BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026F20

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05334.1|  unnamed protein product                                367   2e-118   Coffea canephora [robusta coffee]
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    364   4e-117   Solanum lycopersicum
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    361   4e-116   Solanum tuberosum [potatoes]
ref|XP_006587679.1|  PREDICTED: conserved oligomeric Golgi comple...    353   8e-115   
gb|AIU51149.1|  embryo yellow protein                                   355   1e-113   Lactuca sativa [cultivated lettuce]
emb|CAN76413.1|  hypothetical protein VITISV_043812                     343   2e-113   Vitis vinifera
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                353   9e-113   Erythranthe guttata [common monkey flower]
gb|AIU51119.1|  embryo yellow protein                                   352   1e-112   Glycine max [soybeans]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    352   1e-112   Glycine max [soybeans]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            352   1e-112   Glycine soja [wild soybean]
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         352   2e-112   Jatropha curcas
gb|AIU51131.1|  embryo yellow protein                                   351   3e-112   Manihot esculenta [manioc]
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    350   6e-112   Cicer arietinum [garbanzo]
gb|AIU51141.1|  embryo yellow protein                                   332   1e-111   Saruma henryi
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    349   3e-111   Eucalyptus grandis [rose gum]
gb|KEH17632.1|  oligomeric component-related/COG complex component      348   3e-111   Medicago truncatula
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            348   7e-111   Glycine soja [wild soybean]
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    348   7e-111   Citrus sinensis [apfelsine]
gb|AIU51115.1|  embryo yellow protein                                   348   8e-111   Carica papaya [mamon]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    347   9e-111   Nicotiana sylvestris
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    347   1e-110   Populus euphratica
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             346   2e-110   Citrus clementina [clementine]
ref|XP_002510953.1|  conserved hypothetical protein                     346   3e-110   Ricinus communis
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   346   3e-110   Citrus sinensis [apfelsine]
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    346   3e-110   Nicotiana tomentosiformis
gb|AIU51114.1|  embryo yellow protein                                   345   4e-110   Gossypium raimondii
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             345   7e-110   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   345   7e-110   Phaseolus vulgaris [French bean]
gb|AIU51110.1|  embryo yellow protein                                   345   1e-109   Theobroma cacao [chocolate]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    345   1e-109   Cucumis melo [Oriental melon]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    344   1e-109   
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    344   2e-109   Sesamum indicum [beniseed]
gb|AIU51140.1|  embryo yellow protein                                   344   2e-109   Ricinus communis
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    343   3e-109   
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    343   4e-109   
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    342   8e-109   Pyrus x bretschneideri [bai li]
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    342   9e-109   Cucumis sativus [cucumbers]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    342   9e-109   
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    342   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    337   1e-108   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    342   1e-108   Vitis vinifera
ref|XP_010089680.1|  hypothetical protein L484_001268                   342   1e-108   Morus notabilis
gb|AIU51120.1|  embryo yellow protein                                   335   4e-107   Illicium henryi
gb|AIU51152.1|  embryo yellow protein                                   337   6e-107   Platanus x hispanica [London plane tree]
gb|EPS73811.1|  hypothetical protein M569_00940                         337   1e-106   Genlisea aurea
gb|AIU51121.1|  embryo yellow protein                                   336   3e-106   Buxus sinica
emb|CDX99921.1|  BnaC09g27840D                                          330   4e-106   
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    335   4e-106   Nelumbo nucifera [Indian lotus]
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    333   2e-105   Prunus mume [ume]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    333   2e-105   Fragaria vesca subsp. vesca
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          333   3e-105   Amborella trichopoda
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    332   8e-105   
ref|XP_010442641.1|  PREDICTED: conserved oligomeric Golgi comple...    322   8e-105   Camelina sativa [gold-of-pleasure]
gb|AIU51151.1|  embryo yellow protein                                   331   2e-104   Cinnamomum camphora
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             331   2e-104   Prunus persica
emb|CDY00475.1|  BnaA10g07980D                                          330   2e-104   
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             330   2e-104   Eutrema salsugineum [saltwater cress]
gb|AIU51136.1|  embryo yellow protein                                   331   2e-104   Prunus persica
gb|AIU51147.1|  embryo yellow protein                                   330   3e-104   Schrenkiella parvula
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    330   4e-104   Tarenaya hassleriana [spider flower]
gb|AIU51106.1|  embryo yellow protein                                   328   1e-103   Magnolia denudata [haku-mokuren]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    328   2e-103   Arabis alpina [alpine rockcress]
gb|AIU51112.1|  embryo yellow protein                                   328   2e-103   Sarcandra glabra
gb|AIU51102.1|  embryo yellow protein                                   328   2e-103   Aquilegia coerulea [Rocky Mountain columbine]
emb|CDY56655.1|  BnaA02g11250D                                          327   3e-103   Brassica napus [oilseed rape]
gb|AIU51116.1|  embryo yellow protein                                   327   4e-103   Capsella rubella
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             327   5e-103   Capsella rubella
ref|NP_199956.1|  COG7-like protein EYE                                 327   6e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51104.1|  embryo yellow protein                                   327   7e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         327   7e-103   Medicago truncatula
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             327   7e-103   
gb|AIU51103.1|  embryo yellow protein                                   327   7e-103   Arabidopsis lyrata [lyrate rockcress]
dbj|BAF00649.1|  hypothetical protein                                   327   8e-103   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    327   8e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51129.1|  embryo yellow protein                                   326   8e-103   Medicago truncatula
gb|AIU51154.1|  embryo yellow protein                                   325   3e-102   Houttuynia cordata [chameleon-plant]
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    325   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    325   3e-102   Brassica rapa
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    323   2e-101   Camelina sativa [gold-of-pleasure]
emb|CDX91578.1|  BnaC02g15820D                                          321   5e-101   
gb|AIU51125.1|  embryo yellow protein                                   321   1e-100   Chimonanthus praecox [wintersweet]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    315   3e-100   
gb|AIU51150.1|  embryo yellow protein                                   319   4e-100   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51124.1|  embryo yellow protein                                   319   5e-100   Ceratophyllum demersum [hornwort]
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    313   9e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51128.1|  embryo yellow protein                                   311   6e-97    Aristolochia tagala
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    307   2e-95    Elaeis guineensis
gb|AIU51143.1|  embryo yellow protein                                   307   2e-95    Yucca filamentosa [Adam's-needle]
gb|AIU51157.1|  embryo yellow protein                                   305   1e-94    Trachycarpus fortunei
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    303   6e-94    Phoenix dactylifera
gb|AIU51156.1|  embryo yellow protein                                   299   2e-92    Alisma plantago-aquatica
gb|AIU51127.1|  embryo yellow protein                                   299   2e-92    Asparagus officinalis
gb|AIU51107.1|  embryo yellow protein                                   294   1e-90    Musa acuminata [banana]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    294   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51142.1|  embryo yellow protein                                   288   4e-88    Dioscorea oppositifolia
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         285   1e-87    
gb|AIU51108.1|  embryo yellow protein                                   284   1e-86    Pinellia ternata
ref|XP_001770876.1|  predicted protein                                  284   2e-86    
gb|AIU51153.1|  embryo yellow protein                                   276   5e-84    Ginkgo biloba [ginkgo]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    270   2e-81    Oryza brachyantha
gb|EEC81147.1|  hypothetical protein OsI_24056                          270   3e-81    Oryza sativa Indica Group [Indian rice]
gb|AIU51130.1|  embryo yellow protein                                   269   3e-81    Canna indica [canna]
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        270   4e-81    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51158.1|  embryo yellow protein                                   268   1e-80    Cabomba caroliniana
gb|AIU51144.1|  embryo yellow protein                                   267   2e-80    Setaria italica
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    267   2e-80    Setaria italica
dbj|BAJ94393.1|  predicted protein                                      267   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          266   6e-80    Sorghum bicolor [broomcorn]
gb|AIU51155.1|  embryo yellow protein                                   266   6e-80    Zea mays [maize]
gb|AIU51146.1|  embryo yellow protein                                   266   7e-80    Sorghum bicolor [broomcorn]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    265   7e-80    
dbj|BAJ95800.1|  predicted protein                                      263   4e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51137.1|  embryo yellow protein                                   259   1e-77    Panicum virgatum
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             253   2e-75    
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             250   2e-74    
gb|AIU51111.1|  embryo yellow protein                                   237   3e-69    Acorus calamus [flagroot]
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    222   9e-64    
gb|AIU51109.1|  embryo yellow protein                                   220   3e-63    Brachypodium distachyon [annual false brome]
gb|EEE66191.1|  hypothetical protein OsJ_22310                          212   3e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003055554.1|  predicted protein                                  169   4e-45    Micromonas pusilla CCMP1545
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    159   1e-41    Eucalyptus grandis [rose gum]
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             159   1e-41    Chlorella variabilis
ref|XP_002953697.1|  component of oligomeric golgi complex 7            156   6e-40    Volvox carteri f. nagariensis
ref|XP_002503576.1|  predicted protein                                  148   2e-37    Micromonas commoda
gb|EMT03910.1|  hypothetical protein F775_26031                         145   1e-36    
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       145   1e-36    Triticum urartu
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854              140   1e-34    Coccomyxa subellipsoidea C-169
ref|XP_001701937.1|  component of oligomeric golgi complex 7            138   4e-34    Chlamydomonas reinhardtii
ref|XP_001628559.1|  predicted protein                                  135   4e-33    Nematostella vectensis
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           132   7e-32    Ostreococcus tauri
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...    129   1e-30    Apis dorsata [rock honeybee]
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...    129   1e-30    Harpegnathos saltator
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...    128   2e-30    
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...    128   3e-30    Apis dorsata [rock honeybee]
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...    127   5e-30    
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...    127   6e-30    Acromyrmex echinatior
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...    127   7e-30    
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...    126   1e-29    
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...    126   1e-29    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...    125   2e-29    Solenopsis invicta [imported red fire ant]
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7            125   2e-29    Acromyrmex echinatior
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...    125   2e-29    Bombus terrestris [large earth bumblebee]
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...    124   5e-29    
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...    124   6e-29    
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7            123   1e-28    Zootermopsis nevadensis
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7            122   2e-28    Crassostrea gigas
ref|XP_006825808.1|  PREDICTED: conserved oligomeric Golgi comple...    115   6e-28    Saccoglossus kowalevskii
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...    117   9e-27    Crassostrea gigas
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-26    Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-26    Fopius arisanus
ref|XP_007903980.1|  PREDICTED: conserved oligomeric Golgi comple...    115   8e-26    Callorhinchus milii [Australian ghost shark]
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...    115   9e-26    Callorhinchus milii [Australian ghost shark]
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...    114   1e-25    Xiphophorus maculatus
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952             114   2e-25    Lottia gigantea
emb|CAG04322.1|  unnamed protein product                                110   5e-25    Tetraodon nigroviridis
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...    112   5e-25    Ciona intestinalis [sea vase]
ref|XP_007513783.1|  predicted protein                                  113   5e-25    Bathycoccus prasinos
ref|XP_008474492.1|  PREDICTED: conserved oligomeric Golgi comple...    108   6e-25    
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...    112   6e-25    Stegastes partitus
emb|CBN81326.1|  Conserved oligomeric Golgi complex subunit 7           110   8e-25    Dicentrarchus labrax [European sea bass]
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...    112   1e-24    
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...    112   1e-24    Oryzias latipes [Japanese rice fish]
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...    111   1e-24    Poecilia reticulata
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...    111   2e-24    Pundamilia nyererei
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...    111   2e-24    Poecilia formosa
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...    111   2e-24    Poecilia formosa
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...    111   2e-24    Lepisosteus oculatus
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    111   2e-24    Monodelphis domestica
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...    110   3e-24    Chrysemys picta bellii
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...    109   3e-24    
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...    110   4e-24    Oreochromis niloticus
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                  110   5e-24    Capitella teleta
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...    110   5e-24    Maylandia zebra
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...    110   6e-24    Takifugu rubripes [tiger puffer]
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...    110   6e-24    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...    109   6e-24    Neolamprologus brichardi [lyretail cichlid]
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...    109   8e-24    Chelonia mydas [green seaturtle]
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...    108   1e-23    
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...    108   1e-23    Haplochromis burtoni
ref|XP_008536012.1|  PREDICTED: conserved oligomeric Golgi comple...    103   2e-23    Equus przewalskii [Przewalski horse]
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...    107   3e-23    Anolis carolinensis [Carolina anole]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...    107   4e-23    
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...    107   6e-23    Tribolium castaneum [rust-red flour beetle]
ref|NP_001015714.1|  component of oligomeric golgi complex 7            106   8e-23    Xenopus tropicalis [western clawed frog]
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7       106   8e-23    Gallus gallus [bantam]
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...    106   8e-23    
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...    106   1e-22    Nasonia vitripennis
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...    105   1e-22    Nasonia vitripennis
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...    105   2e-22    Microtus ochrogaster [prairie voles]
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...    105   2e-22    Orycteropus afer afer
ref|NP_001085832.1|  component of oligomeric golgi complex 7            105   3e-22    Xenopus laevis [clawed frog]
