BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026I12

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        219   7e-68   Tarenaya hassleriana [spider flower]
gb|EPS65103.1|  hypothetical protein M569_09676                         216   8e-68   Genlisea aurea
ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               218   1e-67   Sesamum indicum [beniseed]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        218   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          218   2e-67   Sesamum indicum [beniseed]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        218   2e-67   Tarenaya hassleriana [spider flower]
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         218   2e-67   Jatropha curcas
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                218   3e-67   Erythranthe guttata [common monkey flower]
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          217   3e-67   Elaeis guineensis
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        217   4e-67   Tarenaya hassleriana [spider flower]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      216   5e-67   Vitis vinifera
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             216   6e-67   Tarenaya hassleriana [spider flower]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             216   7e-67   Populus euphratica
gb|EPS71864.1|  hypothetical protein M569_02887                         216   7e-67   Genlisea aurea
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        216   9e-67   Vitis vinifera
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          214   3e-66   Oryza brachyantha
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  214   3e-66   Elaeis guineensis
ref|XP_002312545.2|  ribosomal protein S3a                              214   3e-66   
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    214   4e-66   Setaria italica
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               214   4e-66   Elaeis guineensis
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             214   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          214   4e-66   Oryza brachyantha
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          214   5e-66   Oryza brachyantha
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          214   6e-66   Oryza brachyantha
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             214   7e-66   Solanum tuberosum [potatoes]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               214   7e-66   Solanum lycopersicum
emb|CDO99096.1|  unnamed protein product                                214   7e-66   Coffea canephora [robusta coffee]
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             214   8e-66   Eutrema salsugineum [saltwater cress]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          214   9e-66   Setaria italica
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    214   1e-65   
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    213   1e-65   Phoenix dactylifera
ref|XP_007030615.1|  Ribosomal protein S3Ae                             213   1e-65   
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          213   1e-65   Sorghum bicolor [broomcorn]
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             213   1e-65   Vitis vinifera
gb|ABK56834.1|  RPS3                                                    213   2e-65   Cymbidium hybrid cultivar
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             213   2e-65   Medicago truncatula
dbj|BAA05057.1|  cyc07                                                  213   2e-65   Catharanthus roseus [chatas]
ref|NP_001046578.1|  Os02g0287000                                       213   2e-65   
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   212   2e-65   
gb|AFK33413.1|  unknown                                                 213   2e-65   Lotus japonicus
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               213   2e-65   Eucalyptus grandis [rose gum]
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   213   2e-65   Theobroma cacao [chocolate]
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                213   2e-65   Ricinus communis
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               213   2e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                213   3e-65   Ricinus communis
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         212   3e-65   Helianthus annuus
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             212   3e-65   Capsella rubella
gb|ABK24527.1|  unknown                                                 209   3e-65   Picea sitchensis
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    212   3e-65   Catharanthus roseus [chatas]
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        212   4e-65   Populus euphratica
gb|ACU17112.1|  unknown                                                 211   4e-65   Glycine max [soybeans]
ref|NP_001265990.1|  40S ribosomal protein S3a                          212   4e-65   Cicer arietinum [garbanzo]
gb|ACR37738.1|  unknown                                                 209   4e-65   Zea mays [maize]
ref|NP_001066631.1|  Os12g0406200                                       212   5e-65   
gb|KHN30486.1|  40S ribosomal protein S3a                               211   5e-65   Glycine soja [wild soybean]
dbj|BAJ93929.1|  predicted protein                                      211   5e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          211   6e-65   Nicotiana sylvestris
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    211   6e-65   Nicotiana tomentosiformis
dbj|BAA00860.1|  cyc07                                                  211   6e-65   Catharanthus roseus [chatas]
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    211   6e-65   Nicotiana tomentosiformis
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               211   6e-65   Phoenix dactylifera
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        211   7e-65   Nelumbo nucifera [Indian lotus]
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               211   7e-65   Nicotiana sylvestris
ref|NP_001241005.1|  uncharacterized protein LOC100805519               211   7e-65   Glycine max [soybeans]
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    211   7e-65   Nicotiana tomentosiformis
gb|KHN02741.1|  40S ribosomal protein S3a                               211   8e-65   Glycine soja [wild soybean]
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    211   9e-65   Arabis alpina [alpine rockcress]
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          211   9e-65   Sorghum bicolor [broomcorn]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             211   1e-64   Nelumbo nucifera [Indian lotus]
ref|NP_195193.1|  40S ribosomal protein S3a-2                           211   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22319.1|  unknown                                                 210   1e-64   Picea sitchensis
gb|AAC98779.1|  S-phase-specific ribosomal protein                      211   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314671.2|  ribosomal protein S3a                              211   1e-64   Populus trichocarpa [western balsam poplar]
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         211   1e-64   Jatropha curcas
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               211   1e-64   Brachypodium distachyon [annual false brome]
ref|NP_001141038.1|  hypothetical protein                               211   1e-64   Zea mays [maize]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          215   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001152574.1|  40S ribosomal protein S3a                          210   1e-64   Zea mays [maize]
tpg|DAA43947.1|  TPA: hypothetical protein ZEAMMB73_528269              208   2e-64   
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        210   2e-64   Camelina sativa [gold-of-pleasure]
gb|AFW89330.1|  40S ribosomal protein S3a                               213   2e-64   
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             210   2e-64   Camelina sativa [gold-of-pleasure]
gb|KJB34507.1|  hypothetical protein B456_006G069600                    210   2e-64   Gossypium raimondii
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    210   2e-64   Arabis alpina [alpine rockcress]
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             210   2e-64   Prunus mume [ume]
gb|AFW89335.1|  40S ribosomal protein S3a                               213   2e-64   
ref|NP_001049289.1|  Os03g0200500                                       210   2e-64   
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             210   2e-64   Prunus persica
