKLMAVRI+KH MEIIHLLTD NPIQVIVDA+INSGPREDATRIGS
Sbjct  62   RLTNSLMMHGRNNGKKLMAVRIIKHTMEIIHLLTDANPIQVIVDAIINSGPREDATRIGS  121

Query  504  AGVVRR  521
            AGVVRR
Sbjct  122  AGVVRR  127



>ref|XP_010519996.1| PREDICTED: 40S ribosomal protein S5-1-like [Tarenaya hassleriana]
Length=207

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++ + + + LFNRWS+DDV V D+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+
Sbjct  12   QQALTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_010557962.1| PREDICTED: 40S ribosomal protein S5-1 [Tarenaya hassleriana]
Length=207

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++ + + + LFNRWS+DDV V D+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+
Sbjct  12   QQALTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_006298557.1| hypothetical protein CARUB_v10014641mg [Capsella rubella]
 gb|EOA31455.1| hypothetical protein CARUB_v10014641mg [Capsella rubella]
Length=207

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVSVADISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|KJB15005.1| hypothetical protein B456_002G154300 [Gossypium raimondii]
Length=209

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLV  332
            S + LFNRWS++DVQV D+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL 
Sbjct  19   SEVKLFNRWSFEDVQVTDISLSDYIGVQASKHATYVPHTAGRYSVKRFRKAQCPIVERLT  78

Query  333  NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGV  512
            NSLMMHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDATRIGSAGV
Sbjct  79   NSLMMHGRNNGKKLMAVRIVKHAMEIIYLLTDQNPIQVIVDAIINSGPREDATRIGSAGV  138

Query  513  VRR  521
            VRR
Sbjct  139  VRR  141



>ref|XP_002531594.1| 40S ribosomal protein S5, putative [Ricinus communis]
 gb|EEF30797.1| 40S ribosomal protein S5, putative [Ricinus communis]
Length=211

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            ++ + LFNRW+++DVQVND+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  20   YNEVKLFNRWTFEDVQVNDISLSDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  79

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  80   TNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAG  139

Query  510  VVRR  521
            VVRR
Sbjct  140  VVRR  143



>gb|ADR71287.1| 40S ribosomal protein S5B [Hevea brasiliensis]
Length=209

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            A  V  +  + ++ + LFNRW++++VQVND+S+ DYI    AKH TY PHTAGRY  KRF
Sbjct  7    AMPVTGEPTQPYNEVKLFNRWTFEEVQVNDISLSDYIGVQPAKHATYVPHTAGRYSVKRF  66

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  67   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  126

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  127  REDATRIGSAGVVRR  141



>ref|XP_008380691.1| PREDICTED: 40S ribosomal protein S5-like [Malus domestica]
 ref|XP_009339878.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
Length=209

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    A+H TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  18   HYDVKLFNRWSFDDVQVSDISLADYVGVVPARHATYVPHTAGRYSVKRFRKAQCPIVERL  77

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTDLNP+QVIVDAV+NSGPREDATRIGSAG
Sbjct  78   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPVQVIVDAVVNSGPREDATRIGSAG  137

Query  510  VVRR  521
            VVRR
Sbjct  138  VVRR  141



>ref|NP_187800.1| 40S ribosomal protein S5A [Arabidopsis thaliana]
 ref|NP_850564.1| 40S ribosomal protein S5A [Arabidopsis thaliana]
 ref|XP_002884873.1| ATRPS5A [Arabidopsis lyrata subsp. lyrata]
 sp|P51427.2|RS52_ARATH RecName: Full=40S ribosomal protein S5-2 [Arabidopsis thaliana]
 gb|AAF23210.1|AC016795_23 putative 40S ribosomal protein S5 [Arabidopsis thaliana]
 dbj|BAB03103.1| 40S ribosomal protein S5-like [Arabidopsis thaliana]
 gb|AAK76520.1| putative 40S ribosomal protein S5 [Arabidopsis thaliana]
 gb|AAM14315.1| putative 40S ribosomal protein S5 [Arabidopsis thaliana]
 gb|AAM64502.1| 40S ribosomal protein S5, putative [Arabidopsis thaliana]
 gb|EFH61132.1| ATRPS5A [Arabidopsis lyrata subsp. lyrata]
 gb|AEE75123.1| 40S ribosomal protein S5A [Arabidopsis thaliana]
 gb|AEE75124.1| 40S ribosomal protein S5A [Arabidopsis thaliana]
Length=207

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++ + + + LFNRW+YDDV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQALTNEVKLFNRWTYDDVTVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|ADR71286.1| 40S ribosomal protein S5A [Hevea brasiliensis]
Length=209

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            A  V  +  + ++ + LFNRW++++VQVND+S+ DYI    AKH TY PHTAGRY  KRF
Sbjct  7    ATPVTGEPTQPYNEVKLFNRWTFEEVQVNDISLSDYIGVQPAKHATYVPHTAGRYSVKRF  66

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGP
Sbjct  67   RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGP  126

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  127  REDATRIGSAGVVRR  141



>ref|XP_010910415.1| PREDICTED: 40S ribosomal protein S5-like [Elaeis guineensis]
Length=195

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            V   + LFNRWS++DV V+D+S++DYI  T AKH TY PHTAGRY  KRFRKAQCP+VER
Sbjct  3    VEQEVKLFNRWSFEDVHVSDISLNDYIAVTPAKHATYLPHTAGRYAVKRFRKAQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIV+A+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQVIVEAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_002281550.1| PREDICTED: 40S ribosomal protein S5 [Vitis vinifera]
 ref|XP_002281538.1| PREDICTED: 40S ribosomal protein S5 [Vitis vinifera]
 emb|CBI29956.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 4/131 (3%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            N QE  V     LFNRWS+D+VQ++D+S++DYI    AKH TY PHTAGRY  KRFRKAQ
Sbjct  14   NLQETTVK----LFNRWSFDEVQISDISLEDYIAVNPAKHATYVPHTAGRYSVKRFRKAQ  69

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLT+ NPIQVIVDAVINSGPREDA
Sbjct  70   CPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTEQNPIQVIVDAVINSGPREDA  129

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  130  TRIGSAGVVRR  140



>ref|XP_004967892.1| PREDICTED: 40S ribosomal protein S5-like [Setaria italica]
Length=199

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 5/135 (4%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            A+   PQ+E     + LFNRW++DDVQVND+S++DY+  +A KH TY PHTAGRY  KRF
Sbjct  2    AEVEQPQQE-----VKLFNRWTFDDVQVNDISLNDYLAVSAMKHATYLPHTAGRYSKKRF  56

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKAQCP+VERL NSLMMHGRNNGKK+MAVRI+KH +EIIHLLTD NPIQV+VDA+INSGP
Sbjct  57   RKAQCPIVERLTNSLMMHGRNNGKKVMAVRIMKHTLEIIHLLTDANPIQVVVDAIINSGP  116

Query  477  REDATRIGSAGVVRR  521
            REDATRIGSAGVVRR
Sbjct  117  REDATRIGSAGVVRR  131



>ref|XP_010534372.1| PREDICTED: 40S ribosomal protein S5-1 [Tarenaya hassleriana]
Length=207

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++ + + + LFNRWS+DDV V D+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+
Sbjct  12   QQALTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_010464937.1| PREDICTED: 40S ribosomal protein S5-2 isoform X1 [Camelina sativa]
Length=207

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDVQV D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVQVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL D NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLQDQNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_009385470.1| PREDICTED: 40S ribosomal protein S5-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            +   + LFNRWS+DDV+V+D+S+ DYI  T  KH TY PHTAGRY AKRFRK+QCP++ER
Sbjct  3    IQQDVKLFNRWSFDDVEVSDISLADYIAVTPPKHATYLPHTAGRYSAKRFRKSQCPIIER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKH MEIIHLLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHTMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_006481653.1| PREDICTED: 40S ribosomal protein S5-like [Citrus sinensis]
Length=207

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 119/151 (79%), Gaps = 12/151 (8%)
 Frame = +3

Query  69   MEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKH  248
            M  AV   S +P +       PQ +     + LFNRW+++DVQVND+S+ DYI   AAK+
Sbjct  1    MATAVVTQSQDPSQ-------PQYD-----VKLFNRWTFEDVQVNDISLSDYIGVQAAKN  48

Query  249  PTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  428
             TY PHTAGRY  KRFRK QCP+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD
Sbjct  49   ATYVPHTAGRYSLKRFRKLQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  108

Query  429  LNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
             NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  109  QNPIQVIVDAVINSGPREDATRIGSAGVVRR  139



>ref|XP_009121046.1| PREDICTED: 40S ribosomal protein S5-1-like [Brassica rapa]
 ref|XP_009146669.1| PREDICTED: 40S ribosomal protein S5-1-like [Brassica rapa]
 emb|CDY47906.1| BnaAnng09380D [Brassica napus]
 emb|CDY08480.1| BnaA05g27160D [Brassica napus]
 emb|CDY08483.1| BnaA05g27190D [Brassica napus]
 emb|CDY01071.1| BnaC05g41290D [Brassica napus]
Length=207

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVSVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDANPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_004290841.1| PREDICTED: 40S ribosomal protein S5 [Fragaria vesca subsp. vesca]
Length=209

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H+ + LFNRW+++ V+V DLS+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  18   HNDVKLFNRWTFEGVEVTDLSLQDYIGVNQAKHATYVPHTAGRYSVKRFRKAQCPIVERL  77

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  78   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  137

Query  510  VVRR  521
            VVRR
Sbjct  138  VVRR  141



>ref|XP_002266736.1| PREDICTED: 40S ribosomal protein S5 [Vitis vinifera]
 emb|CBI28644.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   220 bits (561),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            +EK  + + LFNRWS+D+VQ+ D+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+
Sbjct  9    DEKKPTEVKLFNRWSFDEVQIGDMSLLDYVAVNPAKHATYVPHTAGRYSVKRFRKAQCPI  68

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRI
Sbjct  69   VERLTNSLMMHGRNNGKKLMAVRIMKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRI  128

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  129  GSAGVVRR  136



>ref|XP_009411843.1| PREDICTED: 40S ribosomal protein S5-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   220 bits (561),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            +   + LFNRWS+DDV+V+D+S+ DY+  T  KH TY PHTAGRY AKRFRK+QCP+VER
Sbjct  3    IQQDVKLFNRWSFDDVEVSDISLADYLAVTPPKHATYLPHTAGRYSAKRFRKSQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKH MEIIHLLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHTMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_010257626.1| PREDICTED: 40S ribosomal protein S5 [Nelumbo nucifera]
Length=197

 Score =   220 bits (561),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQV D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  11   LFNRWSFDDVQVGDISLVDYIGVVPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  70

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  71   MHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  129



>ref|XP_009348626.1| PREDICTED: 40S ribosomal protein S5-like [Pyrus x bretschneideri]
Length=208

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFN WS+DDVQV+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNHWSFDDVQVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|XP_009609310.1| PREDICTED: 40S ribosomal protein S5-like [Nicotiana tomentosiformis]
Length=222

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            E K++  ++LFNRW+YDDVQ+ND+SV+DYITA A+KHP Y  HTAGRYQAKRF KAQ P+
Sbjct  44   ENKIYCDVMLFNRWTYDDVQINDISVEDYITAIASKHPVYMQHTAGRYQAKRFTKAQSPI  103

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLM VRI+KH MEIIHLLT+ NPIQVIVD VIN GPREDATRI
Sbjct  104  VERLTNSLMMHGRNNGKKLMVVRIIKHVMEIIHLLTNKNPIQVIVDVVINIGPREDATRI  163

Query  498  GSAGVVR  518
            GSAGVVR
Sbjct  164  GSAGVVR  170



>ref|XP_009141642.1| PREDICTED: 40S ribosomal protein S5-1 [Brassica rapa]
Length=207

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>emb|CDY55439.1| BnaA04g29230D [Brassica napus]
 emb|CDY18458.1| BnaA04g21290D [Brassica napus]
Length=207

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|ABK23207.1| unknown [Picea sitchensis]
 gb|ABK24039.1| unknown [Picea sitchensis]
 gb|ABK26748.1| unknown [Picea sitchensis]
 gb|ACN40584.1| unknown [Picea sitchensis]
Length=198

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 112/130 (86%), Gaps = 5/130 (4%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            PQ E     + LFNRW+++DV+VNDLS+ DYI   + KH T+ PHTAGRY  KRFRKAQC
Sbjct  6    PQPE-----VKLFNRWTFEDVEVNDLSLADYIAVQSQKHATFVPHTAGRYSVKRFRKAQC  60

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDAT
Sbjct  61   PIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAIINSGPREDAT  120

Query  492  RIGSAGVVRR  521
            RIGSAGVVRR
Sbjct  121  RIGSAGVVRR  130



>ref|XP_008241140.1| PREDICTED: 40S ribosomal protein S5-like [Prunus mume]
Length=211

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  93   SVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTA  272
            +V P    A +V P E   H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY PHTA
Sbjct  4    AVEPTAPTAPTV-PIEP--HLDVKLFNRWSFDDVQVSDISLADYVGVAPAKHATYVPHTA  60

Query  273  GRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIV  452
            GRY  KRFRKAQCP+VERL NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTD NPIQ+IV
Sbjct  61   GRYSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDQNPIQIIV  120

Query  453  DAVINSGPREDATRIGSAGVVRR  521
            DAV+NSGPREDATRIGSAGVVRR
Sbjct  121  DAVVNSGPREDATRIGSAGVVRR  143



>gb|KHG22024.1| 40S ribosomal S5 [Gossypium arboreum]
Length=209

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++DVQV D+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  23   LFNRWSFEDVQVTDISLSDYIGVQASKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  82

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDATRIGSAGVVRR
Sbjct  83   MHGRNNGKKLMAVRIVKHAMEIIYLLTDQNPIQVIVDAIINSGPREDATRIGSAGVVRR  141



>ref|XP_008792965.1| PREDICTED: 40S ribosomal protein S5 [Phoenix dactylifera]
 ref|XP_010926656.1| PREDICTED: 40S ribosomal protein S5 [Elaeis guineensis]
Length=195

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  VHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVER  326
            V   + LFNRWS+++V+V+D+S+ DYI  + AKH TY PHTAGRY  KRFRKAQCP+VER
Sbjct  3    VQQEVKLFNRWSFEEVEVSDISLADYIAVSPAKHATYLPHTAGRYAVKRFRKAQCPIVER  62

Query  327  LVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSA  506
            L NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSA
Sbjct  63   LTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSA  122

Query  507  GVVRR  521
            GVVRR
Sbjct  123  GVVRR  127



>ref|XP_007202555.1| hypothetical protein PRUPE_ppa011243mg [Prunus persica]
 gb|EMJ03754.1| hypothetical protein PRUPE_ppa011243mg [Prunus persica]
Length=218

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  27   HFDVKLFNRWSFDDVQVSDISLADYVGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  86

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  87   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAG  146

Query  510  VVRR  521
            VVRR
Sbjct  147  VVRR  150



>ref|XP_010671292.1| PREDICTED: 40S ribosomal protein S5 [Beta vulgaris subsp. vulgaris]
Length=211

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  EKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVV  320
            + + + + LF RW +DDV V+D+++ DYI  TA KH TY PHTAGRYQ KRFRKAQCP+V
Sbjct  17   DSLQNEVKLFGRWGFDDVTVHDIALADYIGVTAVKHATYVPHTAGRYQMKRFRKAQCPIV  76

Query  321  ERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG  500
            ERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQV+VDA+INSGPREDATRIG
Sbjct  77   ERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVVVDAIINSGPREDATRIG  136