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...    105   3e-22    
ref|XP_005656829.1|  PREDICTED: conserved oligomeric Golgi comple...    104   4e-22    
ref|XP_010568819.1|  PREDICTED: conserved oligomeric Golgi comple...    104   4e-22    Haliaeetus leucocephalus
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...    104   4e-22    Esox lucius
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...    104   4e-22    Ictidomys tridecemlineatus
ref|XP_010568818.1|  PREDICTED: conserved oligomeric Golgi comple...    103   5e-22    Haliaeetus leucocephalus
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...    104   5e-22    Ceratosolen solmsi marchali
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...    104   5e-22    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...    104   5e-22    Alligator sinensis
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    104   5e-22    
ref|XP_001418731.1|  predicted protein                                  104   6e-22    Ostreococcus lucimarinus CCE9901
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...    103   6e-22    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...    103   6e-22    Haliaeetus leucocephalus
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7            103   6e-22    Struthio camelus australis
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...    103   7e-22    Fukomys damarensis [Damara mole rat]
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...    103   7e-22    Struthio camelus australis
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...    103   7e-22    Haliaeetus leucocephalus
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...    103   7e-22    
ref|XP_003795774.1|  PREDICTED: conserved oligomeric Golgi comple...    103   8e-22    
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Trichechus manatus latirostris
ref|XP_004332588.1|  PREDICTED: LOW QUALITY PROTEIN: component of...    103   1e-21    
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Dasypus novemcinctus
emb|CDQ66102.1|  unnamed protein product                                103   1e-21    Oncorhynchus mykiss
gb|EFA86654.1|  oligomeric Golgi complex component                      103   1e-21    Heterostelium album PN500
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Leptonychotes weddellii
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Meleagris gallopavo [common turkey]
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Otolemur garnettii
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    103   1e-21    Ursus maritimus [white bear]
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Bison bison bison
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Sorex araneus [Eurasian shrew]
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...    103   1e-21    Ixodes scapularis [blacklegged tick]
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Odobenus rosmarus divergens
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Tupaia chinensis
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Lipotes vexillifer [baiji]
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7       103   1e-21    Bos taurus [bovine]
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Mustela putorius furo [black ferret]
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7            103   1e-21    Tupaia chinensis
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Capra hircus [domestic goat]
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    103   1e-21    Balaenoptera acutorostrata scammoni
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Orcinus orca [Orca]
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    Cricetulus griseus [Chinese hamsters]
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...    103   1e-21    
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...    102   1e-21    Vicugna pacos
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...    102   1e-21    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Physeter catodon
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Ficedula albicollis
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Camelus bactrianus [camel]
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Heterocephalus glaber [naked mole rat]
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    102   2e-21    Cuculus canorus
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7            102   2e-21    Calypte anna
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Loxodonta africana [African bush elephant]
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Calypte anna
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Eptesicus fuscus
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Camelus ferus
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Bos mutus
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...    102   2e-21    Camelus ferus
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7            102   2e-21    Tinamus guttatus
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    102   2e-21    Tinamus guttatus
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-21    
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...    102   2e-21    Mus musculus [mouse]
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Balearica regulorum gibbericeps
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Falco peregrinus [peregrine]
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Corvus cornix cornix
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Charadrius vociferus
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7            102   3e-21    Bos mutus
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Mesitornis unicolor
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...    102   3e-21    Columba livia [carrier pigeon]
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...    101   4e-21    
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...    101   4e-21    
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...    101   4e-21    Pan troglodytes
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7          101   4e-21    Homo sapiens [man]
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...    101   4e-21    
gb|EFZ22757.1|  hypothetical protein SINV_01051                         101   5e-21    
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    Saimiri boliviensis boliviensis
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    Macaca fascicularis [crab eating macaque]
ref|XP_004351649.1|  hypothetical protein ACA1_397180                   101   5e-21    Acanthamoeba castellanii str. Neff
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    Callithrix jacchus [common marmoset]
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7       101   5e-21    
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...    101   5e-21    
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...    101   5e-21    
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7       101   6e-21    
dbj|BAE37211.1|  unnamed protein product                                101   6e-21    
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...    101   6e-21    
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...    101   6e-21    
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7       101   7e-21    
ref|XP_006507763.2|  PREDICTED: conserved oligomeric Golgi comple...    100   7e-21    
ref|XP_006507762.2|  PREDICTED: conserved oligomeric Golgi comple...    100   7e-21    
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...    100   7e-21    
gb|KFM79728.1|  Conserved oligomeric Golgi complex subunit 7          95.5    8e-21    
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...    100   8e-21    
gb|EDL17254.1|  component of oligomeric golgi complex 7                 100   8e-21    
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...    100   8e-21    
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...    100   9e-21    
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...    100   9e-21    
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...    100   1e-20    
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...    100   1e-20    
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...    100   1e-20    
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...    100   1e-20    
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...    100   2e-20    
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  99.8    2e-20    
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     99.8    2e-20    
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  99.4    3e-20    
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          98.6    4e-20    
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  98.6    4e-20    
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  98.6    5e-20    
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            97.8    7e-20    
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  97.4    1e-19    
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  96.7    2e-19    
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  95.5    6e-19    
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  94.7    9e-19    
ref|XP_637633.1|  oligomeric Golgi complex component                  95.1    1e-18    
ref|XP_009024750.1|  hypothetical protein HELRODRAFT_178406           94.0    1e-18    
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               94.4    1e-18    
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    2e-18    
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          94.0    2e-18    
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  92.8    5e-18    
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  91.3    1e-17    
ref|XP_004360949.1|  oligomeric Golgi complex component               90.9    2e-17    
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  90.5    2e-17    
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      90.1    3e-17    
gb|EEZ99445.1|  hypothetical protein TcasGA2_TC030721                 89.0    8e-17    
gb|ESA17025.1|  hypothetical protein GLOINDRAFT_345271                87.0    5e-16    
gb|EXX54575.1|  hypothetical protein RirG_233350                      87.0    5e-16    
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          86.7    6e-16    
gb|ETN63528.1|  hypothetical protein AND_004755                       86.3    7e-16    
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          85.9    9e-16    
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    9e-16    
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    2e-15    
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    2e-15    
emb|CDH53396.1|  mitogen-activated protein kinase kinase              84.0    5e-15    
dbj|BAB63059.1|  hypothetical protein                                 82.8    8e-15    
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  82.4    1e-14    
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    2e-14    
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  82.4    2e-14    
ref|XP_002431030.1|  conserved hypothetical protein                   81.6    3e-14    
ref|XP_003285944.1|  hypothetical protein DICPUDRAFT_15317            80.9    6e-14    
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    80.5    6e-14    
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14    
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14    
ref|XP_011399022.1|  Conserved oligomeric Golgi complex subunit 7     79.3    9e-14    
emb|CBY32864.1|  unnamed protein product                              78.6    1e-13    
emb|CBY21571.1|  unnamed protein product                              78.6    2e-13    
gb|KFB52038.1|  AGAP004439-PA-like protein                            78.6    3e-13    
gb|KGB34884.1|  Conserved oligomeric Golgi complex subunit 7          77.0    3e-13    
ref|XP_004925156.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    6e-13    
ref|XP_004347003.2|  hypothetical protein CAOG_05318                  77.4    7e-13    
ref|XP_002073360.1|  GK14089                                          77.0    8e-13    
ref|XP_001357618.1|  GA15960                                          77.0    9e-13    
ref|XP_002058398.1|  GJ14333                                          76.6    1e-12    
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12    
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          75.9    2e-12    
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12    
gb|KJE94721.1|  hypothetical protein CAOG_009840                      73.9    1e-11    
ref|XP_001993908.1|  GH22206                                          73.6    1e-11    
gb|ERL93874.1|  hypothetical protein D910_11160                       72.8    2e-11    
ref|XP_313727.3|  AGAP004439-PA                                       70.9    9e-11    
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  70.9    9e-11    
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10    
ref|XP_001955508.1|  GF16218                                          68.6    4e-10    
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    4e-10    
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    5e-10    
ref|XP_001981279.1|  GG11984                                          67.8    7e-10    
emb|CBK24341.2|  unnamed protein product                              65.9    1e-09    
ref|XP_002001440.1|  GI21972                                          67.0    1e-09    
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             67.0    1e-09    
ref|XP_007433967.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    1e-09    
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    2e-09    
ref|NP_651750.1|  Cog7                                                66.6    2e-09    
ref|XP_002037280.1|  GM12202                                          66.6    2e-09    
ref|XP_002105431.1|  GD17535                                          65.9    3e-09    
ref|XP_002098511.1|  GE10410                                          65.9    4e-09    
gb|KFD70340.1|  hypothetical protein M514_06928                       65.5    5e-09    
gb|KFD52215.1|  hypothetical protein M513_06928                       64.7    8e-09    
ref|XP_007323090.1|  hypothetical protein SERLADRAFT_418038           64.7    1e-08    
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08    
gb|EPS95322.1|  hypothetical protein FOMPIDRAFT_20550                 64.3    1e-08    
dbj|GAN08447.1|  hypothetical protein MAM1_0205d07959                 62.8    1e-08    
emb|CBJ26225.1|  similar to Conserved oligomeric Golgi complex su...  62.8    4e-08    
gb|EIE91469.1|  hypothetical protein RO3G_16180                       62.0    6e-08    
ref|XP_002911600.1|  hypothetical protein CC1G_14133                  61.6    1e-07    
gb|KDQ27716.1|  hypothetical protein PLEOSDRAFT_1042517               60.8    1e-07    
emb|CEG65284.1|  hypothetical protein RMATCC62417_02093               58.2    2e-07    
gb|EJU00574.1|  hypothetical protein DACRYDRAFT_80789                 60.1    3e-07    
gb|KIM77400.1|  hypothetical protein PILCRDRAFT_91140                 59.7    4e-07    
gb|KDR75221.1|  hypothetical protein GALMADRAFT_122928                59.7    4e-07    
ref|XP_009167964.1|  hypothetical protein T265_13613                  59.7    4e-07    
gb|EPB83904.1|  hypothetical protein HMPREF1544_09358                 57.8    8e-07    
gb|KIK67210.1|  hypothetical protein GYMLUDRAFT_857700                58.5    9e-07    
ref|XP_003030457.1|  hypothetical protein SCHCODRAFT_57227            57.8    1e-06    
emb|CCM00447.1|  predicted protein                                    57.8    2e-06    
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    2e-06    
ref|XP_001652664.1|  AAEL007307-PA                                    57.4    2e-06    
emb|CEI98246.1|  hypothetical protein RMCBS344292_12361               55.8    2e-06    
gb|KJA20734.1|  hypothetical protein HYPSUDRAFT_55890                 57.4    2e-06    
emb|CCD80953.1|  putative protein arginine n-methyltransferase        57.4    2e-06    
gb|ENN72950.1|  hypothetical protein YQE_10421                        55.1    2e-06    
ref|XP_007348981.1|  hypothetical protein AURDEDRAFT_114889           57.0    3e-06    
gb|KIK39828.1|  hypothetical protein CY34DRAFT_14142                  56.6    4e-06    
gb|KII83859.1|  hypothetical protein PLICRDRAFT_47054                 56.6    4e-06    
ref|XP_001844946.1|  conserved hypothetical protein                   56.2    4e-06    
ref|XP_006460818.1|  hypothetical protein AGABI2DRAFT_204063          55.5    7e-06    
ref|XP_007328323.1|  hypothetical protein AGABI1DRAFT_119285          55.5    9e-06    
gb|KIY44451.1|  hypothetical protein FISHEDRAFT_51354                 54.7    1e-05    
emb|CDS29332.1|  oligomeric golgi complex subunit 7                   54.7    2e-05    
ref|XP_007370499.1|  hypothetical protein DICSQDRAFT_140955           54.3    2e-05    
ref|XP_007772890.1|  hypothetical protein CONPUDRAFT_63639            53.5    3e-05    
gb|KFH66525.1|  hypothetical protein MVEG_07050                       53.5    4e-05    
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          53.1    4e-05    
gb|KIM45255.1|  hypothetical protein M413DRAFT_441937                 53.1    4e-05    
gb|KIJ50489.1|  hypothetical protein M422DRAFT_27443                  53.1    5e-05    
emb|CEP06989.1|  hypothetical protein                                 52.8    7e-05    
ref|XP_003737280.1|  PREDICTED: conserved oligomeric Golgi comple...  52.4    8e-05    
ref|XP_845669.1|  hypothetical protein                                52.4    9e-05    
gb|ELU44402.1|  COG7 domain-containing protein                        52.4    9e-05    
emb|CBH12050.1|  hypothetical protein, conserved                      52.4    9e-05    
gb|KDN35150.1|  hypothetical protein RSAG8_11838                      52.4    9e-05    
gb|KDQ16859.1|  hypothetical protein BOTBODRAFT_186473                52.4    1e-04    
gb|EMD31987.1|  hypothetical protein CERSUDRAFT_69049                 52.0    1e-04    
ref|XP_007844055.1|  component of oligomeric golgi complex 7          52.0    1e-04    
emb|CEL62710.1|  Conserved oligomeric Golgi complex subunit 7 OS=...  51.6    2e-04    
emb|CDO69070.1|  hypothetical protein BN946_scf184992.g19             51.2    3e-04    
gb|KIP09784.1|  hypothetical protein PHLGIDRAFT_11764                 50.8    3e-04    
ref|XP_009548431.1|  hypothetical protein HETIRDRAFT_459761           50.4    4e-04    
gb|KIL65963.1|  hypothetical protein M378DRAFT_76263                  50.1    5e-04    
gb|KEP49189.1|  component 7 (COG7) protein                            50.1    5e-04    
ref|XP_004992273.1|  hypothetical protein PTSG_06874                  49.7    7e-04    
gb|EUC63278.1|  component 7 (COG7) protein                            49.7    7e-04    
gb|KIK09913.1|  hypothetical protein K443DRAFT_82127                  49.3    0.001    