gb|KHG05975.1|  40S ribosomal S3a                                       210   2e-64   Gossypium arboreum [tree cotton]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          210   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          210   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010090259.1|  40S ribosomal protein S3a                          210   2e-64   Morus notabilis
gb|AAX55706.1|  cyc07                                                   209   2e-64   Vitis vinifera
emb|CDO98656.1|  unnamed protein product                                210   2e-64   Coffea canephora [robusta coffee]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               210   3e-64   Glycine max [soybeans]
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          209   3e-64   Brachypodium distachyon [annual false brome]
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    211   4e-64   
ref|XP_002463139.1|  hypothetical protein SORBIDRAFT_02g038380          208   4e-64   
ref|NP_187135.1|  40S ribosomal protein S3a-1                           209   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KJB28386.1|  hypothetical protein B456_005G045000                    209   4e-64   Gossypium raimondii
ref|NP_001239858.1|  uncharacterized protein LOC100808747               209   4e-64   Glycine max [soybeans]
gb|ACU18272.1|  unknown                                                 209   5e-64   Glycine max [soybeans]
gb|AGT16352.1|  40S ribosomal protein S3a                               209   5e-64   Saccharum hybrid cultivar R570
gb|KHG19560.1|  40S ribosomal S3a                                       209   5e-64   Gossypium arboreum [tree cotton]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               209   6e-64   Solanum lycopersicum
ref|NP_001149096.1|  40S ribosomal protein S3a                          209   6e-64   Zea mays [maize]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        209   6e-64   Brassica rapa
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          209   6e-64   Amborella trichopoda
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             209   6e-64   Brassica rapa
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               209   6e-64   Cucumis melo [Oriental melon]
gb|KJB28382.1|  hypothetical protein B456_005G045000                    208   6e-64   Gossypium raimondii
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          209   7e-64   Cucumis sativus [cucumbers]
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          209   7e-64   
emb|CDY50760.1|  BnaAnng10670D                                          209   7e-64   Brassica napus [oilseed rape]
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          209   7e-64   Cucumis melo [Oriental melon]
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        209   8e-64   Brassica rapa
emb|CDY40680.1|  BnaC03g33960D                                          209   8e-64   Brassica napus [oilseed rape]
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          209   9e-64   Brachypodium distachyon [annual false brome]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             208   9e-64   Phaseolus vulgaris [French bean]
emb|CDX74165.1|  BnaA03g28820D                                          208   9e-64   
gb|KHG11221.1|  40S ribosomal S3a                                       208   1e-63   Gossypium arboreum [tree cotton]
emb|CDY17474.1|  BnaC03g65890D                                          208   1e-63   Brassica napus [oilseed rape]
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             208   1e-63   Capsella rubella
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     208   1e-63   
ref|NP_001275123.1|  cyc07-like protein                                 208   1e-63   Solanum tuberosum [potatoes]
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   Solanum lycopersicum
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        208   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002882377.1|  40S ribosomal protein S3A                          208   1e-63   
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             208   1e-63   Phaseolus vulgaris [French bean]
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        208   1e-63   Camelina sativa [gold-of-pleasure]
gb|KJB72261.1|  hypothetical protein B456_011G167500                    208   1e-63   Gossypium raimondii
ref|XP_010092425.1|  40S ribosomal protein S3a                          208   1e-63   
gb|KJB28385.1|  hypothetical protein B456_005G045000                    207   1e-63   Gossypium raimondii
ref|XP_002869131.1|  40S ribosomal protein S3A                          208   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             207   2e-63   Eutrema salsugineum [saltwater cress]
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     207   2e-63   Eucalyptus grandis [rose gum]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                217   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          207   2e-63   Cicer arietinum [garbanzo]
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     207   2e-63   Solanum tuberosum [potatoes]
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        207   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             207   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               207   3e-63   Prunus mume [ume]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    207   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             207   4e-63   Phaseolus vulgaris [French bean]
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          207   4e-63   
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          207   5e-63   Eucalyptus grandis [rose gum]
gb|ABB55362.1|  cyc07-like                                              207   5e-63   Solanum tuberosum [potatoes]
ref|NP_001288829.1|  40S ribosomal protein S3a                          207   5e-63   Brassica rapa
emb|CDX69078.1|  BnaC01g03750D                                          206   5e-63   
emb|CDX75453.1|  BnaA01g02490D                                          206   5e-63   
emb|CDY21109.1|  BnaA01g33400D                                          206   5e-63   Brassica napus [oilseed rape]
gb|ABB72808.1|  cyc07-like protein                                      206   5e-63   Solanum tuberosum [potatoes]
ref|XP_003638196.1|  40S ribosomal protein S3a                          206   6e-63   
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             206   6e-63   Brassica rapa
gb|ACG33267.1|  40S ribosomal protein S3a                               206   6e-63   Zea mays [maize]
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    206   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85751.1|  unknown                                                 206   7e-63   Medicago truncatula
emb|CDY30019.1|  BnaC01g39890D                                          207   9e-63   Brassica napus [oilseed rape]
gb|ACG34058.1|  40S ribosomal protein S3a                               206   9e-63   Zea mays [maize]
gb|ABK93399.1|  unknown                                                 206   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             206   1e-62   
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               206   1e-62   Populus euphratica
ref|XP_006382773.1|  40S ribosomal protein S3A                          206   1e-62   Populus trichocarpa [western balsam poplar]
gb|AAP80855.1|  cyc07                                                   205   1e-62   Triticum aestivum [Canadian hard winter wheat]
emb|CDX76296.1|  BnaA08g11040D                                          205   1e-62   
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        205   2e-62   Brassica rapa
gb|KJB38202.1|  hypothetical protein B456_006G241700                    205   2e-62   Gossypium raimondii
gb|KJB38201.1|  hypothetical protein B456_006G241700                    205   2e-62   Gossypium raimondii
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          204   3e-62   Glycine max [soybeans]
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   203   5e-62   Citrus sinensis [apfelsine]
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    204   5e-62   Daucus carota [carrots]
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    204   6e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             204   6e-62   Selaginella moellendorffii
gb|ACN40078.1|  unknown                                                 204   7e-62   Picea sitchensis
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             204   7e-62   Citrus clementina [clementine]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             203   8e-62   Fragaria vesca subsp. vesca
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    203   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               202   2e-61   Fragaria vesca subsp. vesca