Query  501  SAGVVRR  521
            SAGVVRR
Sbjct  137  SAGVVRR  143



>ref|NP_001067900.1| Os11g0482000 [Oryza sativa Japonica Group]
 gb|ABA93723.1| 40S ribosomal protein S5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28263.1| Os11g0482000 [Oryza sativa Japonica Group]
 gb|EAY80929.1| hypothetical protein OsI_36106 [Oryza sativa Indica Group]
 gb|EAZ18363.1| hypothetical protein OsJ_33893 [Oryza sativa Japonica Group]
 dbj|BAG96318.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87032.1| unnamed protein product [Oryza sativa Japonica Group]
Length=199

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 112/130 (86%), Gaps = 5/130 (4%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            PQ+E     + LF+RWS++DVQVND+S+ DY+     KH TY PHTAGRY AKRFRKAQC
Sbjct  7    PQQE-----VKLFSRWSFEDVQVNDISLADYLAVNPTKHATYLPHTAGRYSAKRFRKAQC  61

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKK+MAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDAT
Sbjct  62   PIVERLTNSLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDAT  121

Query  492  RIGSAGVVRR  521
            RIGSAG VRR
Sbjct  122  RIGSAGAVRR  131



>gb|KDP21916.1| hypothetical protein JCGZ_03054 [Jatropha curcas]
Length=210

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            ++ + LFNRW++++VQVND+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  19   YTEVKLFNRWTFEEVQVNDISLCDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  78

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAG
Sbjct  79   TNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAG  138

Query  510  VVRR  521
            VVRR
Sbjct  139  VVRR  142



>ref|XP_008241141.1| PREDICTED: 40S ribosomal protein S5-like [Prunus mume]
Length=218

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    AKH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  27   HFDVKLFNRWSFDDVQVSDISLADYVGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERL  86

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRI++HAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  87   TNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAG  146

Query  510  VVRR  521
            VVRR
Sbjct  147  VVRR  150



>ref|XP_007145745.1| hypothetical protein PHAVU_007G264200g [Phaseolus vulgaris]
 gb|ESW17739.1| hypothetical protein PHAVU_007G264200g [Phaseolus vulgaris]
Length=207

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++D+QVND+S+ DYI   ++KH TY PHT+GRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWSFEDIQVNDISLADYIGVVSSKHATYVPHTSGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KH+MEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHSMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  139



>ref|XP_010498291.1| PREDICTED: 40S ribosomal protein S5-2-like [Camelina sativa]
Length=207

 Score =   220 bits (560),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDV+V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVEVADISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+D NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDQNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_009135197.1| PREDICTED: 40S ribosomal protein S5-1-like [Brassica rapa]
 emb|CDY53925.1| BnaC03g73560D [Brassica napus]
 emb|CDX73845.1| BnaA03g32020D [Brassica napus]
Length=207

 Score =   219 bits (559),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVSVADISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQ+I+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDANPIQIIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_006858974.1| hypothetical protein AMTR_s00068p00119380 [Amborella trichopoda]
 gb|ERN20441.1| hypothetical protein AMTR_s00068p00119380 [Amborella trichopoda]
Length=197

 Score =   219 bits (558),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+++V+V+D+S+ DY+  +A+KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  11   LFNRWSFEEVEVSDISLADYVAVSASKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  70

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKH+MEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  71   MHGRNNGKKLMAVRIVKHSMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  129



>gb|KGN62801.1| hypothetical protein Csa_2G373440 [Cucumis sativus]
Length=284

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 122/156 (78%), Gaps = 9/156 (6%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            DG+ K  G +AV        +   VN +    H  + LFNRW++DDVQVND+S+ DY+  
Sbjct  70   DGDLK-SGTMAV--------EVDVVNQELTLPHHDVKLFNRWTFDDVQVNDISLVDYVGV  120

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
              AKH TY PHTAGRY  KRFRKAQCP+VERL NSLMMHGRNNGKKLMAVRI+KHAMEII
Sbjct  121  APAKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIIKHAMEII  180

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            HLLTDLN +QVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  181  HLLTDLNTVQVIVDAVVNSGPREDATRIGSAGVVRR  216



>ref|XP_010516988.1| PREDICTED: 40S ribosomal protein S5-1-like [Camelina sativa]
Length=207

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            +E++ + + LFNRWS+DD+ V D+S+ DYI   +AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QEQLTNEVKLFNRWSFDDLDVKDISLVDYIGVQSAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQ+I+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQIIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_010276362.1| PREDICTED: 40S ribosomal protein S5-like [Nelumbo nucifera]
Length=197

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQV D+S+ DYI  +  KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  11   LFNRWSFDDVQVGDISLVDYIGISPNKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  70

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSAGVVRR
Sbjct  71   MHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAIINSGPREDATRIGSAGVVRR  129



>gb|KHG01795.1| 40S ribosomal S5 [Gossypium arboreum]
Length=211

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  KVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVE  323
            K H  + LFNRWS+++VQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VE
Sbjct  18   KSHPDVKLFNRWSFEEVQVSDISLSDYIGVQPSKHATYVPHTAGRYSVKRFRKAQCPIVE  77

Query  324  RLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGS  503
            RL NSLMMHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDATRIGS
Sbjct  78   RLTNSLMMHGRNNGKKLMAVRIVKHAMEIIYLLTDQNPIQVIVDAIINSGPREDATRIGS  137

Query  504  AGVVRR  521
            AGVVRR
Sbjct  138  AGVVRR  143



>gb|AAM66936.1| 40S ribosomal protein S5 [Arabidopsis thaliana]
Length=207

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    +KH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPSKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_008351539.1| PREDICTED: 40S ribosomal protein S5-like [Malus domestica]
Length=336

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+DDVQV+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  17   HYDVKLFNRWSFDDVQVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERL  76

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAG
Sbjct  77   TNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAG  136

Query  510  VVRR  521
            VVRR
Sbjct  137  VVRR  140



>ref|NP_181264.1| 40S ribosomal protein S5-1 [Arabidopsis thaliana]
 ref|NP_001031502.1| 40S ribosomal protein S5-1 [Arabidopsis thaliana]
 sp|Q9ZUT9.1|RS51_ARATH RecName: Full=40S ribosomal protein S5-1 [Arabidopsis thaliana]
 gb|AAC98068.1| 40S ribosomal protein S5 [Arabidopsis thaliana]
 gb|AAL24331.1| 40S ribosomal protein S5 [Arabidopsis thaliana]
 gb|AAM10231.1| 40S ribosomal protein S5 [Arabidopsis thaliana]
 gb|AEC09375.1| 40S ribosomal protein S5-1 [Arabidopsis thaliana]
 gb|AEC09376.1| 40S ribosomal protein S5-1 [Arabidopsis thaliana]
Length=207

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    +KH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPSKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|ACG24566.1| 40S ribosomal protein S5 [Zea mays]
Length=199

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  EKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVV  320
            E+    + LFNRW++DDVQVND+S++DY+  TAAKH T+ PH+AGRY  KRFRKAQC +V
Sbjct  5    EQPQDAVKLFNRWTFDDVQVNDISLNDYLAVTAAKHATFLPHSAGRYSKKRFRKAQCAIV  64

Query  321  ERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG  500
            ERL NSLMMHGRNNGKK+MAVRI+KH +EIIHLLTD NPIQV+VDA+INSGPREDATRIG
Sbjct  65   ERLTNSLMMHGRNNGKKVMAVRIMKHTLEIIHLLTDTNPIQVVVDAIINSGPREDATRIG  124

Query  501  SAGVVRR  521
            SAGVVRR
Sbjct  125  SAGVVRR  131



>ref|NP_001131862.1| 40S ribosomal protein S5 [Zea mays]
 gb|ACF79359.1| unknown [Zea mays]
 gb|ACF80460.1| unknown [Zea mays]
 gb|ACF86170.1| unknown [Zea mays]
 gb|ACL53873.1| unknown [Zea mays]
 gb|ACL53979.1| unknown [Zea mays]
 gb|AFW77646.1| 40S ribosomal protein S5 [Zea mays]
Length=199

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  EKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVV  320
            E+    + LFNRW++DDVQVND+S++DY+  TAAKH T+ PH+AGRY  KRFRKAQC +V
Sbjct  5    EQPQDAVKLFNRWTFDDVQVNDISLNDYLAVTAAKHATFLPHSAGRYSKKRFRKAQCAIV  64

Query  321  ERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIG  500
            ERL NSLMMHGRNNGKK+MAVRI+KH +EIIHLLTD NPIQV+VDA+INSGPREDATRIG
Sbjct  65   ERLTNSLMMHGRNNGKKVMAVRIMKHTLEIIHLLTDANPIQVVVDAIINSGPREDATRIG  124

Query  501  SAGVVRR  521
            SAGVVRR
Sbjct  125  SAGVVRR  131



>ref|XP_010486867.1| PREDICTED: 40S ribosomal protein S5-2-like [Camelina sativa]
Length=207

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+YDDV+V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYDDVEVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAV+IVKHAMEI+HLL+D NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVKIVKHAMEIVHLLSDQNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>pdb|3J60|F Chain F, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=191

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN WS++DVQVND+S+ DY+  ++ KH TY PHTAGRY AKRFRKAQCP+VERL NSLM
Sbjct  5    LFNCWSFEDVQVNDISLADYLAVSSTKHATYLPHTAGRYSAKRFRKAQCPLVERLTNSLM  64

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSAG VRR
Sbjct  65   MHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSAGAVRR  123



>ref|NP_001041738.1| Os01g0100700 [Oryza sativa Japonica Group]
 dbj|BAB62621.1| putative 40S ribosomal protein S5 [Oryza sativa Japonica Group]
 dbj|BAB64234.1| putative 40S ribosomal protein S5 [Oryza sativa Japonica Group]
 dbj|BAE79751.1| putative 40S ribosomal protein S5 [Oryza sativa Japonica Group]
 dbj|BAF03652.1| Os01g0100700 [Oryza sativa Japonica Group]
 gb|EAY72160.1| hypothetical protein OsI_00008 [Oryza sativa Indica Group]
 gb|EAZ10181.1| hypothetical protein OsJ_00007 [Oryza sativa Japonica Group]
 dbj|BAG87164.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00534.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN WS++DVQVND+S+ DY+  ++ KH TY PHTAGRY AKRFRKAQCP+VERL NSLM
Sbjct  14   LFNCWSFEDVQVNDISLADYLAVSSTKHATYLPHTAGRYSAKRFRKAQCPLVERLTNSLM  73

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSAG VRR
Sbjct  74   MHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSAGAVRR  132



>sp|O65731.1|RS5_CICAR RecName: Full=40S ribosomal protein S5, partial [Cicer arietinum]
 emb|CAA06491.1| 40S ribosomal protein S5 [Cicer arietinum]
Length=197

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ++D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  11   LFNRWSFDDVQLSDVSLIDYIGVVPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  70

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  71   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  129



>ref|XP_006294898.1| hypothetical protein CARUB_v10023948mg, partial [Capsella rubella]
 gb|EOA27796.1| hypothetical protein CARUB_v10023948mg, partial [Capsella rubella]
Length=241

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  46   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  105

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  106  VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  165

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  166  GSAGVVRR  173



>gb|KHG03307.1| 40S ribosomal S5 [Gossypium arboreum]
Length=211

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  HSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            H  + LFNRWS+++VQV D+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL
Sbjct  20   HLEVKLFNRWSFEEVQVADISLSDYIGVQASKHATYVPHTAGRYSVKRFRKAQCPIVERL  79

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
             NSLMMHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDATRIGSAG
Sbjct  80   TNSLMMHGRNNGKKLMAVRIVKHAMEIIYLLTDQNPIQVIVDAIINSGPREDATRIGSAG  139

Query  510  VVRR  521
            VVRR
Sbjct  140  VVRR  143



>ref|XP_004486053.1| PREDICTED: 40S ribosomal protein S5-like [Cicer arietinum]
Length=207

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ++D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWSFDDVQLSDVSLIDYIGVVPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  139



>ref|XP_009133144.1| PREDICTED: 40S ribosomal protein S5-1-like [Brassica rapa]
 ref|XP_009143516.1| PREDICTED: 40S ribosomal protein S5-1-like [Brassica rapa]
 emb|CDY46771.1| BnaA03g17150D [Brassica napus]
 emb|CDX79730.1| BnaC03g20660D [Brassica napus]
 emb|CDX74975.1| BnaA05g07210D [Brassica napus]
Length=207

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDANPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|ACJ83953.1| unknown [Medicago truncatula]
Length=207

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  22   LFNRWSFDDVQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  139



>ref|XP_004486054.1| PREDICTED: 40S ribosomal protein S5-like [Cicer arietinum]
Length=207

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ++D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWSFDDVQLSDVSLIDYIGVVPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  139



>ref|XP_010505306.1| PREDICTED: 40S ribosomal protein S5-1-like [Camelina sativa]
Length=207

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DD+ V D+S+ DYI   +AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDLDVKDISLVDYIGVQSAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQ+I+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDANPIQIIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_006407392.1| hypothetical protein EUTSA_v10021528mg [Eutrema salsugineum]
 gb|ESQ48845.1| hypothetical protein EUTSA_v10021528mg [Eutrema salsugineum]
Length=207

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++ + + + LFNRW+YDDV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQALTNEVKLFNRWTYDDVSVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMM+GRNNGKKLMAV I+KHAMEIIHLLTDLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMYGRNNGKKLMAVGIIKHAMEIIHLLTDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_006839043.1| hypothetical protein AMTR_s00090p00050460 [Amborella trichopoda]
 gb|ERN01612.1| hypothetical protein AMTR_s00090p00050460 [Amborella trichopoda]
Length=198

 Score =   217 bits (553),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++DV+V+D+S+ DYI    +KH T+ PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  12   LFNRWSFEDVEVSDISLADYIAVAPSKHATFVPHTAGRYSVKRFRKAQCPIVERLTNSLM  71

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKH+MEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  72   MHGRNNGKKLMAVRIVKHSMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  130



>gb|ACG24474.1| 40S ribosomal protein S5 [Zea mays]
 gb|ACG37688.1| 40S ribosomal protein S5 [Zea mays]
 gb|ACL53933.1| unknown [Zea mays]
 gb|AFW79726.1| 40S ribosomal protein S5 [Zea mays]
Length=199

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW++DDVQVND+S++DY+   A KH  Y PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  13   LFNRWTFDDVQVNDISLNDYLAVNATKHAMYLPHTAGRYSKKRFRKAQCPIVERLTNSLM  72

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRI+KH +EIIHLLTD NPIQV+VDA+INSGPREDATRIGSAGVVRR
Sbjct  73   MHGRNNGKKVMAVRIIKHTLEIIHLLTDANPIQVVVDAIINSGPREDATRIGSAGVVRR  131



>ref|XP_001753712.1| predicted protein [Physcomitrella patens]
 ref|XP_001768339.1| predicted protein [Physcomitrella patens]
 ref|XP_001769390.1| predicted protein [Physcomitrella patens]
 ref|XP_001769450.1| predicted protein [Physcomitrella patens]
 ref|XP_001784323.1| predicted protein [Physcomitrella patens]
 gb|EDQ50885.1| predicted protein [Physcomitrella patens]
 gb|EDQ65759.1| predicted protein [Physcomitrella patens]
 gb|EDQ65819.1| predicted protein [Physcomitrella patens]
 gb|EDQ66953.1| predicted protein [Physcomitrella patens]
 gb|EDQ81464.1| predicted protein [Physcomitrella patens]
Length=196