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLS+FSDEKFDPK+WING CQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSDEKFDPKRWINGVCQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDALSLRSSV+SILQKL KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDALSLRSSVASILQKLIKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDAL+
Sbjct  181  DRLDSMVQPRLTDALT  196



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLIDLEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA RDVIRLRDDALSLRSS+S+ILQKL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILQKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDS+VQPRLTDALS
Sbjct  181  DRLDSVVQPRLTDALS  196



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA RDVIRLRDDALSLRSS+S+IL KL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILLKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDS+VQPRLTDALS
Sbjct  181  DRLDSVVQPRLTDALS  196



>ref|XP_006587679.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Glycine max]
Length=636

 Score =   353 bits (905),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDNMVQPRLTDALS  196



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL SFSDEKFD K+WIN ACQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMIDLGSFSDEKFDAKKWINNACQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A+ RVPRATRDVIRLRDDALSLR SV SIL KL+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   AILRVPRATRDVIRLRDDALSLRQSVGSILLKLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+S DLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASKDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA++
Sbjct  181  DRLDSMVQPRLTDAIT  196



>emb|CAN76413.1| hypothetical protein VITISV_043812 [Vitis vinifera]
Length=444

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDALS
Sbjct  181  DRLDSMVQPRLTDALS  196



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   353 bits (905),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLSSFS+EKFDPK+WINGA Q RHPQDP++KHLVDLEMKLQM SEEIA SLEE S+S
Sbjct  1    MMVDLSSFSEEKFDPKRWINGAVQQRHPQDPVEKHLVDLEMKLQMVSEEIASSLEEQSSS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDV+RLRDDALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRASRDVLRLRDDALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDAL+
Sbjct  181  DRLDSMVQPRLTDALN  196



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDNMVQPRLTDALS  196



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDNMVQPRLTDALS  196



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDNMVQPRLTDALS  196



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAT  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATRDVIRLRDDALSLR+SVSSILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRATRDVIRLRDDALSLRNSVSSILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YRTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRL DALS
Sbjct  181  DRLDAMVQPRLMDALS  196



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATRDVIRLRDDA+SLR+SVS ILQKL+KAEGSSAES+A LAKVDTVK+RME A
Sbjct  61   SLLRVPRATRDVIRLRDDAVSLRNSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMETA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
             RLD+MVQPRLTDALS
Sbjct  181  SRLDAMVQPRLTDALS  196



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   350 bits (899),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  FS+E FDPK+WIN ACQSRHPQ+ LDKHLVDLEMKLQM SEEI  SLEE SA+
Sbjct  1    MMVDLFPFSNENFDPKKWINSACQSRHPQESLDKHLVDLEMKLQMVSEEITASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDD++SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDSVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDTMVQPRLTDALS  196



>gb|AIU51141.1| embryo yellow protein, partial [Saruma henryi]
Length=262

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M+VDLS+FSDE FDPK+WIN ACQ RHPQDP+DKHL DLEMKLQ+ SEEI  SL+E S +
Sbjct  1    MIVDLSAFSDENFDPKRWINSACQFRHPQDPVDKHLADLEMKLQLLSEEITSSLDEQSTA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLAVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  181  DRLEEMVQPRLSDALS  196



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQD L+KHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKRWINSACQARHPQDSLEKHLVDLEMKLQMTSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRD++RLRDDA+SLR SVS ILQKL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDIVRLRDDAVSLRHSVSGILQKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDNMVQPRLTDALS  196



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLS FS+E FDPK+WIN ACQSRHP++ LDKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSPFSNENFDPKKWINSACQSRHPEESLDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VS+ILQKL+KAEGSS+ES++ LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSAILQKLKKAEGSSSESISALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL+VLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLQVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDTMVQPRLTDALS  196



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   348 bits (892),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRL DALS
Sbjct  181  DRLDNMVQPRLMDALS  196



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   348 bits (892),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDAMVQPRLTDALS  196



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   348 bits (892),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD+KFDPK+W+N ACQ+RHPQD L+KH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWMNSACQARHPQDSLEKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSS+ES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSSVAGILQKLKKAEGSSSESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDAMVQPRLTDALS  196



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   347 bits (891),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLSSFSDEKFDPK+WIN   QSRHPQDP+DKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINEVFQSRHPQDPVDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPR TRDV RLRDDAL+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDALTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANM HCL+AVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMSHCLAAVGEVAEFANIRRQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDALS
Sbjct  181  DRLDSMVQPRLTDALS  196



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   347 bits (890),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FSD+KFDPK+WIN AC++RHPQ+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHPQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RLDSMVQPRL DALS
Sbjct  181  RLDSMVQPRLMDALS  195



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDAMVQPRLTDALS  196



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+R+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRRQLEVLE  180

Query  567  DRLDSMVQPRLTDAL  611
            DRLD+MVQPRLTDAL
Sbjct  181  DRLDAMVQPRLTDAL  195



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDAMVQPRLTDALS  196



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M  DLSSFSDEKFDPK+WINGACQSR+PQDP+ KHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MFGDLSSFSDEKFDPKKWINGACQSRNPQDPVVKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPR TRDV RLRDD+L+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDSLTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLAAVGEVAEFANIRRQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDALS
Sbjct  181  DRLDSMVQPRLTDALS  196



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   345 bits (886),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RL+DDA+SLR+SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLQDDAVSLRNSVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDTMVQPRLTDALS  196



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPR+TDALS
Sbjct  181  DRLDTMVQPRITDALS  196



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPR+TDALS
Sbjct  181  DRLDTMVQPRITDALS  196



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDTMVQPRLTDALS  196



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILQKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDAL+
Sbjct  181  DRLDAMVQPRLTDALT  196



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   344 bits (883),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDALS
Sbjct  181  DRLDTMVQPRLTDALS  196



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLS+FS+EKFDPK+WINGA Q RHPQDP++KHLVDLEM+LQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSEEKFDPKKWINGAVQQRHPQDPVEKHLVDLEMRLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDV+RLRD+ALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLRDEALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTD+L+
Sbjct  181  DRLDSMVQPRLTDSLN  196



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+R+QLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRRQLEVLED  180

Query  570  RLDSMVQPRLTDAL  611
            RLD+MVQPRLTDAL
Sbjct  181  RLDAMVQPRLTDAL  194



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   343 bits (881),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA+S
Sbjct  181  DRLDSMVQPRLTDAIS  196



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   343 bits (880),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FSD+KFDPK+WIN AC++RH Q+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHQQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RLDSMVQPRL DALS
Sbjct  181  RLDSMVQPRLMDALS  195



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   342 bits (878),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA+S
Sbjct  181  DRLDSMVQPRLTDAIS  196



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   342 bits (878),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDAL+
Sbjct  181  DRLDAMVQPRLTDALT  196



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   342 bits (877),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDAL+
Sbjct  181  DRLDAMVQPRLTDALT  196



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDPK W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKNWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA+S
Sbjct  181  DRLDSMVQPRLTDAIS  196



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPRKWVNSACQTRHTQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YET QDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETSQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA+S
Sbjct  181  DRLDSMVQPRLTDAIS  196



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDALS
Sbjct  181  DRLDSMVQPRLTDALS  196



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FS E F+PK+WIN ACQSRHP++ +DKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSGENFEPKKWINSACQSRHPEESVDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDVIRLRDDA+SLRS+V+SILQKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRSAVASILQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RLD+MVQPRLTDA+S
Sbjct  181  RLDAMVQPRLTDAIS  195



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL +FS+EKFDPK+WINGACQ+R PQDPLDKHL D+EMKLQ+ SEEI+ SL+E S +
Sbjct  1    MMIDLGAFSEEKFDPKKWINGACQARDPQDPLDKHLADMEMKLQLLSEEISSSLDEQSTA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRD+A+SLRSS+S ILQ+L+KAEG SAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSLSGILQRLKKAEGCSAESIAALSKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRL+DALS
Sbjct  181  DRLEAMVQPRLSDALS  196