gb|KEH32959.1|  40S ribosomal protein S3a-1                             202   3e-61   Medicago truncatula
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        201   4e-61   Malus domestica [apple tree]
gb|KHN21710.1|  40S ribosomal protein S3a                               204   5e-61   Glycine soja [wild soybean]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        201   9e-61   Malus domestica [apple tree]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        201   9e-61   Pyrus x bretschneideri [bai li]
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    201   1e-60   Volvox carteri f. nagariensis
emb|CBI34197.3|  unnamed protein product                                198   2e-60   Vitis vinifera
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    200   2e-60   Chlamydomonas reinhardtii
ref|XP_001761018.1|  predicted protein                                  199   3e-60   
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   198   4e-60   Citrus sinensis [apfelsine]
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             199   5e-60   Citrus clementina [clementine]
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             208   5e-60   
gb|EEC69140.1|  hypothetical protein OsI_38068                          210   6e-60   Oryza sativa Indica Group [Indian rice]
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   198   6e-60   Citrus sinensis [apfelsine]
ref|XP_001767326.1|  predicted protein                                  199   7e-60   
gb|EEE53089.1|  hypothetical protein OsJ_35850                          209   9e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001755439.1|  predicted protein                                  198   1e-59   
ref|XP_001774632.1|  predicted protein                                  197   2e-59   
ref|XP_001765908.1|  predicted protein                                  197   2e-59   
ref|XP_001765967.1|  predicted protein                                  197   3e-59   
emb|CBX25071.1|  40S ribosomal protein S3a                              194   3e-58   Polytomella sp. Pringsheim 198.80
ref|XP_005650618.1|  ribosomal protein S3Ae                             193   6e-58   Coccomyxa subellipsoidea C-169
ref|XP_001777314.1|  predicted protein                                  192   2e-57   
gb|EMT30223.1|  40S ribosomal protein S3a                               188   5e-56   
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          187   1e-55   
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    187   2e-55   Ostreococcus lucimarinus CCE9901
emb|CEG00819.1|  Ribosomal protein S3Ae                                 187   2e-55   Ostreococcus tauri
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                187   3e-55   Pediculus humanus corporis [human body lice]
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          185   6e-55   Zea mays [maize]
gb|KDR16079.1|  40S ribosomal protein S3a                               184   2e-54   Zootermopsis nevadensis
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         184   3e-54   Periplaneta americana
gb|AGM32131.1|  40S ribosomal protein S3a                               184   3e-54   Coptotermes formosanus
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         184   5e-54   Biphyllus lunatus
gb|ABS44871.1|  ribosomal protein S3Ae                                  182   7e-54   Pteromalus puparum
gb|KFM56731.1|  40S ribosomal protein S3a                               181   7e-54   Stegodyphus mimosarum
gb|ACD61705.1|  ribosomal protein S3                                    183   7e-54   Chironomus riparius
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               183   9e-54   Nasonia vitripennis
ref|XP_011495909.1|  PREDICTED: 40S ribosomal protein S3a               181   3e-53   Ceratosolen solmsi marchali
emb|CCD22031.1|  40S ribosomal protein S3A                              177   3e-53   Cupiennius salei
dbj|BAN20332.1|  ribosomal protein S3A                                  181   3e-53   Riptortus pedestris
gb|ABX75452.1|  40S ribosomal protein S3a                               180   4e-53   Lycosa singoriensis
ref|XP_008555289.1|  PREDICTED: 40S ribosomal protein S3a               181   6e-53   Microplitis demolitor
emb|CAJ17219.1|  ribosomal protein S3Ae                                 180   9e-53   Timarcha balearica
ref|XP_968064.1|  PREDICTED: 40S ribosomal protein S3a                  180   2e-52   Tribolium castaneum [rust-red flour beetle]
ref|XP_011155135.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Harpegnathos saltator
ref|XP_011159168.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Solenopsis invicta [imported red fire ant]
ref|XP_011142878.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Harpegnathos saltator
gb|AAV84249.1|  ribosomal protein S3                                    178   2e-52   Culicoides sonorensis
ref|XP_011060675.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Acromyrmex echinatior
ref|XP_011352079.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Ooceraea biroi
ref|XP_011259689.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Camponotus floridanus
ref|XP_007508881.1|  predicted protein                                  179   4e-52   Bathycoccus prasinos
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    177   4e-52   
gb|ACD65096.1|  putative 40S ribosomal protein RPS3A                    176   5e-52   Novocrania anomala
ref|XP_003399883.1|  PREDICTED: 40S ribosomal protein S3a-like          178   5e-52   Bombus terrestris [large earth bumblebee]
ref|XP_003704988.1|  PREDICTED: 40S ribosomal protein S3a-like          178   5e-52   Megachile rotundata
gb|AAU06483.1|  ribosomal protein subunit 3                             178   6e-52   Culicoides sonorensis
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  178   6e-52   
sp|A6YPJ8.1|RS3A_TRIIF  RecName: Full=40S ribosomal protein S3a         178   8e-52   Triatoma infestans
gb|KDD76342.1|  ribosomal protein S3Ae                                  177   1e-51   Helicosporidium sp. ATCC 50920
ref|XP_011297729.1|  PREDICTED: 40S ribosomal protein S3a               177   2e-51   Fopius arisanus
gb|ACY71306.1|  ribosomal protein S3A                                   177   2e-51   Chrysomela tremula
ref|XP_008478156.1|  PREDICTED: 40S ribosomal protein S3a               175   2e-51   
gb|ABI52667.1|  40S ribosomal protein S3a                               176   5e-51   Argas monolakensis
gb|ABW23199.1|  ribosomal protein rps3a                                 176   6e-51   Eurythoe complanata
gb|EDL42086.1|  mCG2066                                                 172   6e-51   Mus musculus [mouse]
dbj|BAH12261.1|  unnamed protein product                                172   7e-51   Homo sapiens [man]
sp|Q4KTD9.1|RS3A_SUBDO  RecName: Full=40S ribosomal protein S3a         175   9e-51   Suberites domuncula
dbj|BAC56507.1|  similar to ribosomal protein S3a                       171   1e-50   Bos taurus [bovine]
emb|CAB46830.1|  Ribosomal protein                                      172   1e-50   Canis lupus familiaris [dogs]
gb|KGL84225.1|  hypothetical protein N309_14824                         172   1e-50   Tinamus guttatus
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          175   1e-50   Pantholops hodgsonii [Tibetan antelope]
gb|ABZ04255.1|  ribosomal protein rps3a                                 173   1e-50   Lineus viridis
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             174   2e-50   Helobdella robusta
gb|AEE62515.1|  unknown                                                 174   2e-50   Dendroctonus ponderosae
ref|XP_004049753.1|  PREDICTED: 40S ribosomal protein S3a-like          171   2e-50   
ref|XP_004088582.1|  PREDICTED: 40S ribosomal protein S3a               173   2e-50   Nomascus leucogenys [White-cheeked Gibbon]
gb|AAT76631.1|  ribosomal protein S3a                                   173   2e-50   Felis catus [cat]
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               174   2e-50   
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    173   3e-50   Homo sapiens [man]
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   Acanthisitta chloris
ref|XP_005149013.1|  PREDICTED: 40S ribosomal protein S3a isoform X4    172   3e-50   Melopsittacus undulatus
gb|EOB04964.1|  40S ribosomal protein S3a                               173   3e-50   Anas platyrhynchos [duck]
ref|XP_005710608.1|  40S ribosomal protein S3A                          174   3e-50   Chondrus crispus [carageen]
gb|EFB26537.1|  hypothetical protein PANDA_001716                       173   3e-50   Ailuropoda melanoleuca
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    173   3e-50   Leptonychotes weddellii
ref|XP_007055759.1|  PREDICTED: 40S ribosomal protein S3a-A isofo...    172   3e-50   
ref|XP_005517609.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    172   3e-50   