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF RWS+DD+++ND+S+ DYI  +  KH T+ PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  10   LFGRWSFDDIEINDISLADYIAVSVDKHATFVPHTAGRYSVKRFRKAQCPIVERLTNSLM  69

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDA+INSGPREDATRIGSAGV+RR
Sbjct  70   MHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAIINSGPREDATRIGSAGVIRR  128



>ref|XP_010509358.1| PREDICTED: 40S ribosomal protein S5-1 [Camelina sativa]
Length=207

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI   +AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVNVTDISLVDYIGVQSAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL D NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLQDQNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>gb|ACG48499.1| 40S ribosomal protein S5 [Zea mays]
Length=199

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW++DDVQVND+S++DY+   A KH  Y PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  13   LFNRWTFDDVQVNDISLNDYLAVNATKHAMYLPHTAGRYSKKRFRKAQCPIVERLTNSLM  72

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRI+KH +EIIHLLTD NPIQV+VDA+INSGPREDATRIGSAGVVRR
Sbjct  73   MHGRNNGKKVMAVRIIKHTLEIIHLLTDANPIQVVVDAIINSGPREDATRIGSAGVVRR  131



>ref|XP_006410908.1| hypothetical protein EUTSA_v10017239mg [Eutrema salsugineum]
 ref|XP_006410909.1| hypothetical protein EUTSA_v10017239mg [Eutrema salsugineum]
 gb|ESQ52361.1| hypothetical protein EUTSA_v10017239mg [Eutrema salsugineum]
 gb|ESQ52362.1| hypothetical protein EUTSA_v10017239mg [Eutrema salsugineum]
Length=207

 Score =   217 bits (553),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D+S+ DYI    AKH TY PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDISLVDYIGVQPAKHATYVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMM+GRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMYGRNNGKKLMAVRIIKHAMEIIHLLTDSNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_004504517.1| PREDICTED: 40S ribosomal protein S5-like [Cicer arietinum]
Length=207

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW++DDVQ +D+S+ DYI   ++KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNRWTFDDVQFSDMSLSDYIGVVSSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKL AV I++HAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  81   MHGRNNGKKLKAVTIIRHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  139



>ref|XP_009777627.1| PREDICTED: 40S ribosomal protein S5-like, partial [Nicotiana 
sylvestris]
Length=180

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  192  VQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKK  371
            V++ND+SV+DYITATA+KHP Y PHTAGRYQAKRFRKAQCP+VERL NSLMMHGRNNGKK
Sbjct  3    VKINDISVEDYITATASKHPVYMPHTAGRYQAKRFRKAQCPIVERLTNSLMMHGRNNGKK  62

Query  372  LMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            LMAVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  63   LMAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  112



>gb|KHN00016.1| 40S ribosomal protein S5 [Glycine soja]
Length=202

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 2/119 (2%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++DV  ND+S+ DYI  + +KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  18   LFNRWSFEDV--NDMSLADYIGVSPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLM  75

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  76   MHGRNNGKKLMAVRIIKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  134



>emb|CDX91349.1| BnaC04g08010D [Brassica napus]
Length=207

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV V D S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSVTDNSLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDANPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_003568787.1| PREDICTED: 40S ribosomal protein S5-like [Brachypodium distachyon]
Length=201

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            E  +   + L+NRWSYD V VND+S++DY+  T  KH TY PH+AGRY AKRFRKAQCP+
Sbjct  6    EPALQHEVKLYNRWSYDGVAVNDISLNDYLAVTLPKHFTYLPHSAGRYSAKRFRKAQCPI  65

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            +ERL NSLMMHGRNNGKK+MAVRI+KH MEIIHLLTD NPIQVIVDA+INSGPREDATRI
Sbjct  66   IERLTNSLMMHGRNNGKKIMAVRIIKHTMEIIHLLTDANPIQVIVDAIINSGPREDATRI  125

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  126  GSAGVVRR  133



>emb|CDM81323.1| unnamed protein product [Triticum aestivum]
Length=200

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW+++DVQV+D+S++DY+  T+ KH T+ PH+AGRY AKRFRKAQCP++ERL NSLM
Sbjct  14   LFNRWTFEDVQVSDISLNDYLAVTSMKHYTFLPHSAGRYSAKRFRKAQCPIIERLTNSLM  73

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRI+KH MEIIHLLTD NPIQ+IVDA+INSGPREDATRIGSAGVVRR
Sbjct  74   MHGRNNGKKIMAVRIIKHTMEIIHLLTDANPIQIIVDAIINSGPREDATRIGSAGVVRR  132



>gb|KEH41731.1| 40S ribosomal protein S5-2 [Medicago truncatula]
Length=239

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  54   LFNRWSFDDVQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  112

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  113  MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  171



>gb|EMT07494.1| 40S ribosomal protein S5-1 [Aegilops tauschii]
Length=200

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW+++DVQV D+S++DY+  T+ KH T+ PH+AGRY AKRFRKAQCP++ERL NSLM
Sbjct  14   LFNRWTFEDVQVTDISLNDYLAVTSMKHYTFLPHSAGRYSAKRFRKAQCPIIERLTNSLM  73

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRI+KH MEIIHLLTD NPIQ+IVDA+INSGPREDATRIGSAGVVRR
Sbjct  74   MHGRNNGKKIMAVRIIKHTMEIIHLLTDANPIQIIVDAIINSGPREDATRIGSAGVVRR  132



>gb|KJB62023.1| hypothetical protein B456_009G396400 [Gossypium raimondii]
Length=211

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  KVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVE  323
            K H  + LFNRWS+++VQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VE
Sbjct  18   KSHPDVKLFNRWSFEEVQVSDISLSDYIGVQPSKHATYVPHTAGRYSVKRFRKAQCPIVE  77

Query  324  RLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGS  503
            RL NSLMMHGRNNGKKLMAVRIVKH MEII+LLTD NP++VIVDA+INSGPREDATRIGS
Sbjct  78   RLTNSLMMHGRNNGKKLMAVRIVKHTMEIIYLLTDQNPVKVIVDAIINSGPREDATRIGS  137

Query  504  AGVVRR  521
            AGVVRR
Sbjct  138  AGVVRR  143



>ref|XP_004979230.1| PREDICTED: 40S ribosomal protein S5-like [Setaria italica]
Length=199

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF RWS++DVQVND+S+ DY+     KH  Y PHTAGRY AKRFRK+QCP+VERL NSLM
Sbjct  13   LFGRWSFEDVQVNDISLADYLAVNPTKHAIYLPHTAGRYSAKRFRKSQCPIVERLTNSLM  72

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRIVKHAMEIIHLLTD NPIQ+IVDA+INSGPREDATRIGSAGVVRR
Sbjct  73   MHGRNNGKKVMAVRIVKHAMEIIHLLTDANPIQIIVDAIINSGPREDATRIGSAGVVRR  131



>gb|AFK48366.1| unknown [Medicago truncatula]
Length=207

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DDVQ+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  22   LFNRWSFDDVQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  80

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIG AGVVRR
Sbjct  81   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGFAGVVRR  139



>gb|ACJ85959.1| unknown [Medicago truncatula]
Length=202

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WS+DD+Q+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNQWSFDDLQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  79

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  80   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  138



>gb|AFK40877.1| unknown [Medicago truncatula]
 gb|KEH24339.1| 40S ribosomal protein S5-2 [Medicago truncatula]
Length=206

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WS+DD+Q+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNQWSFDDLQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  79

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  80   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  138



>gb|KFK38559.1| hypothetical protein AALP_AA3G129300 [Arabis alpina]
Length=207

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRW+Y+DV V D+S+ DYI   AAKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWTYEDVSVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAV I+KHAMEIIHLL+D NPIQ+I+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVNIIKHAMEIIHLLSDQNPIQIIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_002881500.1| ATRPS5B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57759.1| ATRPS5B [Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   214 bits (546),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            ++++ + + LFNRWS+DDV    +S+ DYI    AKH T+ PHTAGRY  KRFRKAQCP+
Sbjct  12   QQQLTNEVKLFNRWSFDDVSATHISLVDYIGVQPAKHATFVPHTAGRYSVKRFRKAQCPI  71

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRI  497
            VERL NSLMMHGRNNGKKLMAVRIVKHAMEIIHLL+DLNPIQVI+DA++NSGPREDATRI
Sbjct  72   VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI  131

Query  498  GSAGVVRR  521
            GSAGVVRR
Sbjct  132  GSAGVVRR  139



>ref|XP_003638095.1| 40S ribosomal protein S5-1, partial [Medicago truncatula]
Length=172

 Score =   213 bits (543),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WS+DD+Q+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  39   LFNQWSFDDLQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  97

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  98   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  156



>ref|XP_003638103.1| 40S ribosomal protein S5-1, partial [Medicago truncatula]
Length=154

 Score =   213 bits (541),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WS+DD+Q+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  21   LFNQWSFDDLQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  79

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  80   MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  138



>ref|XP_006481856.1| PREDICTED: 40S ribosomal protein S5-like [Citrus sinensis]
Length=218

 Score =   215 bits (547),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 114/140 (81%), Gaps = 5/140 (4%)
 Frame = +3

Query  102  PQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRY  281
            P++    S  P     H  + LFNRW+++DV V+D+S++DYI   A K+ TY PHTAGRY
Sbjct  16   PKQAHQDSSQP-----HYDVKLFNRWTFEDVSVSDMSLNDYIGVQAPKNATYVPHTAGRY  70

Query  282  QAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAV  461
              KRFRKAQCP+VERL NSLMMHGRNNGKKLMAV IVKHAMEIIHLLTD NPIQVIVDAV
Sbjct  71   SVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVLIVKHAMEIIHLLTDQNPIQVIVDAV  130

Query  462  INSGPREDATRIGSAGVVRR  521
            INSGPREDATRIGSAGVVRR
Sbjct  131  INSGPREDATRIGSAGVVRR  150



>ref|NP_001235614.1| uncharacterized protein LOC100499758 [Glycine max]
 gb|ACU13511.1| unknown [Glycine max]
Length=204

 Score =   214 bits (545),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++D++V D+S+ DYI   A+KH T  PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  18   LFNRWSFEDIEVTDISLADYIGVAASKHATCVPHTAGRYSVKRFRKAQCPIVERLTNSLM  77

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKL+AVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  78   MHGRNNGKKLLAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  136



>ref|XP_009770521.1| PREDICTED: 40S ribosomal protein S5-2-like [Nicotiana sylvestris]
 ref|XP_009770522.1| PREDICTED: 40S ribosomal protein S5-2-like [Nicotiana sylvestris]
Length=132

 Score =   211 bits (538),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  138  EEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPV  317
            E K+HS ++LFNRW+YDDVQ+ND+SV+DYITATA+KHP Y PHTAGRYQAKRFRKAQCP+
Sbjct  15   ENKIHSDVMLFNRWTYDDVQINDISVEDYITATASKHPVYMPHTAGRYQAKRFRKAQCPI  74

Query  318  VERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVIN  467
            VERL NSLMMHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAVIN
Sbjct  75   VERLTNSLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVIN  124



>ref|XP_003578829.1| PREDICTED: 40S ribosomal protein S5 [Brachypodium distachyon]
Length=199

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+D V+V D+S++DYI     KH TY PHTAGRY AKRFRKAQCP++ERL NSLM
Sbjct  13   LFNRWSFDGVEVQDISLNDYIGVNPDKHATYLPHTAGRYSAKRFRKAQCPIIERLTNSLM  72

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI++H MEIIHLLTD NPIQVIVDA+INSGPREDATRIGSAGVVRR
Sbjct  73   MHGRNNGKKLMAVRIIQHTMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSAGVVRR  131



>ref|NP_001238419.1| uncharacterized protein LOC100305898 [Glycine max]
 gb|ACU13803.1| unknown [Glycine max]
Length=204

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS+DD+++ D+S+ DYI    +KH TY PHTAGRY  KRFRK QCP+VERL NSLM
Sbjct  18   LFNRWSFDDIEITDISLADYIGVATSKHATYVPHTAGRYSVKRFRKVQCPIVERLTNSLM  77

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKL+AVRI+KHAMEIIHLLTD NPIQVIV+AV+NSGPREDATRIGSAGVVRR
Sbjct  78   MHGRNNGKKLLAVRIIKHAMEIIHLLTDRNPIQVIVEAVVNSGPREDATRIGSAGVVRR  136



>ref|XP_003638089.1| 40S ribosomal protein S5 [Medicago truncatula]
Length=248

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WS+DD+Q+ DLS+ DYI A + KH TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  63   LFNQWSFDDLQITDLSLGDYIGARS-KHATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  121

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHAMEIIHLLTD NPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  122  MHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVVRR  180



>dbj|BAJ86032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=200

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRW+++DVQV D+S++DY+  T+ KH T+ PH+AGRY AKRFRKAQCP++ERL NSLM
Sbjct  14   LFNRWTFEDVQVTDISLNDYLAVTSTKHYTFLPHSAGRYSAKRFRKAQCPIIERLTNSLM  73

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKK+MAVRI+KH M IIHLLTD NPIQ+IVDA+INSGPREDATRIGSAGVVRR
Sbjct  74   MHGRNNGKKIMAVRIIKHTMGIIHLLTDANPIQIIVDAIINSGPREDATRIGSAGVVRR  132



>emb|CEF98549.1| Ribosomal protein S5/S7, eukaryotic/archaeal [Ostreococcus tauri]
Length=194

 Score =   212 bits (540),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF +W++DDV++ND+S++DYI A   K+  Y PHTAGR+ AKRFRKAQCP+VERLVNSLM
Sbjct  9    LFGKWTFDDVEINDISLEDYI-AVKPKYAVYVPHTAGRFAAKRFRKAQCPIVERLVNSLM  67

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEIIHLLTD NP+QVIVDA+INSGPREDATRIGSAGVVRR
Sbjct  68   MHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPVQVIVDAIINSGPREDATRIGSAGVVRR  126



>ref|XP_011047107.1| PREDICTED: 40S ribosomal protein S5-like [Populus euphratica]
Length=208

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  + H  + LFNRW+++D+ VND+S+ DYI    AKH TY PHTAGRY  KRFRKAQ
Sbjct  11   NPEVNQPHHDVKLFNRWTFEDITVNDISLADYI-GVQAKHATYVPHTAGRYSVKRFRKAQ  69

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV I+KHAMEIIHLLTD NP+QVIVDAV+NSGPREDA
Sbjct  70   CPIVERLTNSLQMHGRNNGKKLKAVTIIKHAMEIIHLLTDQNPVQVIVDAVVNSGPREDA  129

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  130  TRIGSAGVVRR  140



>ref|XP_002322748.2| 40S ribosomal protein S5 [Populus trichocarpa]
 gb|ABK93911.1| unknown [Populus trichocarpa]
 gb|EEF04509.2| 40S ribosomal protein S5 [Populus trichocarpa]
Length=207

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  +    + LFNRWS+DD+ VND+S+ DY+     KH TY PHTAGRY  KRFRKAQ
Sbjct  10   NPEANQAIYDVKLFNRWSFDDINVNDISLADYV-GVQVKHATYVPHTAGRYSVKRFRKAQ  68

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV IVKHAMEIIHLLTD NPIQVIVDAV+NSGPREDA
Sbjct  69   CPIVERLTNSLQMHGRNNGKKLKAVTIVKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDA  128

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  129  TRIGSAGVVRR  139



>ref|XP_011039529.1| PREDICTED: 40S ribosomal protein S5 isoform X1 [Populus euphratica]
Length=207