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   337 bits (865),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FS+EKFD K+WIN ACQSRHPQDP+++HL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSEEKFDAKKWINAACQSRHPQDPVERHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRNSVSGILLKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRL DALS
Sbjct  181  DRLETMVQPRLYDALS  196



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL+SFSD+KFDPK+WINGA   RHPQDP++KHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLTSFSDDKFDPKKWINGAVNQRHPQDPVEKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A+ R+PRA+RDV+RL+DDALSLRSS++ IL  L+KAEGSSAES+ATLA+VDTVKRRMEAA
Sbjct  61   AILRIPRASRDVLRLQDDALSLRSSIAGILLFLKKAEGSSAESIATLARVDTVKRRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQ  L DALS
Sbjct  181  DRLDSMVQHHLIDALS  196



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FSDEKFD K+WIN ACQSRHPQDP +KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINAACQSRHPQDPPEKHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAMSLRNSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLT+LS++VE VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTELSASVEGVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            D+L+ MVQPRLTDALS
Sbjct  181  DKLEEMVQPRLTDALS  196



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   330 bits (847),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  FSDE+FD K+W+N  CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEEFDAKRWVNSTCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FSDEKFD K+WIN  CQSRHPQDP++KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINVVCQSRHPQDPVEKHLADLEMKLQMISEEIAASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRA+RDVIRLRDDA+SLR+SV+ IL KL+KAEGSSAESVA LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRASRDVIRLRDDAISLRNSVTGILLKLKKAEGSSAESVAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEF+N+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFSNVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRL+DALS
Sbjct  181  DRLEAMVQPRLSDALS  196



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDPK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            D+LDSMVQPRLTDA+S
Sbjct  181  DKLDSMVQPRLTDAIS  196



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDE FD K+W+N ACQSRHPQD +DKHL DLEMK+QM SEEI  SLEE SAS
Sbjct  1    MMLDLGPFSDENFDRKKWVNSACQSRHPQDSVDKHLADLEMKIQMVSEEIGASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATR+VIRLRDDA+SLRS+VSSIL KL+KAEG SAES+  LAK D VK+RMEAA
Sbjct  61   SLLRVPRATREVIRLRDDAVSLRSAVSSILDKLKKAEGLSAESIMALAKYDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLDSMVQPRLTDA+S
Sbjct  181  DRLDSMVQPRLTDAIS  196



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FS+EKFDPK+WIN ACQ++HPQD +DKHL +LEMKLQ+ SEEI+ SL+ELSAS
Sbjct  1    MMIDLGPFSEEKFDPKKWINAACQAKHPQDSMDKHLAELEMKLQVISEEISSSLDELSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL R+PRA+RDV+RLRDDA+SLRS++S ILQKL KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRIPRASRDVVRLRDDAISLRSAISGILQKLEKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLS VGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSVVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  181  DRLEGMVQPRLSDALS  196



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   332 bits (851),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|XP_010442641.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Camelina sativa]
Length=491

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A L++VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALSRVDSVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRLTDAL+
Sbjct  181  DRLEKMVQPRLTDALT  196



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FSDEKFDPK+WIN A  SRHPQDP+DKHL DLEMKLQ+ +EEIA SL+E S +
Sbjct  1    MMVDLGTFSDEKFDPKKWINAASLSRHPQDPIDKHLADLEMKLQVLAEEIASSLDEQSNA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRD+A+SLRSSVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MV PRL+DALS
Sbjct  181  DRLEEMVHPRLSDALS  196



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDAL  611
            D+LDSMVQPRLTDA+
Sbjct  181  DKLDSMVQPRLTDAI  195



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            MVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S SA
Sbjct  1    MVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGSA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RL++MVQPRLTDAL+
Sbjct  181  RLEAMVQPRLTDALT  195



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDAL  611
            D+LDSMVQPRLTDA+
Sbjct  181  DKLDSMVQPRLTDAI  195



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   330 bits (847),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   330 bits (846),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N ACQ+RHPQD L+KHLVDLEMKLQ++SEEIA SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSACQARHPQDSLEKHLVDLEMKLQISSEEIAASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A+ RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   AILRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQPRLTDAL+
Sbjct  181  DRLDAMVQPRLTDALT  196



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FSDEKFDPK+WIN ACQSRH Q+ +D+HL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMVDLGAFSDEKFDPKKWINAACQSRHHQESIDRHLADLEMKLQLLSEEISSSLDEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            ALHRVPRA+RDV+RLRDDA+SLRS+VS IL KL+KAEG+S+ESVA LAKVDTVK+RMEAA
Sbjct  61   ALHRVPRASRDVVRLRDDAVSLRSAVSGILVKLKKAEGTSSESVAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MV PRL+DALS
Sbjct  181  DRLEEMVHPRLSDALS  196



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQSRHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQSRHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFDPK+WIN ACQS   QDPLDKHL DLEMKLQ+ ++EI  SL+E S +
Sbjct  1    MMIDLGPFSDEKFDPKKWINSACQSLRSQDPLDKHLADLEMKLQVMADEITSSLDEQSGA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDA+SLRSSVS IL KL+KAEGSSAESVA LAK+DTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSSVSGILLKLKKAEGSSAESVAALAKIDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSA+GEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAIGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  181  DRLEEMVQPRLSDALS  196



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL SF+DEKFDPK+WIN   QSRHPQD L+KHL +LEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMVDLGSFTDEKFDPKKWINSTTQSRHPQDSLEKHLSELEMKLQMISEEISASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDALS R+SVS IL KL+KAEGSSAES+  LAKVD VK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDALSFRTSVSGILLKLKKAEGSSAESIDALAKVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRL+DALS
Sbjct  181  DRLEAMVQPRLSDALS  196



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FSDEKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSDEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RL++MVQPRLTDAL+
Sbjct  181  RLEAMVQPRLTDALT  195



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   327 bits (839),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   327 bits (839),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   327 bits (838),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   327 bits (838),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   327 bits (837),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQP LTDALS
Sbjct  181  DRLDTMVQPPLTDALS  196



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   327 bits (837),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   327 bits (837),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   327 bits (837),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   327 bits (837),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   326 bits (836),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRLD+MVQP LTDALS
Sbjct  181  DRLDTMVQPPLTDALS  196



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL  F+D+KFD K+WIN ACQ+RHPQ+  DK+L DLEMKLQ+ SEEIA SL+E SA+
Sbjct  1    MMVDLGDFADDKFDAKRWINAACQARHPQEAADKYLADLEMKLQLISEEIAASLDEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL R+PRATRDV+RLRDDALSLRS+VS+IL KL+KAEGSSAE++A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRATRDVVRLRDDALSLRSAVSAILLKLKKAEGSSAEAIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLAVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DAL+
Sbjct  181  DRLEEMVQPRLSDALT  196



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIATLARVDSVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRLTDAL+
Sbjct  181  DRLEKMVQPRLTDALT  196



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL  FS+EKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSEEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  570  RLDSMVQPRLTDALS  614
            RL++MVQPRLTDAL+
Sbjct  181  RLEAMVQPRLTDALT  195



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDSVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRLTDAL+
Sbjct  181  DRLEKMVQPRLTDALT  196



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FS+EKFD K+W+N +CQ+RHPQD L++ LVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSEEKFDAKRWVNSSCQARHPQDSLERQLVDLEMKLQIASEEIGASLEEQSGG  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDCVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            ++TLQDA+GLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  FKTLQDASGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDAL+
Sbjct  181  DRLEAMVQPRLTDALT  196



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +M+DL +FSDEKFDPK+WIN ACQSRHPQ P+D+HL DLEMKLQ+ SEEI+ SL+E S+S
Sbjct  1    IMIDLGAFSDEKFDPKKWINAACQSRHPQQPIDRHLADLEMKLQVLSEEISSSLDEQSSS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL R+PRA+RDVIRLRD+A+SLRSSVSSIL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRASRDVIRLRDEAVSLRSSVSSILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MV PRL+ ALS
Sbjct  181  DRLEEMVHPRLSVALS  196



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 171/195 (88%), Gaps = 6/195 (3%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH VDLEMKLQM  EEIA SLEE SAS
Sbjct  1    MMLDLGPFSDRNFDPRKWVNSACQTRHTQDSVDKHTVDLEMKLQMVXEEIAASLEEQSAS  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRATRDV+R+RDDA      VSSIL K +KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRIRDDA------VSSILDKFKKAEGSSAESMAALAKVDIVKQRMEAA  114

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLP AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  115  YETLQDAAGLTQLSATVEDVFASGDLPLAAETLANMRHCLSAVGEVAEFANLRKQLEVLE  174

Query  567  DRLDSMVQPRLTDAL  611
            DRLDSMVQPRLTDA+
Sbjct  175  DRLDSMVQPRLTDAI  189



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DA++
Sbjct  181  DRLEGMVQPRLSDAIA  196



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   319 bits (817),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANVRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DA++
Sbjct  181  DRLEGMVQPRLSDAIA  196



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   313 bits (803),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDL +FSDEKFD K+WIN A +SRHPQD L+KHLVDLEMKLQ+ SEEI+ SLEE SA+
Sbjct  1    MMVDLGAFSDEKFDAKKWINMAVKSRHPQDALEKHLVDLEMKLQLMSEEISASLEEQSAA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A+ RVPRATRDVIR+RDDA+SLRSS+SSIL K+++AEGS+A+S+A LAKVDTVK RMEAA
Sbjct  61   AILRVPRATRDVIRIRDDAVSLRSSISSILGKIKQAEGSAADSIAALAKVDTVKFRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL++MVQPRLTDALS
Sbjct  181  DRLEAMVQPRLTDALS  196



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   311 bits (797),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MMVDLS+FSDEKFDPK+WIN ACQSRHPQDP+DKHL DLE+KLQ+ SEEI+ SL+E S +
Sbjct  1    MMVDLSAFSDEKFDPKKWINNACQSRHPQDPVDKHLADLELKLQLLSEEISSSLDEQSTA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDVIRLRDDA+SLRS++S IL KL+KAEGSSA ++A+LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAISGILLKLKKAEGSSAAAIASLAKVDTVKQRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLA+MRHCLSAVGEVAEFAN+RKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLASMRHCLSAVGEVAEFANVRKQLAVLE  180

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  181  DRLEEMVQPRLSDALS  196



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VDL  FS+E FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVVDLGEFSEEGFDPKRWINAALESRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSIISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEEMVQPRLSDALS  197



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VDL  FSDE FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSDESFDPKRWINAALESRHPQDPLDRFLSDLEENLRSASEKISDSLERESSD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV RLR+DA+ LRS+VSSILQKL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLAVRDVARLREDAIQLRSAVSSILQKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEEMVQPRLSDALS  197



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +++DL  FS+E FDPK+WIN A +SRHPQDPL++ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALESRHPQDPLERFLSDLEENLRAASEKIADALERESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPVACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEEMVQPRLSDALS  197



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   303 bits (776),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +++DL  FS+E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEEMVQPRLSDALS  197



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VDL+ F+DE FDPK+WIN A  SRHPQDP+D+++ DLE  L+ ++E IA +LE  S  
Sbjct  2    VVVDLTEFADEAFDPKRWINAALDSRHPQDPIDRYISDLEENLRASAENIADALERESTD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRD+A+SLR+ VS ILQKL KA+GSSAE+++ +AK+D VK+RME+A
Sbjct  62   ALRRVPVAVRDVLRLRDEAISLRAVVSGILQKLNKADGSSAEAISAIAKIDVVKKRMESA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  122  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRLD MVQPRL+DALS
Sbjct  182  DRLDQMVQPRLSDALS  197