ref|NP_001129593.1|  ribosomal protein S3A                              174   3e-50   Acyrthosiphon pisum
gb|KFO84143.1|  40S ribosomal protein S3a                               173   3e-50   Buceros rhinoceros silvestris
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   Tauraco erythrolophus
gb|KFW97162.1|  40S ribosomal protein S3a                               173   3e-50   Phalacrocorax carbo [common cormorant]
gb|KFM10230.1|  40S ribosomal protein S3a                               173   3e-50   Aptenodytes forsteri
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   Colius striatus
gb|KFR12636.1|  40S ribosomal protein S3a                               173   3e-50   Opisthocomus hoazin [hoatzin]
gb|EMC77645.1|  40S ribosomal protein S3a                               173   3e-50   
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   
tpg|DAA34106.1|  TPA: 40S ribosomal protein S3a                         172   3e-50   Amblyomma variegatum
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   Tyto alba [Schleiereule]
gb|KFP00832.1|  40S ribosomal protein S3a                               173   3e-50   Calypte anna
ref|NP_001279332.1|  ribosomal protein S3A                              174   3e-50   Callorhinchus milii [Australian ghost shark]
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    174   3e-50   
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               173   3e-50   
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               174   3e-50   
gb|KFP91786.1|  40S ribosomal protein S3a                               173   3e-50   
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               174   4e-50   
gb|EAW77579.1|  hCG33299, isoform CRA_c                                 173   4e-50   
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          174   4e-50   
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    173   4e-50   
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 173   4e-50   
dbj|BAE88391.1|  unnamed protein product                                173   4e-50   
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         173   4e-50   
gb|EAX04994.1|  ribosomal protein S3A, isoform CRA_g                    173   4e-50   
ref|XP_004088583.1|  PREDICTED: 40S ribosomal protein S3a               171   4e-50   
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    173   4e-50   
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    173   4e-50   
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               173   4e-50   
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    173   4e-50   
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    173   4e-50   
dbj|BAE32029.1|  unnamed protein product                                173   4e-50   
gb|AAA35682.1|  ribosmal protein small subunit                          173   4e-50   
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          173   4e-50   
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    173   4e-50   
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
gb|AAH66926.1|  Ribosomal protein S3A                                   173   5e-50   
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         173   5e-50   
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
ref|NP_001075886.1|  ribosomal protein S3A                              173   5e-50   
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
ref|NP_058655.3|  40S ribosomal protein S3a                             173   5e-50   
dbj|BAF83764.1|  unnamed protein product                                173   5e-50   
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   173   5e-50   
gb|ELW69964.1|  40S ribosomal protein S3a                               173   5e-50   
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          173   5e-50   
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_007635341.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    173   5e-50   
ref|NP_001185510.1|  40S ribosomal protein S3a                          173   5e-50   
ref|NP_058849.1|  40S ribosomal protein S3a                             173   5e-50   
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
dbj|BAE87927.1|  unnamed protein product                                173   5e-50   
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               173   6e-50   
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    173   6e-50   
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    173   6e-50   
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          173   6e-50   
gb|ELK25366.1|  40S ribosomal protein S3a                               170   6e-50   
sp|Q56FG9.1|RS3A_LYSTE  RecName: Full=40S ribosomal protein S3a         173   6e-50   
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               173   7e-50   
gb|ETE70827.1|  40S ribosomal protein S3a                               173   7e-50   
gb|EFX89527.1|  hypothetical protein DAPPUDRAFT_303071                  173   7e-50   
gb|KIY97031.1|  small subunit ribosomal protein S3Ae                    171   7e-50   
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    173   7e-50   
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               173   8e-50   
ref|XP_010223052.1|  PREDICTED: 40S ribosomal protein S3a               173   8e-50   
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          172   8e-50   
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               172   8e-50   
ref|XP_009565584.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    172   8e-50   
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               172   8e-50   
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    173   9e-50   
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          173   9e-50   
sp|B0WN96.2|RS3A_CULQU  RecName: Full=40S ribosomal protein S3a         172   9e-50   
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          172   9e-50   
dbj|BAB22611.1|  unnamed protein product                                172   1e-49   
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        172   1e-49   
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               172   1e-49   
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          172   1e-49   
ref|NP_001008075.1|  40S ribosomal protein S3a                          172   1e-49   
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          172   1e-49   
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       172   1e-49   
gb|AFM88910.1|  40S ribosomal protein S3a                               172   1e-49   
gb|EAX04993.1|  ribosomal protein S3A, isoform CRA_f                    172   1e-49   
dbj|BAE30393.1|  unnamed protein product                                172   1e-49   
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               172   1e-49   
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          172   1e-49   
ref|XP_002744350.1|  PREDICTED: 40S ribosomal protein S3a               172   1e-49   
gb|AFM85626.1|  40S ribosomal protein S3a                               172   1e-49   
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        172   1e-49   
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               172   1e-49   
ref|XP_003786993.1|  PREDICTED: 40S ribosomal protein S3a-like          172   2e-49   
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               174   2e-49   
gb|ELW51946.1|  40S ribosomal protein S3a                               170   2e-49   
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               172   2e-49   
ref|XP_002505259.1|  predicted protein                                  172   2e-49   
ref|NP_001098311.1|  40S ribosomal protein S3a                          172   2e-49   
emb|CAD91420.1|  ribosomal protein S3a                                  172   2e-49   
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         172   2e-49   
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a-like is...    172   2e-49   
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               172   2e-49   
ref|NP_001134789.1|  40S ribosomal protein S3a                          172   2e-49   
gb|AFM88988.1|  ribosomal protein S3a                                   172   2e-49   
ref|NP_001291168.1|  ribosomal protein S3A                              172   2e-49   
gb|ACD65136.1|  putative 40S ribosomal protein RPS3A                    169   2e-49   
ref|XP_009210953.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    171   2e-49   
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 171   2e-49   
gb|ABY28374.1|  ribosomal protein S3a                                   171   2e-49   
gb|ELW50426.1|  40S ribosomal protein S3a                               173   2e-49   
gb|ADO29317.1|  40S ribosomal protein s3a                               171   2e-49   
gb|AFM88390.1|  ribosomal protein S3a                                   171   2e-49   