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  +    + LFNRWS+DD+ VND+S+ DY+     KH TY PHTAGRY  KRFRKAQ
Sbjct  10   NPEANQAIYDVKLFNRWSFDDINVNDISLADYV-GVQVKHATYVPHTAGRYSVKRFRKAQ  68

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV IVKHAMEIIHLLTD NPIQVIVDAV+NSGPREDA
Sbjct  69   CPIVERLTNSLQMHGRNNGKKLKAVTIVKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDA  128

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  129  TRIGSAGVVRR  139



>ref|XP_011039530.1| PREDICTED: 40S ribosomal protein S5 isoform X2 [Populus euphratica]
Length=195

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  +    + LFNRWS+DD+ VND+S+ DY+     KH TY PHTAGRY  KRFRKAQ
Sbjct  10   NPEANQAIYDVKLFNRWSFDDINVNDISLADYV-GVQVKHATYVPHTAGRYSVKRFRKAQ  68

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV IVKHAMEIIHLLTD NPIQVIVDAV+NSGPREDA
Sbjct  69   CPIVERLTNSLQMHGRNNGKKLKAVTIVKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDA  128

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  129  TRIGSAGVVRR  139



>ref|XP_002309278.1| 40S ribosomal protein S5-2 [Populus trichocarpa]
 gb|EEE92801.1| 40S ribosomal protein S5-2 [Populus trichocarpa]
Length=208

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  + H  + LFNRW+++D+ VND+S+ DYI    AKH TY PHTAGRY  KRFRKAQ
Sbjct  11   NPEVIQPHHDVKLFNRWTFEDITVNDISLADYI-GVQAKHATYVPHTAGRYSVKRFRKAQ  69

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV I+KHAMEIIHLLTD NP+QVIVDAV+NSGPREDA
Sbjct  70   CPIVERLTNSLQMHGRNNGKKLKAVTIIKHAMEIIHLLTDQNPVQVIVDAVVNSGPREDA  129

Query  489  TRIGSAGVVRR  521
            TRIGSAGVVRR
Sbjct  130  TRIGSAGVVRR  140



>ref|XP_003062276.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53095.1| predicted protein [Micromonas pusilla CCMP1545]
Length=194

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLV  332
            S I LF +W+YDDV++ND+S++DYI    +KH  Y PHTAGRY  KRFRKAQCP+VERLV
Sbjct  5    SEIKLFGKWTYDDVEINDISLEDYI-GVKSKHAVYVPHTAGRYAQKRFRKAQCPIVERLV  63

Query  333  NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGV  512
            N+LMMHGRNNGKKLMAVRIVKH M+IIHLL+D NPIQVIVDA+IN+GPREDATR+GSAGV
Sbjct  64   NALMMHGRNNGKKLMAVRIVKHTMDIIHLLSDQNPIQVIVDAIINAGPREDATRVGSAGV  123

Query  513  VRR  521
            +RR
Sbjct  124  IRR  126



>ref|XP_001418582.1| Ribosomal protein S5, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96875.1| Ribosomal protein S5, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF +W++DDV++ND+S++DYI A   K+  Y PHTAGR+ AKRFRKAQCP+VERLVNSLM
Sbjct  9    LFGKWTFDDVEINDISLEDYI-AVKPKYAVYVPHTAGRFAAKRFRKAQCPIVERLVNSLM  67

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHAMEIIHLLTD NP+QVIVDA+I +GPREDATRIGSAGVVRR
Sbjct  68   MHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPVQVIVDAIIYAGPREDATRIGSAGVVRR  126



>ref|XP_002982486.1| hypothetical protein SELMODRAFT_228853 [Selaginella moellendorffii]
 gb|EFJ16239.1| hypothetical protein SELMODRAFT_228853 [Selaginella moellendorffii]
Length=204

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 113/134 (84%), Gaps = 3/134 (2%)
 Frame = +3

Query  120  QSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFR  299
            ++V  ++    S + LFN WSY+D++++D+S+ DYI   A++  TY PHTAGRY  KRFR
Sbjct  6    EAVAVEKPAASSDVKLFNAWSYEDIEIHDISLHDYI---ASRRATYVPHTAGRYSKKRFR  62

Query  300  KAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPR  479
            KAQCP+VERL NSLMMHGRNNGKKLMA RIVKHAMEIIHLLTD NPIQ+IVDA+INSGPR
Sbjct  63   KAQCPIVERLTNSLMMHGRNNGKKLMAGRIVKHAMEIIHLLTDANPIQIIVDAIINSGPR  122

Query  480  EDATRIGSAGVVRR  521
            EDATRIGSAGVVRR
Sbjct  123  EDATRIGSAGVVRR  136



>ref|XP_002981007.1| hypothetical protein SELMODRAFT_271466 [Selaginella moellendorffii]
 gb|EFJ17708.1| hypothetical protein SELMODRAFT_271466 [Selaginella moellendorffii]
Length=204

 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 113/134 (84%), Gaps = 3/134 (2%)
 Frame = +3

Query  120  QSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFR  299
            ++V  ++    S + LFN WSY+D++++D+S+ DYI   A++  TY PHTAGRY  KRFR
Sbjct  6    EAVAVEKPAASSDVKLFNCWSYEDIEIHDISLHDYI---ASRRATYVPHTAGRYSKKRFR  62

Query  300  KAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPR  479
            KAQCP+VERL NSLMMHGRNNGKKLMA RIVKHAMEIIHLLTD NPIQ+IVDA+INSGPR
Sbjct  63   KAQCPIVERLTNSLMMHGRNNGKKLMAGRIVKHAMEIIHLLTDANPIQIIVDAIINSGPR  122

Query  480  EDATRIGSAGVVRR  521
            EDATRIGSAGVVRR
Sbjct  123  EDATRIGSAGVVRR  136



>ref|XP_002501578.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62836.1| predicted protein [Micromonas sp. RCC299]
Length=195

 Score =   206 bits (525),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WSY+DV++ND+S++DYI    +KH  Y PHTAGRY  KRFRKAQCP+ ERLVN+
Sbjct  8    IKLFGKWSYEDVEINDISLEDYI-GVKSKHAVYVPHTAGRYAQKRFRKAQCPITERLVNA  66

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHAM+IIHLL+D NPIQVIVDA+IN+GPREDATR+GSAGV+R
Sbjct  67   LMMHGRNNGKKLMAVRIVKHAMDIIHLLSDQNPIQVIVDAIINAGPREDATRVGSAGVIR  126

Query  519  R  521
            R
Sbjct  127  R  127



>ref|XP_011095643.1| PREDICTED: 40S ribosomal protein S5-like [Sesamum indicum]
Length=173

 Score =   205 bits (522),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +3

Query  207  LSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVR  386
            +SV+DYITAT+AKHP Y PHTAGRYQ KRFRKAQCP+VERL NSLMMHGRNNGKKLMAVR
Sbjct  1    MSVEDYITATSAKHPIYMPHTAGRYQQKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVR  60

Query  387  IVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            IVKHAMEIIHLLTD NPIQ+IVDAVINSGPREDATRIGSAGVVRR
Sbjct  61   IVKHAMEIIHLLTDQNPIQIIVDAVINSGPREDATRIGSAGVVRR  105



>ref|XP_002961831.1| hypothetical protein SELMODRAFT_164593 [Selaginella moellendorffii]
 ref|XP_002980818.1| hypothetical protein SELMODRAFT_113426 [Selaginella moellendorffii]
 gb|EFJ18003.1| hypothetical protein SELMODRAFT_113426 [Selaginella moellendorffii]
 gb|EFJ37091.1| hypothetical protein SELMODRAFT_164593 [Selaginella moellendorffii]
Length=202

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 3/119 (3%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN W+Y++++V+D+S++DYI+A   K  TY PHTAGRY  KRFRKAQCP+VERL NSLM
Sbjct  19   LFNAWTYEEIEVHDISLEDYISA---KRATYVPHTAGRYSKKRFRKAQCPIVERLTNSLM  75

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMA RIVKHAMEIIHLLTD NPIQ+IVDA+INSGPREDATRIGSAGV+RR
Sbjct  76   MHGRNNGKKLMAGRIVKHAMEIIHLLTDANPIQIIVDAIINSGPREDATRIGSAGVIRR  134



>gb|KFH70431.1| 40S ribosomal protein S5 [Mortierella verticillata NRRL 6337]
Length=201

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            P   +    + LFN+WSYDDV+V D+S+ DYI     K P Y PHTAGR+ +KRFRKAQC
Sbjct  7    PAGIETDGAVRLFNKWSYDDVEVKDISLIDYIQV---KAPVYLPHTAGRFASKRFRKAQC  63

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NSLMMHGRNNGKKLMAVRIVKHA EIIHLL+D NPIQV+VDA+IN+GPRED+T
Sbjct  64   PIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLSDQNPIQVLVDAIINTGPREDST  123

Query  492  RIGSAGVVRR  521
            RIGSAG VRR
Sbjct  124  RIGSAGTVRR  133



>ref|XP_005648374.1| ribosomal protein S5 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23830.1| ribosomal protein S5 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=196

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF +WS+DDV+V+D++++DYI A   K   Y PHTAGRYQ KRFRKAQCP+VER+ +SLM
Sbjct  11   LFGKWSFDDVEVSDMALEDYI-AVKPKTARYVPHTAGRYQKKRFRKAQCPIVERITDSLM  69

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRI+KHA EI+HLLTD NPIQV+VDAVINSGPREDATRIGSAGV+RR
Sbjct  70   MHGRNNGKKLMAVRIIKHAFEIVHLLTDQNPIQVLVDAVINSGPREDATRIGSAGVIRR  128



>ref|XP_002946634.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52561.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=193

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF +WS++D++V D+S++DYI A   K+  Y PHTAGRYQ KRFRKA CP+VERL NSLM
Sbjct  8    LFGKWSFEDIEVQDISLEDYI-AVKTKYAVYVPHTAGRYQKKRFRKALCPIVERLCNSLM  66

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHA +IIHLLTD NPIQV+VDA+INSGPREDATRIGSAGVVRR
Sbjct  67   MHGRNNGKKLMAVRIVKHAFDIIHLLTDQNPIQVLVDAIINSGPREDATRIGSAGVVRR  125



>gb|ERZ98087.1| hypothetical protein GLOINDRAFT_289070 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX60099.1| ribosomal 40S subunit protein S5 [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX60101.1| ribosomal 40S subunit protein S5 [Rhizophagus irregularis DAOM 
197198w]
Length=200

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  156  GILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVN  335
            GI LFN+W+Y+DV+V D+S+ DYI     ++P Y  HTAGR+  KRFRKAQCPVVERL N
Sbjct  14   GIRLFNKWTYEDVEVKDISLTDYI---QIRNPVYLSHTAGRFSTKRFRKAQCPVVERLTN  70

Query  336  SLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVV  515
            SLMMHGRNNGKKLMAVRIVKHA EIIHLLTD NPIQV+VDA+IN+GPRED+TRIGSAG V
Sbjct  71   SLMMHGRNNGKKLMAVRIVKHAFEIIHLLTDQNPIQVLVDAIINTGPREDSTRIGSAGTV  130

Query  516  RR  521
            RR
Sbjct  131  RR  132



>ref|XP_005704631.1| 40S ribosomal protein S5e [Galdieria sulphuraria]
 gb|EME28111.1| 40S ribosomal protein S5e [Galdieria sulphuraria]
Length=191

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFNRWS++DV+VND+S+ DYI A   K+  Y PHTAGRY  KRFRKAQCP+VERLVNSLM
Sbjct  6    LFNRWSFEDVEVNDMSLHDYI-AVKQKYAVYLPHTAGRYAVKRFRKAQCPIVERLVNSLM  64

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVK A EIIHLLTD NP+QV V AV+N+GPRED+TRIGSAG VRR
Sbjct  65   MHGRNNGKKLMAVRIVKQAFEIIHLLTDANPVQVFVQAVMNAGPREDSTRIGSAGTVRR  123



>ref|XP_001695400.1| ribosomal protein S5, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP01658.1| ribosomal protein S5 [Chlamydomonas reinhardtii]
Length=193

 Score =   201 bits (512),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LF +WS++D++V D+S++DYI A   K+  Y PHTAGRYQ +RFRKA CP+VERL NSLM
Sbjct  8    LFGKWSFEDIEVTDISLEDYI-AVKTKYAVYVPHTAGRYQKRRFRKALCPIVERLCNSLM  66

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMAVRIVKHA +IIHLLTD NPIQV+VDA+INSGPREDATRIGSAGVVRR
Sbjct  67   MHGRNNGKKLMAVRIVKHAFDIIHLLTDQNPIQVVVDAIINSGPREDATRIGSAGVVRR  125



>gb|EXX60100.1| ribosomal 40S subunit protein S5 [Rhizophagus irregularis DAOM 
197198w]
Length=185

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  156  GILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVN  335
            GI LFN+W+Y+DV+V D+S+ DYI     ++P Y  HTAGR+  KRFRKAQCPVVERL N
Sbjct  14   GIRLFNKWTYEDVEVKDISLTDYI---QIRNPVYLSHTAGRFSTKRFRKAQCPVVERLTN  70

Query  336  SLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVV  515
            SLMMHGRNNGKKLMAVRIVKHA EIIHLLTD NPIQV+VDA+IN+GPRED+TRIGSAG V
Sbjct  71   SLMMHGRNNGKKLMAVRIVKHAFEIIHLLTDQNPIQVLVDAIINTGPREDSTRIGSAGTV  130

Query  516  RR  521
            RR
Sbjct  131  RR  132



>gb|EPS72966.1| hypothetical protein M569_01791, partial [Genlisea aurea]
Length=103

 Score =   197 bits (502),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            ++LFNRWSYD V+VNDLSV+DYITATAAKHP Y PHTAGRYQA+RFRKAQCP+VERL NS
Sbjct  2    VMLFNRWSYDGVEVNDLSVEDYITATAAKHPIYMPHTAGRYQARRFRKAQCPIVERLTNS  61

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVI  464
            LMMHGRNNGKKLMAVRIVKHAMEIIHLLTD NPIQVIVDAVI
Sbjct  62   LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPIQVIVDAVI  103



>gb|KHN04278.1| 40S ribosomal protein S5 [Glycine soja]
Length=206

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  RWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHG  353
            R +  D++V D+S+ DYI   A+KH TY PHTAGRY  KRFRKAQCP+VERL NSLMMHG
Sbjct  23   RNAEKDIEVTDISLADYIGVAASKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLMMHG  82

Query  354  RNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            RNNGKKL+AVRI+KHAMEIIHLLTD NPIQVIVDAVINSGPREDATRIGSAGVVRR
Sbjct  83   RNNGKKLLAVRIIKHAMEIIHLLTDQNPIQVIVDAVINSGPREDATRIGSAGVVRR  138



>gb|EWC43427.1| 40S ribosomal protein S5 [Drechslerella stenobrocha 248]
Length=259

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 4/135 (3%)
 Frame = +3

Query  120  QSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRF  296
            Q+V P+E     G I LFN+WSY+DV+V+D+S++DYI   A   P YTPH+AGRY  KRF
Sbjct  60   QNVLPKEVTDELGSIKLFNKWSYEDVRVSDISLEDYIQIQA---PVYTPHSAGRYATKRF  116

Query  297  RKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGP  476
            RKA+CP++ERL NSLMM+GRNNGKKLMAVRIVKH+ EIIHLLTDLNPIQV VDA++N GP
Sbjct  117  RKAKCPIIERLTNSLMMNGRNNGKKLMAVRIVKHSFEIIHLLTDLNPIQVAVDAIVNCGP  176