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VDL  FS+E FDPK+WIN A +SRHPQDP+D+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSEESFDPKRWINAALESRHPQDPIDRFLSDLEENLRSASEKISDSLERESSD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV RLR+DA+ LRS+V+SILQKL+KAEG+SAE +A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPAAVRDVARLREDAIQLRSAVNSILQKLKKAEGTSAEHIAALAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDL RAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLSRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRLD MVQPRL+DAL+
Sbjct  182  DRLDEMVQPRLSDALT  197



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDAL  611
            DRL+ MVQPRL DAL
Sbjct  182  DRLEEMVQPRLFDAL  196



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDAL  611
            DRL+ MVQPRL DAL
Sbjct  182  DRLEEMVQPRLFDAL  196



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +++DL  F +E FD K+WINGA +SRHPQDPLD +L DLE  L+ AS++IA +L+  SA 
Sbjct  2    VVLDLGEFGEEGFDAKRWINGALESRHPQDPLDHYLADLEESLRSASDKIADALDRDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            +L R+P A RD++RLRDDA +LR  VS++L  L +AEG+SAES+AT+A++DTVKRRMEAA
Sbjct  62   SLRRLPLACRDLLRLRDDAHALRHLVSALLTNLAQAEGTSAESIATIARIDTVKRRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEEMVQPRLSDALS  197



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M+DL SFS+  FDPK+WIN AC SRH Q     HL+DLEMKLQM SEEI+ SLEE S++A
Sbjct  3    MIDLVSFSNSNFDPKKWINTACNSRHSQ-----HLIDLEMKLQMLSEEISASLEEQSSAA  57

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L RVPRATRDVI LRDDA SL S+VS IL  L+K  GSSAES+A LAKVD VK+RME AY
Sbjct  58   LLRVPRATRDVICLRDDAGSLCSAVSVILHNLQKRNGSSAESIAALAKVDVVKQRMEVAY  117

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            ETLQDAAGLTQLSSTVEDVF SGDLP AAETLANMRHCLSAVGEVAEFANIRKQLEVLED
Sbjct  118  ETLQDAAGLTQLSSTVEDVFDSGDLPCAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  177

Query  570  RLDSMV  587
            RLD+M+
Sbjct  178  RLDTMI  183



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VDL  F++E FDPK+WIN + ++RHPQDPLD+++ DLE  L+ ++E IA +LE+ SA 
Sbjct  2    VVVDLGEFAEEGFDPKRWINASLEARHPQDPLDRYISDLEESLRSSAENIADTLEKESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRD+A +LRS VSSIL KL+KA  +S+ESV  L+++D VKRRMEAA
Sbjct  62   ALRRVPLAVRDVLRLRDEAHALRSVVSSILLKLKKAGETSSESVEALSRIDAVKRRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RK+LEVLE
Sbjct  122  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKRLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRL+ MVQPRL+DALS
Sbjct  182  DRLEDMVQPRLSDALS  197



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM+DL+SF D+KF  K W+N AC++RHP D LDK+L DLE+KLQ+ +E IA SLEE SA 
Sbjct  1    MMLDLASFGDDKFHAKSWVNAACKARHPDDSLDKYLGDLEIKLQLMAENIAASLEEQSAQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVPRA+RDV R+RDDALSLRS+VS++LQKL++AEG+SAESVA LA+VD VK+RMEAA
Sbjct  61   ALLRVPRASRDVFRVRDDALSLRSTVSAVLQKLQQAEGTSAESVAALARVDAVKQRMEAA  120

Query  387  YETL-QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            +ETL QDAAGL +LS++VEDVF+SG+LP+AAETLA MR CL+ VGEV EFAN+++QLE L
Sbjct  121  HETLQQDAAGLAKLSASVEDVFASGNLPQAAETLAQMRRCLAVVGEVPEFANVKRQLEGL  180

Query  564  EDRLDSMVQPRLTDALS  614
            EDRL+ MVQPRL DAL+
Sbjct  181  EDRLEGMVQPRLADALT  197



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +3

Query  102  RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSS  281
            RHP+DP++KHL DLEMKLQ+ SEEIA SL+E SA+AL RVPRA+RDVIR+RDDA++LRS+
Sbjct  1    RHPEDPVEKHLGDLEMKLQVMSEEIASSLDEQSAAALLRVPRASRDVIRVRDDAIALRSA  60

Query  282  VSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGD  461
            VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAAYETLQDAAGLT+LS+TVEDVF+SGD
Sbjct  61   VSGILQKLKKAEGSSAESIAALARVDTVKQRMEAAYETLQDAAGLTKLSATVEDVFASGD  120

Query  462  LPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  614
            L +AAETLANMRHCLS VGEVAEFAN+++QLEVLEDRL+ MVQPRL++A+S
Sbjct  121  LSQAAETLANMRHCLSVVGEVAEFANVKRQLEVLEDRLEGMVQPRLSEAIS  171



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDDMVQPRLVDALS  197



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDDMVQPRLVDALS  197



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD+  F +E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ++++I+ +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRASADKISDALDRESAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLSLNKAEGTSAESIAAIAKIDIVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDAL  611
            DRL+ MVQPRL DAL
Sbjct  182  DRLEEMVQPRLFDAL  196



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDDMVQPRLVDALS  197



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  DKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQK  302
            DKHL DLEMKLQ+ SEEIA SL+E S +AL RVPR+TRDV+RLRDDA SLRS+V  ILQ+
Sbjct  1    DKHLADLEMKLQLLSEEIAASLDEQSQAALLRVPRSTRDVVRLRDDASSLRSAVLLILQR  60

Query  303  LRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAET  482
            L+KAEGSSAES+  LA++D VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAET
Sbjct  61   LKKAEGSSAESITALAEIDMVKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAET  120

Query  483  LANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  614
            LANMRHCLSAVGEVAEFAN+RKQLEVLEDRLD+MVQPRL+DA+S
Sbjct  121  LANMRHCLSAVGEVAEFANVRKQLEVLEDRLDAMVQPRLSDAIS  164



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLLDALS  197



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RL  MVQPRL DALS
Sbjct  182  ERLVEMVQPRLLDALS  197



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+E+ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAAEDAAAALERDSGD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLNLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  182  ERLDEMVQPRLVDALS  197



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            MVD+++F  E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGQEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L R+PRA RDV RL DDALSLRS+VS +L KLR AEG SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAEGLSAGSVAALSRVDLVKQRMEAAH  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            +TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA+++++LE LE+
Sbjct  121  KTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASVKRELEALEN  180

Query  570  RLDSMVQPRLTDALS  614
            RLD MVQ RLTDAL+
Sbjct  181  RLDGMVQTRLTDALT  195



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            MVD+++F +E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGEEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L R+PRA RDV RL DDALSLRS+VS +L KLR AE  SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAESLSAGSVAALSRVDLVKQRMEAAH  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            +TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA+++++LE LE+
Sbjct  121  KTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASVKRELEALEN  180

Query  570  RLDSMVQPRLTDALS  614
            RLD MVQ RLTDAL+
Sbjct  181  RLDGMVQTRLTDALT  195



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +++DLS+F DE+FD K+WIN           +D+H  DLE  L  A + I+  L + ++ 
Sbjct  2    VVLDLSAFDDERFDAKRWINTQDPPSMASSAMDRHFSDLEESLHEAFDRISADLSKRTSE  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A+  VP A RDV RLRD+ALSLRSSVSSIL KL++AEGS+AES+A LAK+DTVK+RMEAA
Sbjct  62   AMLSVPHAARDVARLRDEALSLRSSVSSILSKLKQAEGSAAESIAVLAKIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            + TLQ+AAGLT+LS++VE VF+SGDL +AAETLA MR  L AVGEVAEFAN+RKQLEVLE
Sbjct  122  HTTLQEAAGLTELSASVESVFASGDLRQAAETLAQMRRRLFAVGEVAEFANVRKQLEVLE  181

Query  567  DRLDSMVQPRLTDALS  614
            DRLD MVQP+L+DALS
Sbjct  182  DRLDEMVQPQLSDALS  197



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEV    N  K+L+   
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVRNPPNFEKRLKKFT  181

Query  567  DRLDSM  584
              LD +
Sbjct  182  PFLDPL  187



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQ  551
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGE AE   I K+
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEGAEIPQILKK  176



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 136/196 (69%), Gaps = 35/196 (18%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE     
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALE-----  56

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
                           RD A               +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  57   ---------------RDSA---------------EAEGSSAESITALARIDTVKQRMEAA  86

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  87   YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  146

Query  567  DRLDSMVQPRLTDALS  614
            +RLD MVQPRL DALS
Sbjct  147  ERLDDMVQPRLVDALS  162



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M + ++ F D  FD K W+N AC      + ++K L ++EMKLQ+A+E+I+++LEE S +
Sbjct  1    MSISMADFDDPSFDVKPWVNAACAGCPDDESVEKFLAEVEMKLQLAAEDISLALEEQSNA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
             L+R+PRA  ++ R+  D  +L++ V  IL++L  AEGSS ESV  L +VD VK RMEAA
Sbjct  61   GLNRIPRAVAEIDRVEHDTKALQTRVQGILKRLNDAEGSSRESVRRLTRVDAVKGRMEAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             +TL++AAGL +L ++VEDVF++G++   A+ LA+MR  L  VG V EF +  ++++ LE
Sbjct  121  RDTLREAAGLAELMASVEDVFAAGNVRSMADVLASMRRALKVVGGVPEFQDAPEKVDALE  180

Query  567  DRLDSMVQPRLTDALS  614
             RL+ +++P L  AL+
Sbjct  181  RRLEQILKPELVKALT  196



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  554
            MEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQL  60

Query  555  EVLEDRLDSMVQPRLTDALS  614
            EVLEDRLD+MVQPRLTDALS
Sbjct  61   EVLEDRLDNMVQPRLTDALS  80



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 133/207 (64%), Gaps = 12/207 (6%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M DL++FSD  FDPK +IN AC  +   +PL++ L +LEMKL +++E++ + L++ S  A
Sbjct  1    MTDLNAFSDAAFDPKLFINQACTGKTGDEPLERFLAELEMKLHLSAEDVGLYLQDHSGRA  60

Query  210  LHRVPRATRDVIRLR----------DDALSLRSSVSSILQKLRKA-EGSSAESVATLAKV  356
            + R+P A ++++R++          DD  +LR S ++ L++L  A  G +A  V  L  V
Sbjct  61   MQRIPAAAKELLRIKVRVRLADRNSDDVATLRGSAAAALKQLEDAGSGQAAAVVGQLQAV  120

Query  357  DTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGE-VAEF  533
            DTVKRRME A  TL++AAGL+ L   V+D F+SG+L R A+TLA MR  L+ VG+ VAEF
Sbjct  121  DTVKRRMEDACSTLKEAAGLSALFQQVDDHFASGNLRRVADTLAGMRRGLAVVGDSVAEF  180

Query  534  ANIRKQLEVLEDRLDSMVQPRLTDALS  614
               R +L  LE+R  +MV+  LT A +
Sbjct  181  RGGRDRLARLEERFAAMVEAPLTAAFA  207



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 129/195 (66%), Gaps = 0/195 (0%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            M D++ F+++ FDP  WIN AC SR  ++PL+K L +LEM+LQ+++E+I  +L + SA A
Sbjct  1    MADVADFAEDTFDPITWINQACGSRPVEEPLEKFLAELEMRLQLSAEDIEATLSDNSAQA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            + R+P A +++ RL+ D   ++  V  + Q +++    +  SVA ++++  VK  ME+A 
Sbjct  61   MRRIPFAIQEIYRLQGDIQGMQDQVQVMAQTVQRDATEAQSSVAHISELHRVKANMESAC  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
             +L+ A  L+ L   VEDVF++GDLP+ AE LA+MR  LS VG+V EF   R++L  LED
Sbjct  121  NSLKQATELSGLFVKVEDVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAGRQKLRALED  180