ref|NP_956353.1|  40S ribosomal protein S3a                             171   3e-49   
ref|XP_011395666.1|  40S ribosomal protein S3a                          171   3e-49   
gb|AEP43788.1|  40S ribosomal protein S3a                               171   3e-49   
gb|AGQ03805.1|  ribosomal protein S3A                                   171   3e-49   
gb|AAT44427.1|  V-Fos transformation effector-like protein              171   3e-49   
dbj|BAE27060.1|  unnamed protein product                                171   3e-49   
gb|EKC30815.1|  40S ribosomal protein S3a                               172   3e-49   
gb|ACQ58827.1|  40S ribosomal protein S3a                               171   3e-49   
ref|XP_008588996.1|  PREDICTED: 40S ribosomal protein S3a-like          173   3e-49   
gb|AFM90263.1|  40S ribosomal protein S3a                               171   3e-49   
ref|XP_001651595.1|  AAEL005901-PA                                      170   3e-49   
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               174   3e-49   
ref|NP_001270826.1|  40S ribosomal protein S3a                          171   3e-49   
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               171   3e-49   
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          171   3e-49   
ref|XP_001850180.1|  40S ribosomal protein S3a                          174   3e-49   
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               171   4e-49   
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         171   4e-49   
ref|XP_001837102.1|  40S ribosomal protein S1                           171   4e-49   
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         171   4e-49   
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               171   4e-49   
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               172   4e-49   
ref|XP_009494472.1|  30S ribosomal protein S3Ae                         171   4e-49   
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          171   4e-49   
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               174   4e-49   
ref|XP_005149012.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    170   4e-49   
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         171   4e-49   
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    171   5e-49   
emb|CAJ17199.1|  ribosomal protein S3Ae                                 171   5e-49   
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     170   5e-49   
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  170   6e-49   
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              171   6e-49   
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   170   6e-49   
ref|XP_001633847.1|  predicted protein                                  170   6e-49   
ref|XP_006994622.1|  PREDICTED: 40S ribosomal protein S3a-like          170   7e-49   
sp|A5JSW9.1|RS3A_BOMMA  RecName: Full=40S ribosomal protein S3a         170   8e-49   
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               174   9e-49   
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               170   9e-49   
ref|XP_001651594.1|  AAEL005901-PB                                      170   1e-48   
gb|AAK95185.1|  40S ribosomal protein S3a                               170   1e-48   
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         170   1e-48   
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              170   1e-48   
ref|XP_001774288.1|  predicted protein                                  169   1e-48   
dbj|BAQ21252.1|  hypothetical protein                                   166   1e-48   
ref|NP_001131091.1|  40S ribosomal protein S3a                          169   1e-48   
ref|XP_004412479.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   
ref|XP_006902571.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   
ref|XP_004897638.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    168   2e-48   
gb|ADI50268.1|  S3a protein                                             169   2e-48   
gb|KIY51600.1|  ribosomal protein S3Ae                                  169   2e-48   
ref|XP_005572524.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   
gb|ACT21541.1|  s3a protein                                             169   2e-48   
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        169   2e-48   
ref|XP_004349214.1|  ribosomal protein S3a                              169   2e-48   
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   
ref|XP_007116397.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   
gb|ACY95341.1|  ribosomal protein S3A                                   169   3e-48   
gb|ELR56309.1|  hypothetical protein M91_13443                          166   3e-48   
emb|CCQ18660.1|  40S ribosomal protein S3A                              169   3e-48   
gb|ELW47898.1|  40S ribosomal protein S3a                               165   3e-48   
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          168   3e-48   
ref|XP_004844830.1|  PREDICTED: 40S ribosomal protein S3a-like          168   3e-48   
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          168   3e-48   
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   168   4e-48   
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    168   4e-48   
ref|XP_003385841.1|  PREDICTED: 40S ribosomal protein S3a-like          168   4e-48   
ref|XP_007338149.1|  40S ribosomal protein S1                           168   4e-48   
ref|XP_006821611.1|  PREDICTED: 40S ribosomal protein S3a-like          168   5e-48   
ref|XP_003191240.1|  40s ribosomal protein s3ae-a (s1-a)                168   5e-48   
gb|AGH70187.1|  40S ribosomal protein S3a                               168   5e-48   
ref|XP_005641295.1|  PREDICTED: 40S ribosomal protein S3a-like          168   5e-48   
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   167   5e-48   
gb|KIV90937.1|  40S ribosomal protein S1                                168   5e-48   
ref|XP_003060358.1|  predicted protein                                  167   5e-48   
sp|Q95V35.1|RS3A_SPOFR  RecName: Full=40S ribosomal protein S3a         168   6e-48   
dbj|BAM17666.1|  ribosomal protein S3A                                  168   6e-48   
gb|KGB79628.1|  40S ribosomal protein S3ae-a                            168   6e-48   
gb|ADT80700.1|  ribosomal protein S3A                                   168   6e-48   
ref|XP_007843081.1|  40s ribosomal protein s3ae                         167   6e-48   
gb|ACV83781.1|  ribosomal protein S3A                                   168   6e-48   
gb|EHH54012.1|  hypothetical protein EGM_14744                          168   6e-48   
ref|XP_005978767.1|  PREDICTED: 40S ribosomal protein S3a-like          168   6e-48   
ref|XP_002901276.1|  40S ribosomal protein S3a                          167   6e-48   
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   167   6e-48   
ref|XP_006883035.1|  PREDICTED: 40S ribosomal protein S3a-like          167   7e-48   
ref|XP_004420966.1|  PREDICTED: 40S ribosomal protein S3a isoform 1     167   8e-48   
ref|XP_003038024.1|  40S ribosomal protein S1                           167   8e-48   
gb|KEF61644.1|  40S ribosomal protein S1                                167   8e-48   
ref|XP_004630040.1|  PREDICTED: 40S ribosomal protein S3a-like          166   9e-48   
emb|CCM04869.1|  predicted protein                                      167   9e-48   
ref|XP_568980.1|  40s ribosomal protein s3ae-a (s1-a)                   167   9e-48   
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             167   1e-47   
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                   167   1e-47   
ref|XP_005538843.1|  40S ribosomal protein S3A                          167   1e-47   
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           167   1e-47   
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   167   1e-47   
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          167   1e-47   
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...    167   1e-47   
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    167   1e-47   
ref|XP_008071134.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    167   1e-47   
ref|XP_003433155.1|  PREDICTED: 40S ribosomal protein S3a-like          167   1e-47   
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  167   1e-47   
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          167   1e-47   
ref|XP_009827334.1|  hypothetical protein H257_04494                    167   1e-47   
ref|NP_001037255.1|  40S ribosomal protein S3a                          167   1e-47   
ref|XP_007767741.1|  ribosomal protein S3Ae                             166   2e-47   
gb|EHJ68722.1|  s3a protein                                             167   2e-47   
gb|KDN43521.1|  40S ribosomal protein S1                                167   2e-47   