Query  477  REDATRIGSAGVVRR  521
            RED+TRIGSAG VRR
Sbjct  177  REDSTRIGSAGTVRR  191



>gb|KJB28207.1| hypothetical protein B456_005G034200, partial [Gossypium raimondii]
Length=133

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  144  KVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVE  323
            K H  + LFNRWS+++VQV+D+S+ DYI    +KH TY PHTAGRY  KRFRKAQCP+VE
Sbjct  18   KSHPDVKLFNRWSFEEVQVSDISLSDYIGVQPSKHATYVPHTAGRYSVKRFRKAQCPIVE  77

Query  324  RLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            RL NSLMMHGRNNGKKLMAVRIVKHAMEII+LLTD NPIQVIVDA+INSGPREDAT
Sbjct  78   RLTNSLMMHGRNNGKKLMAVRIVKHAMEIIYLLTDQNPIQVIVDAIINSGPREDAT  133



>ref|XP_006678213.1| hypothetical protein BATDEDRAFT_87732 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81467.1| hypothetical protein BATDEDRAFT_87732 [Batrachochytrium dendrobatidis 
JAM81]
Length=201

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 2/129 (2%)
 Frame = +3

Query  135  QEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            + E+  + I LFN+WSY D++V D+S+ DY+      +P Y PHTAGRYQ +RFRKAQCP
Sbjct  7    ESEETTTSIKLFNKWSYHDIEVKDISLQDYVMVKT--NPVYLPHTAGRYQVRRFRKAQCP  64

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            +VERL NSLMMHGRNNGKKLMA RIVKHA EI+HLLTD NPIQV+VDAV+N+GPRED+TR
Sbjct  65   LVERLANSLMMHGRNNGKKLMAARIVKHAFEIVHLLTDQNPIQVLVDAVLNTGPREDSTR  124

Query  495  IGSAGVVRR  521
            IGS G VRR
Sbjct  125  IGSQGTVRR  133



>ref|XP_008350249.1| PREDICTED: 40S ribosomal protein S5 [Malus domestica]
Length=182

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +3

Query  189  DVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGK  368
            D++V+D+S+ DY+    +KH TY PHTAGRY  KRFRKAQCP+VERL NSLMMHGRNNGK
Sbjct  4    DLEVSDISLADYVGVAPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLMMHGRNNGK  63

Query  369  KLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            KLMAVRIV+HAMEIIHLLTDLNPIQVIVDAV+NSGPREDATRIGSAGVVRR
Sbjct  64   KLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSAGVVRR  114



>ref|XP_001909825.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70959.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP27554.1| Putative cytosolic 40S ribosomal protein Rps5 [Podospora anserina 
S mat+]
Length=210

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 4/139 (3%)
 Frame = +3

Query  108  EEKAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQ  284
            E +A  V P+E     G I LFNRWSYDDV++ D+S+ DYI   A   P Y PH+AGRY 
Sbjct  7    EVQAYEVLPKEVAAEVGSIKLFNRWSYDDVEIRDISLTDYIQIRA---PVYLPHSAGRYA  63

Query  285  AKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVI  464
            AKRFRKA CP++ERL NSLMMHGRNNGKK+MAVRIV HA EIIHL+TD NPIQ+ VDA++
Sbjct  64   AKRFRKANCPIIERLTNSLMMHGRNNGKKMMAVRIVAHAFEIIHLMTDQNPIQIAVDAIV  123

Query  465  NSGPREDATRIGSAGVVRR  521
            N GPRED+TRIGSAG VRR
Sbjct  124  NCGPREDSTRIGSAGTVRR  142



>emb|CAJ45370.1| 40S ribosomal protein S5 [Chlamydomonas sp. ICE-L]
Length=197

 Score =   199 bits (506),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLV  332
            + I LF +WS+DDV+V D+S++DYI A   K   Y PHTAGRYQ KRFRKA CP+VERL 
Sbjct  8    ADIKLFGKWSFDDVEVTDISLEDYI-AVKPKFAVYVPHTAGRYQKKRFRKALCPIVERLA  66

Query  333  NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGV  512
             SLMMHGRNNGKKL+AVRIVKHA EII+LLTD NPIQV+VDA+INSGPREDATRIGSAGV
Sbjct  67   VSLMMHGRNNGKKLLAVRIVKHAFEIINLLTDQNPIQVVVDAIINSGPREDATRIGSAGV  126

Query  513  VRR  521
            VRR
Sbjct  127  VRR  129



>gb|AAP80699.1| 40S ribosome protein S5 [Griffithsia japonica]
Length=194

 Score =   199 bits (506),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LFNRWS+DDV+V D+ + DYI A   KH  Y PHTAGRY +KRF+KAQCP+VERLV S
Sbjct  7    IKLFNRWSFDDVRVEDMCLADYI-AVNQKHAVYLPHTAGRYNSKRFKKAQCPIVERLVCS  65

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKK+MAVRIVKH+ EII+LLTD NPIQV+VDAV+NSGPRED+TRIGSAG VR
Sbjct  66   LMMHGRNNGKKVMAVRIVKHSFEIINLLTDQNPIQVLVDAVVNSGPREDSTRIGSAGTVR  125

Query  519  R  521
            R
Sbjct  126  R  126



>gb|ABK93154.1| unknown [Populus trichocarpa]
Length=142

 Score =   197 bits (500),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +3

Query  129  NPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            NP+  + H  + LFNRW+++D+ VND+S+ DYI    AKH TY PHTAGRY  KRFRKAQ
Sbjct  11   NPEVIQPHHDVKLFNRWTFEDITVNDISLADYI-GVQAKHATYVPHTAGRYSVKRFRKAQ  69

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL NSL MHGRNNGKKL AV I+KHAMEIIHLLTD NP+QVIVDAV+NSGPREDA
Sbjct  70   CPIVERLTNSLQMHGRNNGKKLKAVTIIKHAMEIIHLLTDQNPVQVIVDAVVNSGPREDA  129

Query  489  TRIGSA  506
            TRIGS 
Sbjct  130  TRIGSG  135



>gb|KJB16490.1| hypothetical protein B456_002G232600 [Gossypium raimondii]
Length=220

 Score =   199 bits (507),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  102  PQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRY  281
            P+      V     K  + + LFN WS+ D+++ D+S+ DYI   A+KH TY PHTAGRY
Sbjct  13   PKATTITGVVVNSTKNENEVKLFNCWSFQDLEIGDISLSDYIGVHASKHATYVPHTAGRY  72

Query  282  QAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAV  461
              KRFRKAQCP+V+RL +SLMMHGRNNGKKL+AVRI+KHAMEI++LLTD NPIQVI DA+
Sbjct  73   LVKRFRKAQCPIVKRLAHSLMMHGRNNGKKLIAVRIIKHAMEIVYLLTDQNPIQVIADAI  132

Query  462  INSGPREDATRIGSAGVVRR  521
            +NSGPREDAT IGSAGVVRR
Sbjct  133  VNSGPREDATSIGSAGVVRR  152



>ref|XP_011396407.1| 40S ribosomal protein S5-2 [Auxenochlorella protothecoides]
 gb|KFM23534.1| 40S ribosomal protein S5-2 [Auxenochlorella protothecoides]
Length=203

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = +3

Query  141  EKVH--SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCP  314
            EKV   + + LF +WS+++++V DLS+ DYI A  AKH  YTPH+AGR+Q +RFRKAQCP
Sbjct  8    EKVREATNVKLFGKWSFNELEVTDLSLIDYI-AVKAKHDRYTPHSAGRFQKRRFRKAQCP  66

Query  315  VVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATR  494
            VVERL NSLMMHGRNNGKK MAVRIV+HA EI+HLLTD NPIQV+V A+IN GPREDATR
Sbjct  67   VVERLTNSLMMHGRNNGKKQMAVRIVQHAFEIVHLLTDQNPIQVLVQAIINGGPREDATR  126

Query  495  IGSAGVVRR  521
            IGSAGVVRR
Sbjct  127  IGSAGVVRR  135



>ref|XP_004351577.1| ribosomal protein S7p/S5e, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22800.1| ribosomal protein S7p/S5e, putative [Acanthamoeba castellanii 
str. Neff]
Length=198

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAA-KHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSL  341
            LFNRW++DDV V+D+S+ DYI      K+ T+ PHTAGRY  KRFRKAQCP+VER+ NSL
Sbjct  11   LFNRWTFDDVTVSDMSLTDYIAVKQKPKYYTFLPHTAGRYAQKRFRKAQCPIVERMTNSL  70

Query  342  MMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MMHGRNNGKKL+AV+I+KHA EIIHLLTD NP+Q++VDA+INSGPRED+TRIGSAG VRR
Sbjct  71   MMHGRNNGKKLLAVKIMKHAFEIIHLLTDANPLQILVDAIINSGPREDSTRIGSAGTVRR  130



>ref|XP_005712066.1| unnamed protein product [Chondrus crispus]
 emb|CDF32401.1| unnamed protein product [Chondrus crispus]
Length=255

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LFNRWS++DV+V D+ + DYI A   KH  Y PHTAGRY +KRFRKAQCP+VERLV S
Sbjct  68   IKLFNRWSFEDVRVEDMCLADYI-AVNQKHAVYLPHTAGRYNSKRFRKAQCPIVERLVCS  126

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKK+MAVRIVKH  EIIHLLTD NPIQV+V+AV+NSGPRED+TRIGSAG VR
Sbjct  127  LMMHGRNNGKKIMAVRIVKHCFEIIHLLTDQNPIQVLVEAVVNSGPREDSTRIGSAGTVR  186

Query  519  R  521
            R
Sbjct  187  R  187



>ref|XP_963230.2| 40s ribosomal protein s5 [Neurospora crassa OR74A]
 sp|Q7RVI1.2|RS5_NEUCR RecName: Full=40S ribosomal protein S5 [Neurospora crassa OR74A]
 emb|CAE75742.1| probable 40S ribosomal protein S5 [Neurospora crassa]
 gb|EAA33994.2| 40s ribosomal protein s5 [Neurospora crassa OR74A]
Length=213

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 114/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  72   EGAVAVHSVNPQEEKAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKH  248
            EG V V +V+  E     V P+E     G + LFNRWSY+DV++ D+S+ DYI     + 
Sbjct  3    EGEVDVAAVSQYE-----VLPKEVLAEVGSVKLFNRWSYEDVEIRDISLTDYIQI---RS  54

Query  249  PTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  428
            P Y PH+AGRY AKRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIHL+TD
Sbjct  55   PVYLPHSAGRYAAKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIHLMTD  114

Query  429  LNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
             NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  115  QNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  145



>gb|KHG10064.1| 40S ribosomal S5 [Gossypium arboreum]
Length=215

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = +3

Query  78   AVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTY  257
             V V+S   + EKAQ + P  E     + LFNRWS+ D+++ D+S+ DYI   A+ H TY
Sbjct  22   GVIVNSTKNENEKAQ-IEPYTE-----VKLFNRWSFQDLEIGDISLSDYIGVHASTHATY  75

Query  258  TPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNP  437
             PHTAGRY  KRF KAQCP+VERL NSLMMHG+NNGKKL A+RI+KHAMEII+LLTD NP
Sbjct  76   VPHTAGRYSVKRFGKAQCPIVERLANSLMMHGQNNGKKLTALRIIKHAMEIIYLLTDQNP  135

Query  438  IQVIVDAVINSGPREDATRIGSAGVVR  518
             QVIVD ++NSGPRE ATRIGSAGVVR
Sbjct  136  NQVIVDTIVNSGPREYATRIGSAGVVR  162



>emb|CCJ30839.1| unnamed protein product [Pneumocystis jirovecii]
Length=212

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 110/137 (80%), Gaps = 4/137 (3%)
 Frame = +3

Query  114  KAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAK  290
            + Q+V P +     G I LFN+WSY+DV+V D+S+ DYI     + PTY  HTAGRYQ K
Sbjct  11   RVQTVLPNDIMEEIGQIKLFNKWSYEDVEVKDISLTDYIQI---RQPTYLNHTAGRYQVK  67

Query  291  RFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINS  470
            RFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIVKHA EIIHLLTD NPIQV+VDA++N 
Sbjct  68   RFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVKHAFEIIHLLTDQNPIQVVVDAIVNC  127

Query  471  GPREDATRIGSAGVVRR  521
            G RED+TRIGSAG VRR
Sbjct  128  GVREDSTRIGSAGTVRR  144



>ref|XP_005539558.1| 40S ribosomal protein S5 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83522.1| 40S ribosomal protein S5 [Cyanidioschyzon merolae strain 10D]
Length=197

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            ILLFN+WS +DV+V+D+++ DYI A   K+  Y PHTAGRYQ +RF+KAQCP+VERLVN+
Sbjct  10   ILLFNKWSLEDVEVSDIALADYI-AVKQKYAVYLPHTAGRYQTRRFKKAQCPIVERLVNA  68

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LM HGRNNGKKLMAVRIVKH  EI+H+LTD NP+Q++VDAVINSGPRED+TRIGSAG VR
Sbjct  69   LMKHGRNNGKKLMAVRIVKHCFEIMHVLTDQNPVQILVDAVINSGPREDSTRIGSAGTVR  128

Query  519  R  521
            R
Sbjct  129  R  129



>ref|XP_001228475.1| 40S ribosomal protein S5 [Chaetomium globosum CBS 148.51]
 gb|EAQ84144.1| 40s ribosomal protein S5 [Chaetomium globosum CBS 148.51]
Length=212

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
             E ++E A + + V P+E  A+            + LFNRWSY+DV++ D+S+ DYI   
Sbjct  2    SEGEVEVASSSYEVLPKEVLAEV---------GSVKLFNRWSYEDVEIRDISLTDYIQI-  51

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              + P Y PH+AGRY AKRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIH
Sbjct  52   --RSPVYLPHSAGRYAAKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIH  109

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            L+TD NPIQ+ VDAV+N GPRED+TRIGSAG VRR
Sbjct  110  LMTDQNPIQIAVDAVVNCGPREDSTRIGSAGTVRR  144



>ref|XP_002109401.1| 40S ribosomal protein S5 [Trichoplax adhaerens]
 gb|EDV27567.1| 40S ribosomal protein S5 [Trichoplax adhaerens]
Length=203

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 7/130 (5%)
 Frame = +3

Query  132  PQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQC  311
            PQE K      LF +WS DDVQ+ D+S++DYI A   +H TY PHT+GRY AKRFRKAQC
Sbjct  13   PQEVK------LFGKWSTDDVQIGDISLNDYI-AVKERHATYLPHTSGRYSAKRFRKAQC  65

Query  312  PVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDAT  491
            P+VERL NS+MMHGRNNGKKL+AVRIVKH+ EIIHLLT+ NP+QV+V+A+INSGPRED+T
Sbjct  66   PIVERLTNSMMMHGRNNGKKLLAVRIVKHSFEIIHLLTNENPLQVLVNAIINSGPREDST  125

Query  492  RIGSAGVVRR  521
            RIG AG VRR
Sbjct  126  RIGRAGTVRR  135



>gb|KDD76112.1| ribosomal protein S7p/S5e [Helicosporidium sp. ATCC 50920]
Length=195

 Score =   196 bits (499),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            + LF +WS++DV+VND+S++DY+ A   K   +TPH+AGR+Q +RFRKAQCP+VERL NS
Sbjct  8    VKLFGKWSFEDVEVNDISLEDYL-AVKPKFARFTPHSAGRFQKRRFRKAQCPIVERLTNS  66