Query  570  RLDSMVQPRLTDALS  614
            RL + V+  L +AL+
Sbjct  181  RLQTQVEGSLGEALA  195



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 126/196 (64%), Gaps = 0/196 (0%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            M  + + FSD  FD K W+N AC      + ++K+L ++EMKLQ+ +E+I+++LEE S +
Sbjct  1    MSFNPAEFSDANFDVKAWVNSACAGCPRGESMEKYLSEVEMKLQLVAEDISLALEEQSVA  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
             L R+PRA  ++ R+  ++ +L++ ++ IL++L +AE  S  SV  L  +D VK RME  
Sbjct  61   GLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASVNLLRDIDAVKGRMELT  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             +TL +AAGL +L  + +DVF+ G++   A+ +A+MR  L  VG V EF +  +++E LE
Sbjct  121  RDTLAEAAGLAELMRSADDVFAGGNVRSMADIVASMRRSLKVVGSVPEFEDAPERVEALE  180

Query  567  DRLDSMVQPRLTDALS  614
             RL+  V+P L  AL+
Sbjct  181  HRLEQAVKPELVKALA  196



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  554
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  555  EVLEDRLDSMVQPRLTDALS  614
            EVLE+RLD MVQPRL DALS
Sbjct  61   EVLEERLDEMVQPRLLDALS  80



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  554
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  555  EVLEDRLDSMVQPRLTDALS  614
            EVLE+RLD MVQPRL DALS
Sbjct  61   EVLEERLDEMVQPRLLDALS  80



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 123/193 (64%), Gaps = 0/193 (0%)
 Frame = +3

Query  36   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  215
            DL++F ++ F+PK WIN AC ++  ++ L++ L DLE++L +A+E+I  +LE  S  AL 
Sbjct  6    DLAAFQEDSFEPKNWINAACDNKPSEESLERFLTDLELRLHLAAEDIDAALEIDSTRALQ  65

Query  216  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  395
            R+P A ++V  +R D   L++ VS  L  +  A  ++  +VA + +++ VK RMEAA  T
Sbjct  66   RIPAAVQEVSHVRGDVTGLKADVSRGLGTVSAAASAATGNVALIVELERVKNRMEAACST  125

Query  396  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  575
            L++A  L+   + VE VF+ GDL R A TLA++R  L+ VG+V EF     +L+ LE+R 
Sbjct  126  LKEATELSAHFTQVEAVFAEGDLQRIAATLASIRQGLALVGDVPEFKGGAARLQALEERF  185

Query  576  DSMVQPRLTDALS  614
               ++P ++ AL+
Sbjct  186  HQNIEPAVSSALA  198



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 115/182 (63%), Gaps = 0/182 (0%)
 Frame = +3

Query  45   SFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVP  224
            +F ++ FDP  WIN AC ++   +PL+K L +LEM+LQ+ +E+I  +L + SA A+ R+P
Sbjct  8    AFGEDGFDPISWINNACNNKATDEPLEKFLAELEMRLQLNAEDIEATLSDNSAQAMRRIP  67

Query  225  RATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQD  404
             A +++ RL+ D   ++  V  +   +++    +  SV  ++++  VK  ME A  +L++
Sbjct  68   FAIQEIYRLQGDIQGMQDQVQVLAGSVQRDATDARGSVEHISQLHLVKANMENACNSLKE  127

Query  405  AAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSM  584
            A  L+ L   VE+VF++GDLP+ AE LA+MR  LS VG+V EF   R++L  LEDRL + 
Sbjct  128  ATELSGLFVKVEEVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAGRQKLRALEDRLQTQ  187

Query  585  VQ  590
            V 
Sbjct  188  VH  189



>ref|XP_001628559.1| predicted protein [Nematostella vectensis]
 gb|EDO36496.1| predicted protein [Nematostella vectensis]
Length=713

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 123/194 (63%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D S FS++ FD K+W+N A ++R  + P+D H   L MKLQ+  +E+  +LEE S  A+
Sbjct  1    MDFSKFSNDNFDVKEWVNSALRARDDKIPVDAHASTLVMKLQLFIQEVNNALEETSVQAV  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
            + +PR  R++  ++ +A  LR  +  + + ++K E ++A+S+  L ++DTVK  M+AA +
Sbjct  61   NNIPRVVREIDNVQHEASLLREQMHMVKEDIKKVEENTAQSMKMLMELDTVKSHMQAASQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             LQ+A   T LSS V+ VF SGD+   ++ L  M   L+ + +V ++A  R+ LE L++R
Sbjct  121  GLQEADNWTTLSSDVDKVFESGDIIAISDKLVGMHKSLNVLQDVPDYAERRRMLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L++++ P++  A +
Sbjct  181  LEALLSPKIVAAFN  194



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 119/195 (61%), Gaps = 4/195 (2%)
 Frame = +3

Query  27   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            MM D   F  + FD  +WIN  C++R    P+++ L DLE++ Q+ SE+ A +LEE S  
Sbjct  16   MMRD---FESDGFDRARWINERCRARG-DVPVERFLSDLELQTQLVSEDAARALEERSRE  71

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            A  RVPRATR++ R+     +LR    ++L +L + E  S  SV  L ++D  KRRME+A
Sbjct  72   ATSRVPRATREIERVERRVEALREETRAMLTRLDEVEEVSRASVDALRQLDAAKRRMESA  131

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             ETLQ+  GL  L + V+ +F+SG++   ++ LA M+  L+ VG+V EFA+ + ++   E
Sbjct  132  KETLQETNGLADLMANVDGIFASGNIRSMSDALARMKRALAVVGDVPEFADGQDKVNAFE  191

Query  567  DRLDSMVQPRLTDAL  611
             +L+ +V+P L  A 
Sbjct  192  HKLEGIVRPALVTAF  206



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 119/197 (60%), Gaps = 0/197 (0%)
 Frame = +3

Query  24   KMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            K   D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S 
Sbjct  24   KYFQDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQ  83

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
            S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ 
Sbjct  84   SVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQT  143

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L
Sbjct  144  AKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGL  203

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P+L  A +
Sbjct  204  KNRLEAIASPKLVQAFT  220



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 118/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDNFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L++M  PRL  A +
Sbjct  181  LEAMASPRLVQAFT  194



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 118/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FSD+ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSDDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDRIKTELQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L++M  PRL  A +
Sbjct  181  LEAMASPRLVQAFT  194



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 119/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P+L  A +
Sbjct  181  LEAIASPKLVQAFT  194



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 119/200 (60%), Gaps = 0/200 (0%)
 Frame = +3

Query  15   DPGKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEE  194
            D   +M D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE
Sbjct  7    DGAALMQDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEE  66

Query  195  LSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRR  374
             S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  
Sbjct  67   TSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTE  126

Query  375  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  554
            ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + + QL
Sbjct  127  LQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDKKLQL  186

Query  555  EVLEDRLDSMVQPRLTDALS  614
            E L++RL+++  PRL  A +
Sbjct  187  EGLKNRLEAIASPRLVQAFT  206



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 119/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  PRL  A +
Sbjct  181  LEAIASPRLVQAFT  194



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 121/198 (61%), Gaps = 0/198 (0%)
 Frame = +3

Query  21   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELS  200
            G+ + D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S
Sbjct  25   GEEVRDVSAFSEDTFDVKDWINKTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETS  84

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
             S L  +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D +K  ++
Sbjct  85   QSVLSSLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQ  144

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
            AA + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE 
Sbjct  145  AAKQGLHEADNWSVLANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVVDYEDKKFQLEG  204

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL++M  P+L  A +
Sbjct  205  LKNRLEAMASPKLVQAFT  222



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 119/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   + L++ VE++F SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWSVLANDVEEIFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P+L  A +
Sbjct  181  LEAIASPKLVQAFT  194



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 116/197 (59%), Gaps = 3/197 (2%)
 Frame = +3

Query  30   MVDLSSFSDEKFDPKQWINGA--CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            M+D S F D  FD K W+N A   Q   P+   D H   L MKLQ+  +E+  SLEE S 
Sbjct  1    MMDFSKFLDANFDVKDWVNAAFKAQKDSPEQK-DAHAATLVMKLQLFIQEVNNSLEETSQ  59

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT+K RM+A
Sbjct  60   QALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDTIKSRMKA  119

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A + LQ+A   T L + V++VF+S D+   A+ L  M+H LS +    ++    + LEVL
Sbjct  120  ASDALQEADNWTTLMADVDEVFASKDVQLIADKLLAMQHSLSMLAHCGDYDERCQSLEVL  179

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL++++ P+L  A +
Sbjct  180  KNRLEALLSPQLVSAFN  196



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 118/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+ +FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVGAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDRIKTELQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  PRL  A +
Sbjct  181  LEAIASPRLVQAFT  194



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 118/193 (61%), Gaps = 0/193 (0%)
 Frame = +3

Query  36   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  215
            D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  131  DVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  190

Query  216  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  395
             +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A + 
Sbjct  191  SLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQG  250

Query  396  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  575
            L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  251  LHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNRL  310

Query  576  DSMVQPRLTDALS  614
            +++  PRL  A +
Sbjct  311  EAIASPRLVQAFT  323



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 119/194 (61%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P+L  A +
Sbjct  181  LEAIASPKLVQAFT  194



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 118/193 (61%), Gaps = 0/193 (0%)
 Frame = +3

Query  36   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  215
            D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  50   DVSAFSEDIFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  109

Query  216  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  395
             +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A + 
Sbjct  110  SLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQG  169

Query  396  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  575
            L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  170  LHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNRL  229

Query  576  DSMVQPRLTDALS  614
            +++  P+L  A +
Sbjct  230  EAIASPKLVQAFT  242



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 117/194 (60%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  PRL  A +
Sbjct  181  LEAIASPRLVQAFT  194



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 114/194 (59%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+++FSD+ F+ K WIN   +S   Q+  D  +  L MKLQ+  +++  +LE+ S   L
Sbjct  1    MDVAAFSDDNFEVKNWINKTFKSAEAQENRDAFVSSLVMKLQLYVQQVNSALEDTSQQVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L  +AL LR  + S+ Q++ K E  +A+S+ TL ++D +K  ++AA E
Sbjct  61   QSLPRVMRDTEILHQEALLLRDKMHSVKQEIAKVEQDTAQSMKTLERIDRIKTELQAAKE  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ +   QLE L++R
Sbjct  121  ALHEADNWTVLATDLEEVFESGDIQSISAKLVSMQQSLRILANVPDYEDRHLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L++M  P L  A +
Sbjct  181  LEAMASPLLVQAFT  194



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = +3

Query  21   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLE  191
            GK+ +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +E
Sbjct  17   GKLKMDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIE  74

Query  192  ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  371
            E S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K 
Sbjct  75   ETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKS  134

Query  372  RMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQ  551
            RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  + 
Sbjct  135  RMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRCQH  194

Query  552  LEVLEDRLDSMVQPRLTDALS  614
            LE L++RL++++ P+L  A +
Sbjct  195  LETLKNRLEAVLSPQLVQAFT  215



>ref|XP_006825808.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Saccoglossus kowalevskii]
Length=207

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 113/197 (57%), Gaps = 7/197 (4%)
 Frame = +3