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTL  135



>gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlisea aurea]
Length=165

 Score =   216 bits (549),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  30   DWYDVKAPSIFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  89

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  90   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  137



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  135



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAH+DVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHIDVKTTDNYTL  135



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  135



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTL  135



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDVKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  135



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTL  135



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  34   DWYDVKAPSIFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  93

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  94   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  141



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTL  135



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTL  135



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNY+L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYSL  135



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFSQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNERNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNY+L
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYSL  135



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAH+DVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHIDVKTTDNYTL  135



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+N+LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNLLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTL
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTL  135



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  12   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  71

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  72   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  120



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +EDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   SEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TL
Sbjct  88   AEDVQGRNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTL  135



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFKVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTL  135



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLR
Sbjct  28   DWYDIKAPSLFITRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLVKKWQSLIEAHVDVKTTDN+TL
Sbjct  88   AEDVQGKNVLTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTL  135



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQSLIEAHVDVKT+D YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTSDGYTL  135



>gb|ABK24527.1| unknown [Picea sitchensis]
Length=165

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTL
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTL  135



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|ACR37738.1| unknown [Zea mays]
 gb|AFW89327.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=175

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  9    DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  68

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  69   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  116



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+TRNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPTLFNTRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   211 bits (537),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTL
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTL  135



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   211 bits (537),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDSYTL  135



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS R+IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRDIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP  F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTL  135



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  12   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  71

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  72   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  119



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS FS +N+GKTLV+RTQGTKIASEGLKHRVF++SLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSAFSVKNVGKTLVSRTQGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +F+TRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   EWYDIKAPLLFNTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY +
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMI  135



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>tpg|DAA43947.1| TPA: hypothetical protein ZEAMMB73_528269, partial [Zea mays]
Length=188

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTL  135



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  205



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTL  135



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  100  DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  159

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  160  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  207



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTD Y L
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYML  135



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIK PS+FS R IGKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKVPSIFSVRTIGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ R +GKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKAPSVFNVRTVGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSLFNQRQVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRV  +SLADLQNDED A+RKIRLR
Sbjct  6    DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLR  65

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  66   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  113



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDK+RSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKVRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   EWYDIKAPLLFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  205



>ref|XP_002463139.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
 gb|EER99660.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
Length=218

 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE SLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEASLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+L EAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLTEAHVDVKTTDNYML  135



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +NIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSIFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE  LADLQNDED A++KIRLR
Sbjct  28   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTL  135



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTL  135



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTL  135



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTL  135



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTL  135



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTL  135



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTL  135



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDN+TL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNFTL  135



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   EWYDIKAPLIFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTL  135



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTL  135



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSNFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTL
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDAYTL  135



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  136



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +EDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TL
Sbjct  88   SEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTL  135



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPASFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTL  135



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLR
Sbjct  28   DWYDVKAPASFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVF+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLR
Sbjct  416  DWYDVKAPSVFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLR  475

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  476  AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  523



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  135



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +T 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTF  135



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTL  135



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDK+R LV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFT DKLRSLV+KWQ+LIEAH DVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTNDKLRSLVRKWQTLIEAHADVKTTDNYTL  135



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLR
Sbjct  33   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLR  92

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  93   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  140



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTL  135



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTL  135



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  27   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  87   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  134



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  11   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  70

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  71   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  118



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTT NY L
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTXNYML  135



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +EDVQG+NVLTNFWGMD TTDKLR +V++WQ+LIEAHVDVKTTDNYTL
Sbjct  88   SEDVQGKNVLTNFWGMDLTTDKLRHIVRRWQTLIEAHVDVKTTDNYTL  135



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   206 bits (524),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  69   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  128

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTL
Sbjct  129  AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTL  176



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQ RNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQDRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  32   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  91

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  92   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  139



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  384
            WYDIKAP +F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRA  88

Query  385  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  89   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  135



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTL  135



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 106/109 (97%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 106/109 (97%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTL  136



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTL  135



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTL  135



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VF  +N+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPNVFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  135



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDK+R +V+KW +LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYIVRKWLTLIEAHVDVKTTDNYTL  135



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KA S F+ R IGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LR
Sbjct  28   DWYDVKAMSTFNVRQIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTL  135



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLR  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTL
Sbjct  87   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTL  134



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTL  135



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+ APS+F+ R +G TLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDVTAPSLFNVRKVGVTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKDVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEV LADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ + +GKTLVTRTQGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSIFNIKQVGKTLVTRTQGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGR VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGRTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNHQNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTL
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTL  135



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   201 bits (510),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   201 bits (510),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  135



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VF+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTVFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTL
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTL  135



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYT  522
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVD +  +  T
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDRQNQNKKT  134



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTMFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTL
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTL  135



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +N+GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQI  135



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TL
Sbjct  68   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTL  115



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TL
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTL  135



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  397  DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  456

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTL
Sbjct  457  AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTL  504



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KW +LIEA+VDVKTTDN+TL
Sbjct  68   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTL  115



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+ + +GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNIFTQKALGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQL  135



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  135



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQL  135



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQL  135



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYML  135



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY L
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYML  135