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKK MAVRIV+HA EI+HLL+D NPIQV+VDA+IN GPREDATRIGSAGVVR
Sbjct  67   LMMHGRNNGKKQMAVRIVQHAFEIVHLLSDQNPIQVLVDAIINGGPREDATRIGSAGVVR  126

Query  519  R  521
            R
Sbjct  127  R  127



>ref|XP_003667290.1| hypothetical protein MYCTH_2312962 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO62045.1| hypothetical protein MYCTH_2312962 [Myceliophthora thermophila 
ATCC 42464]
Length=212

 Score =   196 bits (499),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
             E ++E A + + V P+E  A+            + LFNRWSY+DV++ D+S+ DYI   
Sbjct  2    SEGEVEVATSSYDVLPKEVLAEV---------GSVKLFNRWSYEDVEIRDISLTDYIQI-  51

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              + P Y PH+AGRY  KRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIH
Sbjct  52   --RSPVYIPHSAGRYATKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIH  109

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            L+TD NPIQV VDA++N GPRED+TRIGSAG VRR
Sbjct  110  LMTDQNPIQVAVDAIVNCGPREDSTRIGSAGTVRR  144



>ref|XP_505167.1| 40S ribosomal protein S5 [Yarrowia lipolytica]
 emb|CAG77974.1| YALI0F08569p [Yarrowia lipolytica CLIB122]
Length=210

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +3

Query  132  PQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQ  308
            P++    SG + LFN+W+YDDV+V D+S+ DY+  +    P Y PHTAGRY  KRFRKAQ
Sbjct  15   PKDIIAESGSVKLFNKWTYDDVEVKDISLTDYVQIS---QPVYIPHTAGRYANKRFRKAQ  71

Query  309  CPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDA  488
            CP+VERL N+LMM+GRNNGKKL AVRIV+HA+EIIHLLTDLNP+QV+VDA+IN GPRED+
Sbjct  72   CPIVERLTNALMMNGRNNGKKLKAVRIVEHALEIIHLLTDLNPLQVVVDAIINCGPREDS  131

Query  489  TRIGSAGVVRR  521
            TRIGS+G VRR
Sbjct  132  TRIGSSGAVRR  142



>gb|ACI23255.1| ribosomal protein S5 [Auxenochlorella protothecoides]
Length=208

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS+D+V+VND+S++DYI A   K+  +TPH+AGR+Q +RFRKAQCP+VERL NS
Sbjct  21   IKLFGKWSFDEVEVNDISLEDYI-AVKPKYARFTPHSAGRFQKRRFRKAQCPIVERLTNS  79

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKH  +II+LLTD NPIQV+V A+IN GPREDATRIGSAGVVR
Sbjct  80   LMMHGRNNGKKLMAVRIVKHTFDIINLLTDQNPIQVLVGAIINGGPREDATRIGSAGVVR  139

Query  519  R  521
            R
Sbjct  140  R  140



>ref|XP_003351162.1| 40S ribosomal protein S5 [Sordaria macrospora k-hell]
 ref|XP_009851692.1| hypothetical protein NEUTE1DRAFT_117193 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO56048.1| hypothetical protein NEUTE1DRAFT_117193 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ71103.1| putative 40S ribosomal protein S5 [Neurospora tetrasperma FGSC 
2509]
 emb|CCC14011.1| unnamed protein product [Sordaria macrospora k-hell]
Length=213

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 113/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  72   EGAVAVHSVNPQEEKAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKH  248
            EG V V +V+  E     V P+E     G + LFNRWSY+DV++ D+S+ DYI     + 
Sbjct  3    EGEVDVAAVSQYE-----VLPKEVLAEVGSVKLFNRWSYEDVEIRDISLTDYIQI---RS  54

Query  249  PTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  428
            P Y PH+AGRY  KRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIHL+TD
Sbjct  55   PVYLPHSAGRYAVKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIHLMTD  114

Query  429  LNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
             NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  115  QNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  145



>ref|XP_001389720.1| 40S ribosomal protein S5 [Aspergillus niger CBS 513.88]
 emb|CAK96189.1| unnamed protein product [Aspergillus niger]
 gb|EHA27052.1| hypothetical protein ASPNIDRAFT_55252 [Aspergillus niger ATCC 
1015]
 dbj|GAA86742.1| 40S ribosomal protein S5 [Aspergillus kawachii IFO 4308]
Length=215

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
            GE ++E   A   V P+E  A+            + LFN+WSY+DV++ D+S+ DY+   
Sbjct  5    GEVEVENPAAAFQVLPKEAIAE---------MGSVKLFNKWSYEDVEIRDISLTDYVQI-  54

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              + P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMAVRIV HA EIIH
Sbjct  55   --RSPVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAVRIVAHAFEIIH  112

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            ++TD NP+QV VDA++N GPRED+TRIGSAG VRR
Sbjct  113  IMTDQNPLQVAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_011108201.1| hypothetical protein H072_2214 [Dactylellina haptotyla CBS 200.50]
 gb|EPS43808.1| hypothetical protein H072_2214 [Dactylellina haptotyla CBS 200.50]
Length=267

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 3/122 (2%)
 Frame = +3

Query  156  GILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVN  335
             I LFN+WSY+DV+V D+S++DYI   A   P Y PH+AGRY  KRFRKA+CP++ERL N
Sbjct  81   AIKLFNKWSYEDVRVTDISLEDYIQIQA---PVYIPHSAGRYATKRFRKAKCPIIERLTN  137

Query  336  SLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVV  515
            SLMM+GRNNGKKLMAVRIVKH+ EIIHLLTDLNPIQV VDA++N GPRED+TRIGSAG V
Sbjct  138  SLMMNGRNNGKKLMAVRIVKHSFEIIHLLTDLNPIQVAVDAIVNCGPREDSTRIGSAGTV  197

Query  516  RR  521
            RR
Sbjct  198  RR  199



>ref|XP_003658186.1| 40S ribosomal protein S5 [Thielavia terrestris NRRL 8126]
 gb|AEO71850.1| hypothetical protein THITE_2124701 [Thielavia terrestris NRRL 
8126]
Length=212

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 113/155 (73%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
             E ++E A + + V P+E  A+            + LFNRWSY+DV++ D+S+ DYI   
Sbjct  2    SEGEVEVATSSYEVLPKEVLAEV---------GSVKLFNRWSYEDVEIRDISLTDYIQI-  51

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              + P Y PH+AGRY  KRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIH
Sbjct  52   --RSPVYIPHSAGRYAVKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIH  109

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            L+TD NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  110  LMTDQNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  144



>ref|XP_002430077.1| 40S ribosomal protein S5, putative [Pediculus humanus corporis]
 gb|EEB17339.1| 40S ribosomal protein S5, putative [Pediculus humanus corporis]
Length=205

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RWS DDVQV+D+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  18   IKLFGRWSCDDVQVSDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  76

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+Q++V A+INSGPRED+TRIG AG VR
Sbjct  77   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQILVSAIINSGPREDSTRIGRAGTVR  136

Query  519  R  521
            R
Sbjct  137  R  137



>ref|XP_006692042.1| 40S ribosomal protein s5-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS23050.1| 40S ribosomal protein s5-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=212

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 112/151 (74%), Gaps = 10/151 (7%)
 Frame = +3

Query  72   EGAVAVHSVNPQEEKAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKH  248
            EG V V    PQ +    V P+E     G + LFNRWSYDD+++ D+S+ DYI   A   
Sbjct  3    EGEVEV--AQPQYD----VLPKEVLAEVGSVKLFNRWSYDDIEIRDISLTDYIQIRA---  53

Query  249  PTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  428
            P Y PH+AGRY  KRFRKA CP++ERL NSLMMHGRNNGKKLMAVRIV HA EIIHL+TD
Sbjct  54   PVYIPHSAGRYAVKRFRKANCPIIERLTNSLMMHGRNNGKKLMAVRIVAHAFEIIHLMTD  113

Query  429  LNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
             NPIQV VDA++N GPRED+TRIGSAG VRR
Sbjct  114  QNPIQVAVDAIVNCGPREDSTRIGSAGTVRR  144



>ref|XP_002844558.1| 40S ribosomal protein S5 [Arthroderma otae CBS 113480]
 gb|EEQ33703.1| 40s ribosomal protein s5 [Arthroderma otae CBS 113480]
Length=212

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 14/156 (9%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            DGE ++E     + V P++  A+  N         I LFN+WSY+D+QV D+S+ DYI  
Sbjct  3    DGEVEVE--TGAYDVLPKDVTAEMGN---------IKLFNKWSYEDIQVRDISLTDYIQI  51

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P YTPH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKK+MAVRIV HA EII
Sbjct  52   ---RQPVYTPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKVMAVRIVAHAFEII  108

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQ+ VDA+ N GPRED+TRIGSAG VRR
Sbjct  109  HIMTDQNPIQITVDAISNCGPREDSTRIGSAGTVRR  144



>ref|XP_009159509.1| 40S ribosomal protein S5 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59048.1| 40S ribosomal protein S5 [Exophiala dermatitidis NIH/UT8656]
Length=215

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 118/156 (76%), Gaps = 12/156 (8%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            +GE ++E  V+ ++V P++  A+            I LFN+WSY+DV++ D+S+ DYI  
Sbjct  4    NGEVEVEVPVSGYAVLPKDVTAEI---------GTIKLFNKWSYEDVEIRDISLTDYIQI  54

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIV HA EII
Sbjct  55   ---RSPVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVAHAFEII  111

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQV VDA++N GPRED+TRIGSAG VRR
Sbjct  112  HIMTDQNPIQVAVDAIVNCGPREDSTRIGSAGTVRR  147



>emb|CDS08967.1| Putative 40S ribosomal protein S5 [Absidia idahoensis var. thermophila]
Length=203

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WSY+DV+V D+S+ DYI     +   Y PHTAGR+  KRFRKAQCP+VERL NSLM
Sbjct  20   LFNKWSYEDVEVKDISLQDYIQV---RQHVYLPHTAGRFAVKRFRKAQCPIVERLTNSLM  76

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMA RIV+HA EIIHLLTD NPIQV+VDA+IN+GPRED+TRIGSAG VRR
Sbjct  77   MHGRNNGKKLMAARIVQHAFEIIHLLTDQNPIQVMVDAIINTGPREDSTRIGSAGTVRR  135



>gb|KDR08378.1| 40S ribosomal protein S5a [Zootermopsis nevadensis]
Length=218

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RWS DDVQV+D+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  31   IKLFGRWSCDDVQVSDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  89

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  90   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  149

Query  519  R  521
            R
Sbjct  150  R  150



>ref|XP_011152199.1| PREDICTED: 40S ribosomal protein S5 [Harpegnathos saltator]
 ref|XP_011152208.1| PREDICTED: 40S ribosomal protein S5 [Harpegnathos saltator]
 gb|EFN88677.1| 40S ribosomal protein S5 [Harpegnathos saltator]
Length=216

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>gb|KDR18597.1| 40S ribosomal protein S5a [Zootermopsis nevadensis]
Length=218

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RWS DDVQV+D+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  31   IKLFGRWSCDDVQVSDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  89

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  90   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  149

Query  519  R  521
            R
Sbjct  150  R  150



>gb|KIX02490.1| 40S ribosomal protein S5 [Rhinocladiella mackenziei CBS 650.93]
Length=215

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 116/156 (74%), Gaps = 12/156 (8%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            +GE ++E  V+  SV P++  A+            I LFN+WSY+DV++ D+S+ DYI  
Sbjct  4    NGEVEVENPVSAFSVLPKDVTAEI---------GSIKLFNKWSYEDVEIRDISLTDYIQI  54

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P Y  H+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIV HA EII
Sbjct  55   ---RSPVYISHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVAHAFEII  111

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  112  HIMTDQNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|NP_001264173.1| 40S ribosomal protein S5 isoform 2 [Rattus norvegicus]
Length=171

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>emb|CDS02852.1| Putative 40S ribosomal protein S5 [Absidia idahoensis var. thermophila]
 emb|CDS04492.1| Putative 40S ribosomal protein S5 [Absidia idahoensis var. thermophila]
Length=203

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WSY+DV+V D+S+ DYI     +   Y PHTAGR+  KRFRKAQCP+VERL NSLM
Sbjct  20   LFNKWSYEDVEVKDISLQDYIQV---RQHVYLPHTAGRFAVKRFRKAQCPIVERLTNSLM  76

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMA RIV+HA EIIHLLTD NPIQV+VDA+IN+GPRED+TRIGSAG VRR
Sbjct  77   MHGRNNGKKLMAARIVQHAFEIIHLLTDQNPIQVMVDAIINTGPREDSTRIGSAGTVRR  135



>ref|XP_011151778.1| PREDICTED: 40S ribosomal protein S5-like [Harpegnathos saltator]
 ref|XP_011151779.1| PREDICTED: 40S ribosomal protein S5-like [Harpegnathos saltator]
 ref|XP_011151780.1| PREDICTED: 40S ribosomal protein S5-like [Harpegnathos saltator]
 gb|EFN76325.1| 40S ribosomal protein S5a [Harpegnathos saltator]
Length=216

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>emb|CDS13855.1| Putative 40S ribosomal protein S5 [Absidia idahoensis var. thermophila]
Length=202

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +3

Query  165  LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLM  344
            LFN+WSY+DV+V D+S+ DYI     +   Y PHTAGR+  KRFRKAQCP+VERL NSLM
Sbjct  20   LFNKWSYEDVEVKDISLQDYIQV---RQHVYLPHTAGRFAVKRFRKAQCPIVERLTNSLM  76

Query  345  MHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            MHGRNNGKKLMA RIV+HA EIIHLLTD NPIQV+VDA+IN+GPRED+TRIGSAG VRR
Sbjct  77   MHGRNNGKKLMAARIVQHAFEIIHLLTDQNPIQVMVDAIINTGPREDSTRIGSAGTVRR  135



>ref|XP_011169142.1| PREDICTED: 40S ribosomal protein S5 [Solenopsis invicta]
 gb|EFZ22115.1| hypothetical protein SINV_07427 [Solenopsis invicta]
Length=216

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_007648302.1| PREDICTED: 40S ribosomal protein S5 isoform X1 [Cricetulus griseus]
Length=204

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>gb|KIV89485.1| 40S ribosomal protein S5 [Exophiala mesophila]
Length=215

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 117/156 (75%), Gaps = 12/156 (8%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            +GE ++E  V+ + V P++  A+            I LFN+WSY+DV++ D+S+ DYI  
Sbjct  4    NGEVEVENPVSGYPVLPKDVVAE---------QGSIKLFNKWSYEDVEIRDISLTDYIQI  54

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIV H+ EII
Sbjct  55   ---RSPVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVAHSFEII  111

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  112  HIMTDQNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_011266719.1| PREDICTED: 40S ribosomal protein S5 [Camponotus floridanus]
 ref|XP_011266720.1| PREDICTED: 40S ribosomal protein S5 [Camponotus floridanus]
 gb|EFN61170.1| 40S ribosomal protein S5 [Camponotus floridanus]
Length=216

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_011052375.1| PREDICTED: 40S ribosomal protein S5 [Acromyrmex echinatior]
 ref|XP_011052376.1| PREDICTED: 40S ribosomal protein S5 [Acromyrmex echinatior]
 gb|EGI66854.1| 40S ribosomal protein S5 [Acromyrmex echinatior]
Length=216