Query  36   DLSSFSDEKFDPKQWINGACQSRH--PQ--DPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            D S F D+ FD K+W+N A +++   PQ  D L   LV    KLQ+  +E+  SLEE S 
Sbjct  10   DFSKFLDDNFDVKEWVNAAFRTQRDTPQQKDALASTLV---TKLQLFIQEVNNSLEETSQ  66

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL   PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D +K RM++
Sbjct  67   QALQNFPRVLRDVEAVRQEAAFLQEQMQMVKEDIKKVEQDTAQSMQMLLELDVIKSRMQS  126

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A   L++A   T L + ++D+F S D+   A+ L  M+H LS +    ++    + LE L
Sbjct  127  ASSALKEADNWTTLMADIDDLFQSQDVHAIAKKLLAMQHSLSLLAHCGDYEERAQYLETL  186

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++V P+L  A +
Sbjct  187  KNRLETLVSPQLITAFN  203



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 119/197 (60%), Gaps = 5/197 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +EE S 
Sbjct  1    MDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIEETSQ  58

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K RM +
Sbjct  59   QAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKSRMTS  118

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  + LE L
Sbjct  119  AAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRCQHLETL  178

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL++++ P+L  A +
Sbjct  179  KNRLEAVLSPQLVQAFT  195



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 117/194 (60%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L
Sbjct  1    MDVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A +
Sbjct  61   SSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
            +L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + + QLE L++R
Sbjct  121  SLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L++M  P+L  A +
Sbjct  181  LEAMASPKLVQAFT  194



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 116/193 (60%), Gaps = 0/193 (0%)
 Frame = +3

Query  36   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  215
            D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L 
Sbjct  16   DVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVLS  75

Query  216  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  395
             +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A ++
Sbjct  76   SLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQS  135

Query  396  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  575
            L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + + QLE L++RL
Sbjct  136  LHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDKKLQLEGLKNRL  195

Query  576  DSMVQPRLTDALS  614
            ++M  P+L  A +
Sbjct  196  EAMASPKLVQAFT  208



>ref|XP_007903980.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Callorhinchus milii]
Length=687

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 115/196 (59%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P++  A +
Sbjct  181  NRLEALASPQIVAAFN  196



>ref|XP_007903979.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Callorhinchus milii]
Length=766

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 115/196 (59%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P++  A +
Sbjct  181  NRLEALASPQIVAAFN  196



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 111/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            ALH +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALHNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 115/197 (58%), Gaps = 5/197 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F D+ FD K+W+N A   R+ +D     D++   L MKLQM  +E+   LEE S 
Sbjct  1    MDYSKFLDDSFDAKEWVNAA--FRNHKDTAVSKDQYATTLVMKLQMFIQEVNNILEEASQ  58

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  R++  +R +A  L+  +  + + ++K E S+A+S+  L K+D +K RM+ 
Sbjct  59   QALQNLPRVMREIDAVRQEASLLQDQMRMVKEDIQKVEQSTAQSMQVLLKLDGIKGRMKT  118

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
              E L++A   T LS+ VE+VF S D+    + L  M+  L  + +  ++A+  + LE L
Sbjct  119  TAEALKEADNWTTLSADVEEVFHSNDIQAITDKLTGMQQSLQMLVDTPDYADRCQHLEKL  178

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL++++ P+L  A +
Sbjct  179  KNRLEAILSPQLIAAFN  195



>emb|CAG04322.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 110/196 (56%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLALISSKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P++    +
Sbjct  181  NRLEALASPQIVGTFN  196



>ref|XP_002128341.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ciona 
intestinalis]
Length=765

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 107/187 (57%), Gaps = 0/187 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D S FSD+ FD K+W+NG  +S+  +   + +   L  KLQ   +E+  SLEE+S  A+
Sbjct  1    MDFSKFSDDNFDVKEWVNGVFRSQKDEQQKEAYTATLVTKLQRYIQEVNRSLEEISQQAV  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RDV  L+ +A  L   +  + +++R  E  ++ S+  L K+D+V+ R+E A  
Sbjct  61   GNLPRVLRDVETLKKEATFLWQQMQQVKEEIRSVEQRTSHSMEVLVKIDSVRSRVEQASA  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L++A   + L+S +ED+F SGD+   A  L +M+  L  +    ++ +    LE L++R
Sbjct  121  ALKEADNWSSLASAIEDIFRSGDIEAVAAQLQSMQASLVVLRNSPDYDDKVLHLEALKNR  180

Query  573  LDSMVQP  593
            L++ V P
Sbjct  181  LETAVSP  187



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 116/209 (56%), Gaps = 18/209 (9%)
 Frame = +3

Query  39   LSSFSDEKFDPKQWINGACQSRHPQDPLDKHL------------------VDLEMKLQMA  164
            +  F+D +FDP  ++N A +     D   KHL                   +LEM+LQ+ 
Sbjct  1    MEEFNDPRFDPIHYVNVAARQCFNNDEKKKHLQHKANDITDENVELERLLSELEMRLQLL  60

Query  165  SEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVAT  344
             E+I++ LE  S   + R+P A  ++  L ++  SL ++V +I + L + E  S +S+  
Sbjct  61   GEDISLQLERESQLGVKRIPTAIGEIEVLEENVESLTNTVKNISRSLDETEFPSKQSIER  120

Query  345  LAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEV  524
            L K+D VK RME A +TL +AAGL +L  +V+ VF+  ++   A+ L  M+  L+ VG+V
Sbjct  121  LRKIDEVKSRMERARDTLSEAAGLAELMHSVDSVFNGENVSNMADALVRMKRGLAIVGDV  180

Query  525  AEFANIRKQLEVLEDRLDSMVQPRLTDAL  611
             EFA+ R ++ VLE RL+S  +P L  AL
Sbjct  181  PEFADGRDRIAVLESRLESAARPALLRAL  209



>ref|XP_008474492.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Diaphorina citri]
Length=272

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 114/194 (59%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FS + FD K WIN + ++   QD    ++ ++  KLQ+  +++   LEE++   +
Sbjct  1    MDISAFSSDNFDVKNWINESLKNVKDQDNKSVYVGNMVKKLQLYVQQVNSGLEEMNEQVV  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  RD   L  +A  L+  +S++ Q++   E ++  S+A+L ++D +K  + +A +
Sbjct  61   ASLPRIMRDANVLSQEAEMLQQKMSAVKQEIIDVEKNTRASMASLERIDKIKSELLSAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
            +L +A   T +++ +E++F  GD+   A  + +M+ CL+ +    ++ + R QLE L+++
Sbjct  121  SLHEADNWTLMTTDIEEIFERGDIEGIAAKIVSMQQCLAVLTHTPDYEDKRLQLETLKNQ  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P L  A +
Sbjct  181  LEAIASPHLVQAFT  194



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNSIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ LS + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLSMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>emb|CBN81326.1| Conserved oligomeric Golgi complex subunit 7 [Dicentrarchus labrax]
Length=445

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 110/192 (57%), Gaps = 2/192 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K+W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLT  602
            +RL+++  P++ 
Sbjct  181  NRLEALASPQIV  192



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 59/194 (30%), Positives = 117/194 (60%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+++FS + F+ K WIN   +S   Q+  D ++  L MKLQ+  +++  ++E+ S S L
Sbjct  1    MDIAAFSKDDFNIKDWINKILESLDSQNDKDAYVGSLIMKLQLYVQQVNGNIEDTSQSVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +PR  R+   L+ +A+SL+  +S +  ++ K E  ++ S+ +LAK+D +K  +E A +
Sbjct  61   ASLPRIFRETQLLQQEAVSLKDKMSVVKDEIAKIEKDTSLSINSLAKIDKIKCDLEKAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
            +L +A   + L++ VED F +GD+   ++ + +M+  LS +    ++   + QLE L++R
Sbjct  121  SLHEADNWSVLANEVEDSFETGDIEMISKKIFSMQKSLSMLTNTIDYEEKKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P+L  A +
Sbjct  181  LEAIASPQLVQAFT  194



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQ--SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +  S+      D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVSKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEAFFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFALISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 110/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 110/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 110/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K+W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRMVQKEAPGKADGHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M   L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLSVISSKLTSMTSSLAMLADTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 117/196 (60%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K+WINGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFKAVPKEAPGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVTVISAKLTSMQNSLTMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 113/192 (59%), Gaps = 3/192 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD---PLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  E F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFEVKRWVNGAFRAVQQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRL  599
            ++RL++M  P++
Sbjct  181  KNRLEAMASPQI  192



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + FD K W+NGA +    + P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLADDFDVKDWVNGAFKVAQQEAPGRADAHAATLVMKLQLFIQEVNNSIEESSIQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RD+  L+ +A  L+  ++ + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDIEALKQEASFLKDQMTMVKEDIKKFEQDTLQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D+   +  LA M+  L+ + +  +++    QLE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDVAVISSKLAAMQSSLAMLVDTPDYSEKCVQLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P++    +
Sbjct  181  NRLEALASPQIVSTFN  196



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 114/194 (59%), Gaps = 1/194 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D S F DE FD K+W+N A ++       D++   L MKLQM  +E+   +EE    ++
Sbjct  1    MDYSKFLDESFDVKEWVNAAFRANKDSSQ-DQYATTLVMKLQMFIQEVNNLIEESCLQSV  59

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
            + +PR  R++  L+ +A+ L+  +  I   ++K E  +++S+ TL K+DTVK RM+ A E
Sbjct  60   NNLPRVMRELEALKQEAVLLQDQMKMIKFDIQKVEQDTSQSMLTLLKLDTVKTRMKDASE  119

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             LQ+A   T L S ++D++ SG++   A  L  ++  L  + +V ++    + LE L++R
Sbjct  120  ALQEADNWTSLLSGLDDIYESGNVNEIAAKLVGLQQSLLILTDVPDYEERCQYLETLKNR  179

Query  573  LDSMVQPRLTDALS  614
            L++++ P++  A S
Sbjct  180  LEALLSPQVVAAFS  193



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 108/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAIISSKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 110/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D++FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDEFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDMAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 109/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 114/192 (59%), Gaps = 3/192 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD---PLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  + F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLADDFEVKRWVNGAFRAVQQQDAPSKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQNSLAMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRL  599
            ++RL++M  P++
Sbjct  181  KNRLEAMASPQI  192



>ref|XP_003761800.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sarcophilus 
harrisii]
Length=655

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 116/196 (59%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K+WINGA ++  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFRAAPKEASGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVAVISAKLTSMQNSLTMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 108/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E LQ+A   + LS+ +E+ F + D    +  L +M+  L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQSSLAMLVDTPDYSDKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL++M  P++
Sbjct  181  NRLEAMASPQI  191



>ref|XP_008536012.1| PREDICTED: conserved oligomeric Golgi complex subunit 7, partial 
[Equus przewalskii]
Length=201

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++    S
Sbjct  180  LKNRLEALASPQIVAVFS  197



>ref|XP_003230252.2| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Anolis carolinensis]
Length=768

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 115/196 (59%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F +E F+ K W+NGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLEEDFEVKSWVNGAFRAMQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSQQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQSMPRVLREVEALKQEAAFLKEQMVLVREDIKKLEQDTAQSMQVLVQLDQVKSRMQMA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             ++LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADSLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAVLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P++  A +
Sbjct  181  NRLEALASPQIVAAFN  196



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQ--SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  E FD K+WIN A +  S+      D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAGSKEAAGKADGHAATLVMKLQLFIQEVNHAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDIGVISAKLTGMQNSLAMLVDTPQYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL+++  P +  A +
Sbjct  181  NRLEALASPHIVAAFA  196



>ref|XP_974190.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tribolium 
castaneum]
Length=726