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP  FS RN+GKTLVTRTQGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR
Sbjct  28   DWYDLKAPGFFSVRNVGKTLVTRTQGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRN LTNF+GMDFTTDKLR L++KWQSLIEAHVDVKTTD Y+L
Sbjct  88   VEDVQGRNCLTNFYGMDFTTDKLRFLIRKWQSLIEAHVDVKTTDGYSL  135



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F++RN+GKTLVTRTQGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR
Sbjct  28   DWYDVKAPSSFTSRNVGKTLVTRTQGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRN LTNFWGMD+TTDKLRSLV+KWQ+LIEA VDVKTTD Y L
Sbjct  88   VEDVQGRNCLTNFWGMDYTTDKLRSLVRKWQTLIEAQVDVKTTDGYLL  135



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 6/114 (5%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTK------IASEGLKHRVFEVSLADLQNDEDNAF  363
            DWYDIKAP+ F+ +N+GKTLVTRT GTK      IAS+GLK RVFEVSLADLQNDED AF
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKAISSSDIASDGLKGRVFEVSLADLQNDEDQAF  87

Query  364  RKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RKI+LRAEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +
Sbjct  88   RKIKLRAEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYMI  141



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 6/107 (6%)
 Frame = +1

Query  205  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  384
            WYDIKAP +F++RN+GKTLV+RTQ      EGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQ------EGLKHRVFEVSLADLQNDEDQAYRKIRLRA  82

Query  385  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY L
Sbjct  83   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYML  129



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 95/115 (83%), Gaps = 7/115 (6%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQG-------TKIASEGLKHRVFEVSLADLQNDEDNA  360
            DWYDIKAPSVFS RNIGKT V  T           IASEGLKHRVFEV LADLQ DED A
Sbjct  28   DWYDIKAPSVFSVRNIGKTSVQDTGCYSISNFIQNIASEGLKHRVFEVCLADLQGDEDQA  87

Query  361  FRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  88   YRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  142



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RNIGKTLV+RTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVSRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD YTL
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTL  135



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RNIGKTLVTRTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVTRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD Y+L
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYSL  135



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAHVDVKTTDGYLL  138



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            D YDIKAP VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSL DL +DED  + KIRL 
Sbjct  28   DRYDIKAPPVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLC  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQG NV+TNFWGM FTTDKL SLVKKWQ LIEAHV++KTTDNY L
Sbjct  88   AEDVQGGNVITNFWGMSFTTDKLHSLVKKWQRLIEAHVNIKTTDNYML  135



>gb|KDR16079.1| 40S ribosomal protein S3a [Zootermopsis nevadensis]
Length=263

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>sp|Q5G5C4.1|RS3A_PERAM RecName: Full=40S ribosomal protein S3a [Periplaneta americana]
 gb|AAW57773.1| Parcxpwex01 [Periplaneta americana]
Length=263

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>gb|AGM32131.1| 40S ribosomal protein S3a [Coptotermes formosanus]
Length=272

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  38   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  97

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  98   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  147



>sp|Q6EV04.1|RS3A_BIPLU RecName: Full=40S ribosomal protein S3a [Biphyllus lunatus]
 emb|CAH04315.1| S3Ae ribosomal protein [Biphyllus lunatus]
Length=267

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAP +F+TR +GKTLV RTQGTKIASEGLKHRVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPCMFATRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQNDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQSLIEA  DVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQSLIEASADVKTTDGYLL  138



>gb|ABS44871.1| ribosomal protein S3Ae [Pteromalus puparum]
Length=249

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  375
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  11   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  70

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+L
Sbjct  71   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSL  120



>gb|KFM56731.1| 40S ribosomal protein S3a, partial [Stegodyphus mimosarum]
Length=187

 Score =   181 bits (458),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPAMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDEI-AFRKFRLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  135



>gb|ACD61705.1| ribosomal protein S3 [Chironomus riparius]
Length=270

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYDIKAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  29   DWYDIKAPSMFTTRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFK  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLL  138



>ref|XP_001601315.1| PREDICTED: 40S ribosomal protein S3a [Nasonia vitripennis]
Length=267

 Score =   183 bits (464),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  375
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  29   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSL  138



>ref|XP_011495909.1| PREDICTED: 40S ribosomal protein S3a [Ceratosolen solmsi marchali]
Length=267

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPSVF+ R++GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D D   +FRK R
Sbjct  29   DWYDVKAPSVFTVRHVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDHDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGR VLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+L
Sbjct  89   LIAEDVQGRGVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSL  138



>emb|CCD22031.1| 40S ribosomal protein S3A [Cupiennius salei]
Length=149

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP +FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPVMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDEI-AFRKFRLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  135



>dbj|BAN20332.1| ribosomal protein S3A [Riptortus pedestris]
Length=262

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFNTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDSDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLL  138



>gb|ABX75452.1| 40S ribosomal protein S3a [Lycosa singoriensis]
Length=223

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP +FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPVMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDE-IAFRKFRLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  135



>ref|XP_008555289.1| PREDICTED: 40S ribosomal protein S3a [Microplitis demolitor]
Length=266

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND+D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKLRVFEVSLADLQNDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRSVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>emb|CAJ17219.1| ribosomal protein S3Ae [Timarcha balearica]
Length=268

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLL  138



>ref|XP_968064.1| PREDICTED: 40S ribosomal protein S3a [Tribolium castaneum]
 gb|EFA05373.1| hypothetical protein TcasGA2_TC015539 [Tribolium castaneum]
Length=267

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTTDGYLL  138



>ref|XP_011155135.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN87627.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_011159168.1| PREDICTED: 40S ribosomal protein S3a [Solenopsis invicta]
Length=267

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_011142878.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN82270.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>gb|AAV84249.1| ribosomal protein S3 [Culicoides sonorensis]
Length=215

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  27   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  86

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y L
Sbjct  87   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLL  136



>ref|XP_011060675.1| PREDICTED: 40S ribosomal protein S3a [Acromyrmex echinatior]
 gb|EGI61728.1| 40S ribosomal protein S3a [Acromyrmex echinatior]
Length=267

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_011352079.1| PREDICTED: 40S ribosomal protein S3a [Cerapachys biroi]
 gb|EZA60712.1| 40S ribosomal protein S3a [Cerapachys biroi]
Length=267

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_011259689.1| PREDICTED: 40S ribosomal protein S3a [Camponotus floridanus]
 gb|EFN66139.1| 40S ribosomal protein S3a [Camponotus floridanus]
Length=267