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_003696661.1| PREDICTED: 40S ribosomal protein S5-like [Apis florea]
 ref|XP_006570299.1| PREDICTED: 40S ribosomal protein S5 isoform X1 [Apis mellifera]
 ref|XP_006570300.1| PREDICTED: 40S ribosomal protein S5 isoform X2 [Apis mellifera]
 ref|XP_006622149.1| PREDICTED: 40S ribosomal protein S5-like isoform X1 [Apis dorsata]
 ref|XP_006622150.1| PREDICTED: 40S ribosomal protein S5-like isoform X2 [Apis dorsata]
 ref|XP_006622151.1| PREDICTED: 40S ribosomal protein S5-like isoform X3 [Apis dorsata]
Length=216

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGDNPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>emb|CAH04316.1| S5e ribosomal protein [Dascillus cervinus]
Length=192

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RWS DDVQV+D+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  5    IKLFGRWSCDDVQVSDMSLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  63

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIV+HA EIIHLLT  NP+Q++V A+INSGPRED+TRIG AG VR
Sbjct  64   LMMHGRNNGKKLMAVRIVRHAFEIIHLLTGENPLQILVTAIINSGPREDSTRIGRAGTVR  123

Query  519  R  521
            R
Sbjct  124  R  124



>gb|KHE83352.1| hypothetical protein GE21DRAFT_3745 [Neurospora crassa]
Length=213

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 113/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  72   EGAVAVHSVNPQEEKAQSVNPQEEKVHSG-ILLFNRWSYDDVQVNDLSVDDYITATAAKH  248
            EG V V +V+  E     V P+E     G + LFNRWSY+DV++ D+S+ DYI     + 
Sbjct  3    EGEVDVAAVSQYE-----VLPKEVLAEVGSVKLFNRWSYEDVEIRDISLTDYIQI---RS  54

Query  249  PTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTD  428
            P Y PH+AGRY AKRFRKA CP++ERL NSLMMHGRNNGKK MAVRIV HA EIIHL+TD
Sbjct  55   PVYLPHSAGRYAAKRFRKANCPIIERLTNSLMMHGRNNGKKPMAVRIVAHAFEIIHLMTD  114

Query  429  LNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
             NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  115  QNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  145



>gb|EYE99010.1| putative 40S ribosomal protein S5 [Aspergillus ruber CBS 135680]
Length=215

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
            GE ++E   A +++ P++  A+            + LFN+WSY+DV++ D+S+ DY+   
Sbjct  5    GEVEVENPTAAYTMLPKDALAE---------MGSVKLFNKWSYEDVEIRDISLTDYVQI-  54

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              + P Y PHTAGRY AKRFRKAQCP++ERL NSLMM+GRN+GKKLMAVRIV HA EIIH
Sbjct  55   --RSPVYLPHTAGRYAAKRFRKAQCPIIERLTNSLMMNGRNSGKKLMAVRIVAHAFEIIH  112

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            ++TD NP+QV VDA++N GPRED+TRIGSAG VRR
Sbjct  113  IMTDQNPLQVAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_005312284.1| PREDICTED: 40S ribosomal protein S5 [Chrysemys picta bellii]
Length=203

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  16   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  74

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  75   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  134

Query  519  R  521
            R
Sbjct  135  R  135



>ref|XP_003969321.1| PREDICTED: 40S ribosomal protein S5-like [Takifugu rubripes]
Length=203

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  16   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  74

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  75   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  134

Query  519  R  521
            R
Sbjct  135  R  135



>ref|NP_001264172.1| 40S ribosomal protein S5 isoform 1 [Rattus norvegicus]
 ref|XP_005086780.1| PREDICTED: 40S ribosomal protein S5-like [Mesocricetus auratus]
 ref|XP_005361146.1| PREDICTED: 40S ribosomal protein S5-like [Microtus ochrogaster]
 ref|XP_006166785.1| PREDICTED: 40S ribosomal protein S5 [Tupaia chinensis]
 ref|XP_006997265.1| PREDICTED: 40S ribosomal protein S5-like [Peromyscus maniculatus 
bairdii]
 ref|XP_007636753.1| PREDICTED: 40S ribosomal protein S5 isoform X2 [Cricetulus griseus]
 ref|XP_008820997.1| PREDICTED: 40S ribosomal protein S5 [Nannospalax galili]
 gb|EDL75778.1| ribosomal protein S5, isoform CRA_b [Rattus norvegicus]
 gb|EDL75779.1| ribosomal protein S5, isoform CRA_b [Rattus norvegicus]
 gb|EDL75780.1| ribosomal protein S5, isoform CRA_b [Rattus norvegicus]
 gb|AAI58719.1| Rps5 protein [Rattus norvegicus]
 gb|ERE49918.1| 40S ribosomal protein S5 [Cricetulus griseus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|NP_001000.2| 40S ribosomal protein S5 [Homo sapiens]
 ref|NP_001015531.1| 40S ribosomal protein S5 [Bos taurus]
 ref|NP_001252648.1| 40S ribosomal protein S5 [Macaca mulatta]
 ref|NP_001291855.1| ribosomal protein S5 [Ailuropoda melanoleuca]
 ref|XP_533568.1| PREDICTED: 40S ribosomal protein S5 isoform 1 [Canis lupus familiaris]
 ref|XP_001495410.2| PREDICTED: 40S ribosomal protein S5 [Equus caballus]
 ref|XP_002721942.1| PREDICTED: 40S ribosomal protein S5 [Oryctolagus cuniculus]
 ref|XP_002762606.1| PREDICTED: 40S ribosomal protein S5 [Callithrix jacchus]
 ref|XP_002927105.1| PREDICTED: 40S ribosomal protein S5 [Ailuropoda melanoleuca]
 ref|XP_003128181.1| PREDICTED: 40S ribosomal protein S5 isoform 1 [Sus scrofa]
 ref|XP_001147137.2| PREDICTED: 40S ribosomal protein S5 [Pan troglodytes]
 ref|XP_003406279.1| PREDICTED: 40S ribosomal protein S5 [Loxodonta africana]
 ref|XP_003467241.1| PREDICTED: 40S ribosomal protein S5 isoform X1 [Cavia porcellus]
 ref|XP_003766486.1| PREDICTED: 40S ribosomal protein S5-like [Sarcophilus harrisii]
 ref|XP_003795392.1| PREDICTED: 40S ribosomal protein S5-like isoform 1 [Otolemur 
garnettii]
 ref|XP_003795393.1| PREDICTED: 40S ribosomal protein S5-like isoform 2 [Otolemur 
garnettii]
 ref|XP_003816691.1| PREDICTED: 40S ribosomal protein S5 [Pan paniscus]
 ref|XP_003997388.1| PREDICTED: 40S ribosomal protein S5 [Felis catus]
 ref|XP_004015514.1| PREDICTED: 40S ribosomal protein S5 [Ovis aries]
 ref|XP_004061646.1| PREDICTED: 40S ribosomal protein S5 isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004061647.1| PREDICTED: 40S ribosomal protein S5 isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004061648.1| PREDICTED: 40S ribosomal protein S5 isoform 3 [Gorilla gorilla 
gorilla]
 ref|XP_004283297.1| PREDICTED: 40S ribosomal protein S5-like [Orcinus orca]
 ref|XP_004317840.1| PREDICTED: 40S ribosomal protein S5-like [Tursiops truncatus]
 ref|XP_004386973.1| PREDICTED: 40S ribosomal protein S5 [Trichechus manatus latirostris]
 ref|XP_004405743.1| PREDICTED: 40S ribosomal protein S5 isoform 2 [Odobenus rosmarus 
divergens]
 ref|XP_004439185.1| PREDICTED: 40S ribosomal protein S5 [Ceratotherium simum simum]
 ref|XP_004596972.1| PREDICTED: 40S ribosomal protein S5-like [Ochotona princeps]
 ref|XP_004616982.1| PREDICTED: 40S ribosomal protein S5-like [Sorex araneus]
 ref|XP_004672947.1| PREDICTED: 40S ribosomal protein S5 [Jaculus jaculus]
 ref|XP_004715714.1| PREDICTED: 40S ribosomal protein S5-like [Echinops telfairi]
 ref|XP_005002562.1| PREDICTED: 40S ribosomal protein S5 isoform X2 [Cavia porcellus]
 ref|XP_005002563.1| PREDICTED: 40S ribosomal protein S5 isoform X3 [Cavia porcellus]
 ref|XP_005342454.1| PREDICTED: 40S ribosomal protein S5-like [Ictidomys tridecemlineatus]
 ref|XP_005414430.1| PREDICTED: 40S ribosomal protein S5 [Chinchilla lanigera]
 ref|XP_005590657.1| PREDICTED: 40S ribosomal protein S5 [Macaca fascicularis]
 ref|XP_005693089.1| PREDICTED: 40S ribosomal protein S5-like [Capra hircus]
 ref|XP_005902482.1| PREDICTED: 40S ribosomal protein S5 [Bos mutus]
 ref|XP_005960550.1| PREDICTED: 40S ribosomal protein S5 isoform X3 [Pantholops hodgsonii]
 ref|XP_005960551.1| PREDICTED: 40S ribosomal protein S5 isoform X4 [Pantholops hodgsonii]
 ref|XP_006172661.1| PREDICTED: 40S ribosomal protein S5 [Camelus ferus]
 ref|XP_006218737.1| PREDICTED: 40S ribosomal protein S5 [Vicugna pacos]
 ref|XP_006747835.1| PREDICTED: 40S ribosomal protein S5 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006747836.1| PREDICTED: 40S ribosomal protein S5 isoform X2 [Leptonychotes 
weddellii]
 ref|XP_006904818.1| PREDICTED: 40S ribosomal protein S5 [Pteropus alecto]
 ref|XP_007093587.1| PREDICTED: 40S ribosomal protein S5 [Panthera tigris altaica]
 ref|XP_007124596.1| PREDICTED: 40S ribosomal protein S5-like [Physeter catodon]
 ref|XP_006067329.1| PREDICTED: 40S ribosomal protein S5 [Bubalus bubalis]
 ref|XP_007175452.1| PREDICTED: 40S ribosomal protein S5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007457543.1| PREDICTED: 40S ribosomal protein S5 [Lipotes vexillifer]
 ref|XP_007996635.1| PREDICTED: 40S ribosomal protein S5 [Chlorocebus sabaeus]
 ref|XP_008069145.1| PREDICTED: 40S ribosomal protein S5 [Tarsius syrichta]
 ref|XP_008542770.1| PREDICTED: 40S ribosomal protein S5 [Equus przewalskii]
 ref|XP_008570412.1| PREDICTED: 40S ribosomal protein S5 [Galeopterus variegatus]
 ref|XP_008704688.1| PREDICTED: 40S ribosomal protein S5 [Ursus maritimus]
 ref|XP_010330665.1| PREDICTED: 40S ribosomal protein S5 [Saimiri boliviensis boliviensis]
 ref|XP_010614850.1| PREDICTED: 40S ribosomal protein S5 [Fukomys damarensis]
 ref|XP_010960315.1| PREDICTED: 40S ribosomal protein S5 [Camelus bactrianus]
 ref|XP_010960316.1| PREDICTED: 40S ribosomal protein S5 [Camelus bactrianus]
 ref|XP_010987525.1| PREDICTED: 40S ribosomal protein S5 [Camelus dromedarius]
 ref|XP_010987526.1| PREDICTED: 40S ribosomal protein S5 [Camelus dromedarius]
 ref|XP_011382919.1| PREDICTED: 40S ribosomal protein S5 [Pteropus vampyrus]
 sp|P46782.4|RS5_HUMAN RecName: Full=40S ribosomal protein S5; Contains: RecName: Full=40S 
ribosomal protein S5, N-terminally processed [Homo sapiens]
 sp|Q5E988.3|RS5_BOVIN RecName: Full=40S ribosomal protein S5; Contains: RecName: Full=40S 
ribosomal protein S5, N-terminally processed [Bos taurus]
 pdb|2ZKQ|GG Chain g, Structure Of A Mammalian Ribosomal 40s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3A|F Chain F, Structure Of The Human 40s Ribosomal Proteins
 pdb|4KZX|F Chain F, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|F Chain F, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|F Chain F, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|F Chain F, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|F Chain F, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|F Chain F, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|F Chain F, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|F Chain F, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|F Chain F, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|F Chain F, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 gb|AAH15405.1| Ribosomal protein S5 [Homo sapiens]
 gb|AAH18151.1| Ribosomal protein S5 [Homo sapiens]
 dbj|BAB79493.1| ribosomal protein S5 [Homo sapiens]
 gb|AAX09049.1| ribosomal protein S5 [Bos taurus]
 gb|AAX41778.1| ribosomal protein S5 [synthetic construct]
 gb|AAI02375.1| Ribosomal protein S5 [Bos taurus]
 gb|EAW72581.1| ribosomal protein S5, isoform CRA_a [Homo sapiens]
 gb|EAW72582.1| ribosomal protein S5, isoform CRA_a [Homo sapiens]
 gb|ABM82710.1| ribosomal protein S5 [synthetic construct]
 gb|ABM85894.1| ribosomal protein S5 [synthetic construct]
 dbj|BAG34879.1| unnamed protein product [Homo sapiens]
 tpg|DAA19239.1| TPA: 40S ribosomal protein S5 [Bos taurus]
 gb|AEA39489.1| ribosomal protein S5 [Ailuropoda melanoleuca]
 gb|AEA39535.1| ribosomal protein S5 [Ailuropoda melanoleuca]
 gb|EHB05268.1| 40S ribosomal protein S5 [Heterocephalus glaber]
 gb|EHH30493.1| hypothetical protein EGK_11175 [Macaca mulatta]
 gb|EHH59989.1| hypothetical protein EGM_10232 [Macaca fascicularis]
 gb|ELR51553.1| 40S ribosomal protein S5 [Bos mutus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|NP_033121.2| 40S ribosomal protein S5 [Mus musculus]
 emb|CAA73041.1| 5S ribosomal protein [Mus musculus]
 dbj|BAB21953.1| unnamed protein product [Mus musculus]
 dbj|BAB26424.1| unnamed protein product [Mus musculus]
 dbj|BAB27113.1| unnamed protein product [Mus musculus]
 dbj|BAB28229.1| unnamed protein product [Mus musculus]
 dbj|BAB28270.1| unnamed protein product [Mus musculus]
 dbj|BAB32115.1| unnamed protein product [Mus musculus]
 dbj|BAB32203.1| unnamed protein product [Mus musculus]
 dbj|BAC34342.1| unnamed protein product [Mus musculus]
 dbj|BAC34347.1| unnamed protein product [Mus musculus]
 gb|AAH58690.1| Ribosomal protein S5 [Mus musculus]
 dbj|BAE35868.1| unnamed protein product [Mus musculus]
 dbj|BAE40813.1| unnamed protein product [Mus musculus]
 dbj|BAE43008.1| unnamed protein product [Mus musculus]
 dbj|BAE39602.1| unnamed protein product [Mus musculus]
 dbj|BAE40026.1| unnamed protein product [Mus musculus]
 dbj|BAE40077.1| unnamed protein product [Mus musculus]
 dbj|BAE37616.1| unnamed protein product [Mus musculus]
 dbj|BAE31228.1| unnamed protein product [Mus musculus]
 gb|EDL38092.1| ribosomal protein S5, isoform CRA_a [Mus musculus]
 gb|EDL38094.1| ribosomal protein S5, isoform CRA_a [Mus musculus]
 gb|EDL38095.1| ribosomal protein S5, isoform CRA_a [Mus musculus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_011331368.1| PREDICTED: 40S ribosomal protein S5-like [Cerapachys biroi]
 gb|EZA59020.1| 40S ribosomal protein S5 [Cerapachys biroi]
Length=221