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ RN+GKT  TRTQGTKIAS+GLK R+FE SLADL  DED AFRK+ L+
Sbjct  36   DWYDIKAPSMFTVRNVGKTPQTRTQGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLK  95

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+NVLTNF+GMDFTTDK+RSLV+KW SLIE  VDVKTTD YT+
Sbjct  96   CEDVQGKNVLTNFYGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTM  143



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  250  GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGM  429
            GKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM
Sbjct  15   GKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGM  74

Query  430  DFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY L
Sbjct  75   NFTTDKLRSLVKKWQTLIEAHVDVKTTDNYML  106



>gb|ACD65096.1| putative 40S ribosomal protein RPS3A [Novocrania anomala]
Length=185

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIAS+GLK RVFE +LADLQNDE  +FRK +L 
Sbjct  29   DWYDVKAPSMFAVRQIGKTLVTRTQGTKIASDGLKGRVFECALADLQNDEI-SFRKFKLM  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AEDVQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  88   AEDVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  135



>ref|XP_003399883.1| PREDICTED: 40S ribosomal protein S3a-like [Bombus terrestris]
 ref|XP_003493551.1| PREDICTED: 40S ribosomal protein S3a-like [Bombus impatiens]
 ref|XP_003695223.1| PREDICTED: 40S ribosomal protein S3a-like [Apis florea]
 ref|XP_006565264.1| PREDICTED: 40S ribosomal protein S3a [Apis mellifera]
 ref|XP_006615653.1| PREDICTED: 40S ribosomal protein S3a-like [Apis dorsata]
Length=267

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R++GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTNRHVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDGDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQHRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>ref|XP_003704988.1| PREDICTED: 40S ribosomal protein S3a-like [Megachile rotundata]
Length=267

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R++GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTNRHVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDGDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQHRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>gb|AAU06483.1| ribosomal protein subunit 3 [Culicoides sonorensis]
Length=265

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  30   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  89

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y L
Sbjct  90   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLL  139



>gb|ERZ98268.1| hypothetical protein GLOINDRAFT_339726, partial [Rhizophagus 
irregularis DAOM 181602]
Length=253

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F  RNIGKTLV RTQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR
Sbjct  24   DWYDVKAPSIFEVRNIGKTLVNRTQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLR  83

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             ++VQG+N+LTNF GMDFT+DKLRSLVKKWQSLIEAHVDVKTTD Y L
Sbjct  84   VDEVQGKNLLTNFHGMDFTSDKLRSLVKKWQSLIEAHVDVKTTDGYLL  131



>sp|A6YPJ8.1|RS3A_TRIIF RecName: Full=40S ribosomal protein S3a [Triatoma infestans]
 gb|ABR27894.1| 40S ribosomal protein S3a [Triatoma infestans]
Length=262

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFTTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSYRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y L
Sbjct  89   LIAEDVQARNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLL  138



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLVTRT GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR
Sbjct  28   DWYDIKAPSMFSVRNVGKTLVTRTAGTKIASDGLKGRIINVSLADLQSNEADAYRNIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQGRN LT+F GMD TTDKLRSLV+KWQ+LIEAHVDV+T D YTL
Sbjct  88   IEDVQGRNCLTHFHGMDLTTDKLRSLVRKWQTLIEAHVDVRTADGYTL  135



>ref|XP_011297729.1| PREDICTED: 40S ribosomal protein S3a [Fopius arisanus]
Length=266

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDHDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQ R+VLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   LIAEDVQHRSVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  138



>gb|ACY71306.1| ribosomal protein S3A [Chrysomela tremula]
Length=269

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR +GKTLV RTQGT+IASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTRIASEGLKSRVFEVSLADLQNDNDAERSYRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y L
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLL  138



>ref|XP_008478156.1| PREDICTED: 40S ribosomal protein S3a [Diaphorina citri]
Length=208

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 3/111 (3%)
 Frame = +1

Query  202  DWYDIKAPS-VFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKI  372
            DWYD+KAPS +F+ + +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D+D   +FRK 
Sbjct  29   DWYDVKAPSAMFTNKQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDQDAERSFRKF  88

Query  373  RLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            RL AEDVQG NVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y L
Sbjct  89   RLIAEDVQGHNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLL  139



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP ++S RNIGKT V RTQGTKIASEGLK RVFEVS ADLQN ED AFRK RL 
Sbjct  15   DWYDVKAPMMYSVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLI  73

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y L
Sbjct  74   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLL  121



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIASEGLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLV  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            AE+VQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDV+TTD + L
Sbjct  88   AEEVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVRTTDAFLL  135



>gb|EDL42086.1| mCG2066 [Mus musculus]
Length=173

 Score =   172 bits (437),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y L
Sbjct  88   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL  135



>dbj|BAH12261.1| unnamed protein product [Homo sapiens]
Length=175

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  16   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  74

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y L
Sbjct  75   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL  122



>sp|Q4KTD9.1|RS3A_SUBDO RecName: Full=40S ribosomal protein S3a [Suberites domuncula]
 gb|AAX48879.1| S3a [Suberites domuncula]
Length=252

 Score =   175 bits (443),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RNIGKTLVTRTQG K+AS+GLK RVFEVSLADLQNDE  +FRK RL 
Sbjct  28   DWYDVKAPSMFAVRNIGKTLVTRTQGKKLASDGLKGRVFEVSLADLQNDE-QSFRKFRLI  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
            +ED+QG+NVLTNF GM  TTDKLR+LVKKWQ+LIEA+VDVKTTD Y L
Sbjct  87   SEDIQGKNVLTNFHGMTMTTDKLRALVKKWQTLIEANVDVKTTDGYLL  134



>dbj|BAC56507.1| similar to ribosomal protein S3a [Bos taurus]
Length=159

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y L
Sbjct  88   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL  135



>emb|CAB46830.1| Ribosomal protein [Canis lupus familiaris]
Length=184

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  23   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  81

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y L
Sbjct  82   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL  129



>gb|KGL84225.1| hypothetical protein N309_14824, partial [Tinamus guttatus]
Length=167

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  8    DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLV  66

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAH+DVKTTD Y L
Sbjct  67   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHIDVKTTDGYLL  114



>ref|XP_005954900.1| PREDICTED: 40S ribosomal protein S3a-like [Pantholops hodgsonii]
Length=264

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP+VF+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPAVFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTL  525
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y L
Sbjct  88   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600