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  34   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  92

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  93   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTAENPLQVLVTAIINSGPREDSTRIGRAGTVR  152

Query  519  R  521
            R
Sbjct  153  R  153



>ref|XP_010855936.1| PREDICTED: 40S ribosomal protein S5 [Bison bison bison]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_001210932.1| 40S ribosomal protein S5 [Aspergillus terreus NIH2624]
 gb|EAU39492.1| 40S ribosomal protein S5 [Aspergillus terreus NIH2624]
Length=215

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
            GE ++E       V P+E  A+            + LFN+WSY+DV++ D+S+ DYI   
Sbjct  5    GEVEVENPAGAFQVLPKEAIAE---------MGTVKLFNKWSYEDVEIRDISLTDYIQI-  54

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
              ++P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMAVRIV HA EIIH
Sbjct  55   --RNPVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAVRIVAHAFEIIH  112

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            ++TD NP+QV VDA++N GPRED+TRIGSAG VRR
Sbjct  113  IMTDQNPLQVAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_008159315.1| PREDICTED: 40S ribosomal protein S5 [Eptesicus fuscus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>sp|P97461.3|RS5_MOUSE RecName: Full=40S ribosomal protein S5; Contains: RecName: Full=40S 
ribosomal protein S5, N-terminally processed [Mus musculus]
 gb|AAB63526.1| ribosomal protein S5 [Mus musculus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>gb|AAX43400.1| ribosomal protein S5 [synthetic construct]
Length=205

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_007722583.1| 40S ribosomal protein S5 [Capronia coronata CBS 617.96]
 gb|EXJ90389.1| 40S ribosomal protein S5 [Capronia coronata CBS 617.96]
Length=215

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 117/156 (75%), Gaps = 12/156 (8%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            +GE ++E  V  ++V P+E  ++            I LFN+WSY+DV++ D+S+ DYI  
Sbjct  4    NGEVEVEVPVTGYTVLPKEVTSEI---------GTIKLFNKWSYEDVEIRDISLTDYIQI  54

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIV H+ EII
Sbjct  55   ---RTPVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVAHSFEII  111

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQV VDA++N GPRED+TRIGSAG VRR
Sbjct  112  HIMTDQNPIQVAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_004647791.1| PREDICTED: 40S ribosomal protein S5 [Octodon degus]
Length=204

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_003491320.1| PREDICTED: 40S ribosomal protein S5a-like [Bombus impatiens]
Length=216

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGDNPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_007955198.1| PREDICTED: 40S ribosomal protein S5 [Orycteropus afer afer]
Length=204

 Score =   194 bits (493),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_003707267.1| PREDICTED: 40S ribosomal protein S5a-like [Megachile rotundata]
Length=216

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKHA EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  88   LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGDNPLQVLVTAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_010271573.1| PREDICTED: 40S ribosomal protein S5-like [Nelumbo nucifera]
Length=197

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLV  332
            S + LFNRWS D+VQV D+S+ DYI  +  K  TY PHTA RY  KRF++AQCP+VERL 
Sbjct  7    SEVKLFNRWSLDNVQVGDISLVDYIGVSPNKIATYVPHTAERYSVKRFKEAQCPIVERLT  66

Query  333  NSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGV  512
            NSLMMHGRNNGKKL AV IVK AMEIIHLLTD NPIQVIVDA+INSGPREDATR GSAGV
Sbjct  67   NSLMMHGRNNGKKLKAVCIVKKAMEIIHLLTDQNPIQVIVDAIINSGPREDATRNGSAGV  126

Query  513  VRR  521
            VRR
Sbjct  127  VRR  129



>ref|XP_007062326.1| PREDICTED: 40S ribosomal protein S5-like [Chelonia mydas]
Length=203

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  16   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  74

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  75   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  134

Query  519  R  521
            R
Sbjct  135  R  135



>dbj|BAJ94184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  SGILLFNRWSYDDVQVNDLSVDDYITATAA-KHPTYTPHTAGRYQAKRFRKAQCPVVERL  329
            + I LFN+WS+DD+Q++D+S+ DYI      K+  + PHTAGRY  +RFRKAQCPVVER+
Sbjct  6    ADIKLFNKWSFDDIQISDISLKDYIAVKEKFKYFIFVPHTAGRYNKRRFRKAQCPVVERV  65

Query  330  VNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAG  509
            VNSLMMHGR+NGKKL AVRIV+HA EIIHLLTD NP+Q++VDA+INSGPRED+TRIGS G
Sbjct  66   VNSLMMHGRDNGKKLKAVRIVQHAFEIIHLLTDKNPLQILVDAIINSGPREDSTRIGSQG  125

Query  510  VVRR  521
             VRR
Sbjct  126  TVRR  129



>gb|ACD65097.1| putative 40S ribosomal protein RPS5 [Novocrania anomala]
Length=152

 Score =   192 bits (489),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            + LF +WS DDVQV+D+S+ DYI A   K+  Y PH+AGRYQ KRFRKAQCP+VERL NS
Sbjct  20   VKLFGKWSSDDVQVSDISLTDYI-AVKEKYSKYLPHSAGRYQVKRFRKAQCPIVERLTNS  78

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMA+RIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  79   LMMHGRNNGKKLMAMRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  138

Query  519  R  521
            R
Sbjct  139  R  139



>ref|XP_005431414.1| PREDICTED: 40S ribosomal protein S5-like [Geospiza fortis]
 ref|XP_008929503.1| PREDICTED: 40S ribosomal protein S5 [Manacus vitellinus]
 ref|XP_009665510.1| PREDICTED: 40S ribosomal protein S5 [Struthio camelus australis]
 ref|XP_009701478.1| PREDICTED: 40S ribosomal protein S5 [Cariama cristata]
 ref|XP_010286276.1| PREDICTED: 40S ribosomal protein S5 [Phaethon lepturus]
 ref|XP_010568213.1| PREDICTED: 40S ribosomal protein S5 [Haliaeetus leucocephalus]
Length=203

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  16   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  74

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  75   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  134

Query  519  R  521
            R
Sbjct  135  R  135



>dbj|BAD96826.1| ribosomal protein S5 variant [Homo sapiens]
Length=204

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_007799008.1| putative 40s ribosomal protein s5 protein [Eutypa lata UCREL1]
 gb|EMR61915.1| putative 40s ribosomal protein s5 protein [Eutypa lata UCREL1]
Length=212

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +3

Query  156  GILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVN  335
             + LFNRWSY+DV++ D+S+ DYI   A   P Y PH+AGRY AKRFRKA CP++ERL N
Sbjct  26   SVKLFNRWSYEDVEIRDISLTDYIQIRA---PVYLPHSAGRYAAKRFRKANCPIIERLTN  82

Query  336  SLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVV  515
            SLMMHGRNNGKKLMAVRIV HA EIIH++TD NPIQ+ VDA++N GPRED+TRIGSAG V
Sbjct  83   SLMMHGRNNGKKLMAVRIVAHAFEIIHIMTDQNPIQIAVDAIVNCGPREDSTRIGSAGTV  142

Query  516  RR  521
            RR
Sbjct  143  RR  144



>ref|XP_005234126.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S5 [Falco 
peregrinus]
Length=204

 Score =   194 bits (492),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>gb|KIW48463.1| 40S ribosomal protein S5 [Exophiala oligosperma]
Length=215

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 114/155 (74%), Gaps = 12/155 (8%)
 Frame = +3

Query  57   GEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITAT  236
            GE ++E  V+ + V P++  A+            I LFN+W Y DV+V D+S+ DYI   
Sbjct  5    GEVEVENPVSGYQVLPKDVTAE---------LGSIRLFNKWDYSDVEVRDISLTDYIQIR  55

Query  237  AAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIH  416
            A   P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKKLMA+RIV HA EIIH
Sbjct  56   A---PVYLPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKLMAIRIVAHAFEIIH  112

Query  417  LLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            ++TD NPIQ+ VDA++N GPRED+TRIGSAG VRR
Sbjct  113  IMTDQNPIQIAVDAIVNCGPREDSTRIGSAGTVRR  147



>ref|XP_007508472.1| 40S ribosomal protein S5 [Bathycoccus prasinos]
 emb|CCO20576.1| 40S ribosomal protein S5 [Bathycoccus prasinos]
Length=209

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 108/132 (82%), Gaps = 14/132 (11%)
 Frame = +3

Query  165  LFNRWSYDDVQV-------------NDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKA  305
            LF +WS+DDV+V             ND+S++DYI A   K+ T+ PH+AGRY AKRFRKA
Sbjct  11   LFGKWSFDDVEVRFSEIRAYLCSRINDISLEDYI-AVKPKYATFVPHSAGRYAAKRFRKA  69

Query  306  QCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPRED  485
            QCP+VER+VNSLMMHGRNNGKKLMA RIV+HAM+II LLTD NP+QV+VDA+IN+GPRED
Sbjct  70   QCPIVERIVNSLMMHGRNNGKKLMAARIVRHAMDIIFLLTDQNPLQVVVDAIINAGPRED  129

Query  486  ATRIGSAGVVRR  521
            ATR+GSAGVVRR
Sbjct  130  ATRVGSAGVVRR  141



>ref|XP_003171002.1| 40S ribosomal protein S5 [Microsporum gypseum CBS 118893]
 gb|EFR03994.1| 40S ribosomal protein S5 [Microsporum gypseum CBS 118893]
Length=212

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 14/156 (9%)
 Frame = +3

Query  54   DGEAKMEGAVAVHSVNPQEEKAQSVNPQEEKVHSGILLFNRWSYDDVQVNDLSVDDYITA  233
            DGE ++E     ++V P++  A+  N         I LFN+WSY+D+QV D+S+ DYI  
Sbjct  3    DGEVEVE--TGAYNVLPKDVTAEMGN---------IKLFNKWSYEDIQVRDISLTDYIQI  51

Query  234  TAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEII  413
               + P Y PH+AGRY AKRFRKAQCP++ERL NSLMM+GRNNGKK+MAVRIV HA EII
Sbjct  52   ---RQPVYVPHSAGRYAAKRFRKAQCPIIERLTNSLMMNGRNNGKKVMAVRIVAHAFEII  108

Query  414  HLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVRR  521
            H++TD NPIQ+ VDA+ N GPRED+TRIGSAG VRR
Sbjct  109  HIMTDQNPIQITVDAISNCGPREDSTRIGSAGTVRR  144



>gb|EMP33494.1| 40S ribosomal protein S5 [Chelonia mydas]
Length=216

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  29   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  87

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  88   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  147

Query  519  R  521
            R
Sbjct  148  R  148



>ref|XP_006759039.1| PREDICTED: 40S ribosomal protein S5, partial [Myotis davidii]
Length=190

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  17   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  75

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  76   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  135

Query  519  R  521
            R
Sbjct  136  R  136



>ref|XP_008616084.1| 40S ribosomal protein S5 [Saprolegnia diclina VS20]
 gb|EQC30491.1| 40S ribosomal protein S5 [Saprolegnia diclina VS20]
Length=195

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            + LFN+W+YDD++VND+++ DY+ A + K  T+ PHTA RYQ KRFRKAQCP+VERL NS
Sbjct  8    VKLFNKWTYDDIKVNDVALIDYV-AVSGKAATFLPHTAQRYQKKRFRKAQCPIVERLANS  66

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LM HGRN+GKKLMA RI++H +EIIHLLTD NP+QV+VDAVIN+GPRED+TR+GSAGVVR
Sbjct  67   LMRHGRNSGKKLMANRIIRHTLEIIHLLTDQNPLQVVVDAVINAGPREDSTRVGSAGVVR  126

Query  519  R  521
            R
Sbjct  127  R  127



>ref|XP_002373376.1| 40S ribosomal protein S5 [Aspergillus flavus NRRL3357]
 ref|XP_001818176.2| 40S ribosomal protein S5 [Aspergillus oryzae RIB40]
 gb|EED57764.1| 40S ribosomal protein S5, putative [Aspergillus flavus NRRL3357]
 gb|EIT81053.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE81124.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=214

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 4/136 (3%)
 Frame = +3

Query  117  AQSVNPQEEKVHSGIL-LFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKR  293
            A  V P+E     G + LFN+WSY+DV++ D+S+ DYI     ++P Y PH+AGRY AKR
Sbjct  14   AFQVLPKEALAEMGTVKLFNKWSYEDVEIRDISLTDYIQI---RNPVYLPHSAGRYAAKR  70

Query  294  FRKAQCPVVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSG  473
            FRKAQCP++ERL NSLMM+GRNNGKKLMAVRIV HA EIIH++TD NP+QV VDA++N G
Sbjct  71   FRKAQCPIIERLTNSLMMNGRNNGKKLMAVRIVAHAFEIIHIMTDQNPLQVAVDAIVNCG  130

Query  474  PREDATRIGSAGVVRR  521
            PRED+TRIGSAG VRR
Sbjct  131  PREDSTRIGSAGTVRR  146



>ref|XP_011313627.1| PREDICTED: 40S ribosomal protein S5 [Fopius arisanus]
Length=218

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF RW+ DDVQVND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  31   IKLFGRWNCDDVQVNDMSLQDYI-AVKEKNAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  89

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            LMMHGRNNGKKLMAVRIVKH  EIIHLLT  NP+QV+V A+INSGPRED+TRIG AG VR
Sbjct  90   LMMHGRNNGKKLMAVRIVKHGFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR  149

Query  519  R  521
            R
Sbjct  150  R  150



>ref|XP_006877391.1| PREDICTED: 40S ribosomal protein S5-like [Chrysochloris asiatica]
Length=214

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  27   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  85

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  86   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  145

Query  519  R  521
            R
Sbjct  146  R  146



>ref|XP_005838790.1| small subunit ribosomal protein S5e, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX51810.1| small subunit ribosomal protein S5e, cytoplasmic [Guillardia 
theta CCMP2712]
Length=196

 Score =   193 bits (491),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            + LFN+WSYDD++V+D+S++DYI A   K+  + PH+AGR+QAKRF+KAQCP+VERL NS
Sbjct  9    VKLFNKWSYDDIEVSDISLEDYI-AVKPKYAQFVPHSAGRFQAKRFKKAQCPIVERLTNS  67

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKK+MAVRIVKHA +IIHLLTD NPIQ +V+A+I + PRED+TRIGS GVVR
Sbjct  68   IMMHGRNNGKKIMAVRIVKHAFDIIHLLTDSNPIQQLVEAIIQASPREDSTRIGSGGVVR  127

Query  519  R  521
            R
Sbjct  128  R  128



>gb|EPY90091.1| 40S ribosomal protein S5-like protein [Camelus ferus]
Length=222

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  159  ILLFNRWSYDDVQVNDLSVDDYITATAAKHPTYTPHTAGRYQAKRFRKAQCPVVERLVNS  338
            I LF +WS DDVQ+ND+S+ DYI A   K+  Y PH+AGRY AKRFRKAQCP+VERL NS
Sbjct  35   IKLFGKWSTDDVQINDISLQDYI-AVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNS  93

Query  339  LMMHGRNNGKKLMAVRIVKHAMEIIHLLTDLNPIQVIVDAVINSGPREDATRIGSAGVVR  518
            +MMHGRNNGKKLM VRIVKHA EIIHLLT  NP+QV+V+A+INSGPRED+TRIG AG VR
Sbjct  94   MMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVR  153

Query  519  R  521
            R
Sbjct  154  R  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800