 Score =   107 bits (266),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 55/194 (28%), Positives = 111/194 (57%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+FSD+ FD K WIN   ++   QD  + + + L MKLQ+  +++  +LE+ S   L
Sbjct  1    MDISAFSDDNFDTKAWINDVLKNAETQDKKENYTMSLVMKLQLCVQQVNSALEDTSQQIL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT+K  +  A +
Sbjct  61   MSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDTIKNELNMAKQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L ++   T L + +E+VF S ++   +  +  M+  L  +  V+++ + + QLE L++R
Sbjct  121  GLHESDNWTILVNDLEEVFDSKNIENISAKIIGMQRSLQLLVNVSDYEDRKLQLEGLKNR  180

Query  573  LDSMVQPRLTDALS  614
            L+++  P +  A +
Sbjct  181  LEAIASPAIVQAFT  194



>ref|NP_001015714.1| component of oligomeric golgi complex 7 [Xenopus (Silurana) tropicalis]
 gb|AAH89645.1| MGC107838 protein [Xenopus (Silurana) tropicalis]
Length=768

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 114/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A +S     P  +D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKDWVNAAFKSVQKDAPAKVDAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             ++LQ+A   + LS+ +E+ F + ++   +E L +M+  L+ + +  +++     LE L+
Sbjct  121  ADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQVSLTMLVDTPDYSEKCVYLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMCSPQIVAAFN  196



>ref|NP_001264493.1| conserved oligomeric Golgi complex subunit 7 [Gallus gallus]
Length=769

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D+S F  + F+ K W+N A ++     P   D H   L MKLQ+  +E+   +EE S  
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQQDAPGQADAHASTLVMKLQVFIQEVNNVVEEASQQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   T LS+ +E+   + D+   A  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWTTLSADIEETLKTQDVSAIAAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 108/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM  A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMHLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             + LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_008202374.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Nasonia vitripennis]
Length=737

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 112/195 (57%), Gaps = 1/195 (1%)
 Frame = +3

Query  33   VDLS-SFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            +D+S +  +++FDP   IN  C++   ++ ++ +L  + MKLQ+  +++  SLEE S + 
Sbjct  1    MDISQALGEDEFDPVDLINKICRTEEARENVETYLSSILMKLQLYVQQVNASLEETSQNV  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D +K       
Sbjct  61   LSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDKIKTEYINKT  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + + QLE L++
Sbjct  121  EGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDKKLQLEGLKN  180

Query  570  RLDSMVQPRLTDALS  614
            RL+++  P+L  A +
Sbjct  181  RLEALTSPKLVQAFT  195



>ref|XP_008202373.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Nasonia vitripennis]
Length=749

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 108/190 (57%), Gaps = 0/190 (0%)
 Frame = +3

Query  45   SFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVP  224
            +  +++FDP   IN  C++   ++ ++ +L  + MKLQ+  +++  SLEE S + L  +P
Sbjct  18   ALGEDEFDPVDLINKICRTEEARENVETYLSSILMKLQLYVQQVNASLEETSQNVLSNMP  77

Query  225  RATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQD  404
            +  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D +K       E  ++
Sbjct  78   KVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDKIKTEYINKTEGQRE  137

Query  405  AAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSM  584
            +      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + + QLE L++RL+++
Sbjct  138  SDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDKKLQLEGLKNRLEAL  197

Query  585  VQPRLTDALS  614
              P+L  A +
Sbjct  198  TSPKLVQAFT  207



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K WIN A ++  P+D +    D H  +L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFKAG-PKDGVAGKADGHAANLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HLALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + DL   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDLAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++    S
Sbjct  180  LKNRLEALASPQIVAVFS  197



>ref|NP_001085832.1| component of oligomeric golgi complex 7 [Xenopus laevis]
 gb|AAH73403.1| MGC80865 protein [Xenopus laevis]
Length=768

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL--DKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K+W+N A +S     P   D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKEWVNAAFKSVQKDAPAKADAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMHVLVEMDKVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + ++   +E L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQNISVISEKLTSMQVSLTMLVDTPDYSEKCVYLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMCSPQIVAAFN  196



>ref|XP_002711891.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryctolagus 
cuniculus]
Length=847

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  78   MDFSKFLADDFDVKEWINAAFKAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  136

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +PR  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  137  HQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  196

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  197  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLAMLVDTPDYSEKCVHLEA  256

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  257  LKNRLEALASPQIVAAFT  274



>ref|XP_005656829.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Sus scrofa]
Length=651

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVTVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_010568819.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X5 [Haliaeetus leucocephalus]
Length=639

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 107/190 (56%), Gaps = 1/190 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAA  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            + LQ+A   + LS+ +E+ F + DL   +  L  M++ L+ + +  +++     LE L++
Sbjct  121  DALQEADKWSTLSADIEETFKTQDLAVISSKLTAMQNSLAMLVDTPDYSEKCVHLEALKN  180

Query  570  RLDSMVQPRL  599
            RL+++  P++
Sbjct  181  RLEALASPQI  190



>ref|XP_005323804.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ictidomys 
tridecemlineatus]
Length=770

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P+D      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKDSAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDITVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_010568818.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Haliaeetus leucocephalus]
Length=671

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_011502446.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratosolen 
solmsi marchali]
Length=734

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 56/194 (29%), Positives = 113/194 (58%), Gaps = 1/194 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            +D+S+F++  FDP  +IN  C+S   +  ++ HL  + MKLQ+  +++ VSLEE + + L
Sbjct  1    MDISTFNENDFDPIDFINKICRSEEARANIEAHLSSILMKLQLYIQQVHVSLEETNQNVL  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +P+  RD   L+ +A +L++ + ++  +L   +  ++ S+  L K+D +K +  +   
Sbjct  61   SNMPKVLRDTQLLQQEAQALKNKMQTVRMELENVKKDTS-SIYVLMKLDKLKAQTISNAT  119

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             + +    + L   ++ VF S +    A+TL +M+  LS++ +  +F N + QLE L++R
Sbjct  120  CINEDNTWSILIHDIDSVFESENEETIAKTLYSMKQSLSSLNDSTDFKNKKSQLEELKNR  179

Query  573  LDSMVQPRLTDALS  614
            L+ M++P+L  A +
Sbjct  180  LEIMIRPKLMQAFT  193



>ref|XP_008312851.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cynoglossus 
semilaevis]
Length=769

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 109/197 (55%), Gaps = 4/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGA---CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  + FD K+W+NGA    Q   P  P D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLGDDFDVKEWVNGAFKVVQKDVPGKP-DTHAATLVMKLQLFIQEVNNAIEESSN  59

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  RDV  ++ +A  L+  +  + + ++K E  +  S+  L ++D +K RM+ 
Sbjct  60   QALQNMPRVLRDVDAVKQEASFLKEQMVLVKEDIQKFEQDTVRSMQVLVEIDQIKSRMQV  119

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A + LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++     LE L
Sbjct  120  AADALQEADKWSTLSADIEETFKTQDFAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEAL  179

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P++    +
Sbjct  180  KNRLEALASPQIVGTFN  196



>ref|XP_006027196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Alligator 
sinensis]
Length=769

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 111/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  SESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_006268482.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Alligator mississippiensis]
Length=771

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 111/191 (58%), Gaps = 2/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRL  599
            +RL+++  P++
Sbjct  181  NRLEALASPQI  191



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 122/221 (55%), Gaps = 30/221 (14%)
 Frame = +3

Query  39   LSSFSDEKFDPKQWIN-----------GACQSRHPQD-------------------PLDK  128
            L  FS + FD  +WIN           G+ +    +D                   PL++
Sbjct  12   LRDFSSDDFDRVRWINEQTRARIGDAGGSGRDATARDGSAVVARAVGEGTRGTSASPLER  71

Query  129  HLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLR  308
             L DLE++LQ+  E++++SLEE S   + RVP+A +++  +      L   V  IL +L 
Sbjct  72   FLADLELQLQLLGEDLSMSLEERSREGVARVPKAVKEIEVVEGRVKRLHEEVRGILDRLD  131

Query  309  KAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLA  488
            + E  S  SV  L ++D  K+RME+A ETLQ+A GL  L ++V+ +F+SG++   +E+LA
Sbjct  132  EVESESRASVEALRQLDAAKQRMESARETLQEANGLADLMASVDGIFASGNIRNMSESLA  191

Query  489  NMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDAL  611
             M+  L+ VG+V EFA+ + ++   E +L+++V+P L  AL
Sbjct  192  RMKRGLAVVGDVPEFADGQDKVNAFEHKLEAIVRPALITAL  232



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 112/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  + FD K WIN A ++   +     +D H   L MKLQ+  +E+  +LEE S 
Sbjct  1    MDFSKFLADDFDVKDWINTAFRAGSKEAAAAKVDGHAATLVMKLQLFIQEVNHALEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L+ M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIILISNKLSGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P +  AL+
Sbjct  181  KNRLEALASPHIIAALT  197



>ref|XP_010568814.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Haliaeetus leucocephalus]
Length=769

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>gb|KFV72508.1| Conserved oligomeric Golgi complex subunit 7, partial [Struthio 
camelus australis]
Length=768

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 112/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_010621761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fukomys 
damarensis]
 gb|KFO33512.1| Conserved oligomeric Golgi complex subunit 7 [Fukomys damarensis]
Length=770

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 115/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE+S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEEMS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_009665174.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Struthio camelus australis]
Length=769

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 112/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_010568816.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Haliaeetus leucocephalus]
Length=728

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_005656828.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Sus scrofa]
Length=755

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVTVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_003795774.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
2 [Otolemur garnettii]
Length=684

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIITAFT  197



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 112/193 (58%), Gaps = 5/193 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDIEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAMISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRL  599
            L++RL+++V P++
Sbjct  180  LKNRLEALVSPQI  192



>ref|XP_004332588.1| PREDICTED: LOW QUALITY PROTEIN: component of oligomeric golgi 
complex 7 [Tursiops truncatus]
Length=685

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP----LDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++     +D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKVDGHAATLVMKLQVFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFN  197



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 107/191 (56%), Gaps = 1/191 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  209
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDVPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  210  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  389
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAS  120

Query  390  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  569
            + LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L++
Sbjct  121  DALQEADKWSTLSADIEETFKTQDMAVISSKLTAMQNSLAMLVDTPDYSEKCVHLEALKN  180

Query  570  RLDSMVQPRLT  602
            RL+++  P++ 
Sbjct  181  RLEALASPQIV  191



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 60/206 (29%), Positives = 116/206 (56%), Gaps = 18/206 (9%)
 Frame = +3

Query  48   FSDEKFDPKQWINGACQSRHP---------------QDPLDKHL---VDLEMKLQMASEE  173
            FS + F+ KQWIN   +  +                +  L+ H+    D+  KLQ+ S E
Sbjct  19   FSSDTFNTKQWINNLLKPANSTSSQSQTNDVFNYSIESDLEVHINRASDILSKLQIYSLE  78

Query  174  IAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAK  353
            + +SLE  ++ +L  VP+A R++ R+R +++SL+  V  I Q +     +++++VA ++ 
Sbjct  79   LNMSLENKASDSLLYVPKAVREIDRVRKESVSLKQKVKHINQTIASMHANTSDTVARISS  138

Query  354  VDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF  533
            +DTV++R++    +L +A  L   SS ++ +F S D  + A+TL  ++  L+ + ++ EF
Sbjct  139  LDTVRKRIDQCIISLNEAEKLLSFSSGLDKLFQSADYLKIADTLEGVKQSLAVLSDIPEF  198

Query  534  ANIRKQLEVLEDRLDSMVQPRLTDAL  611
               ++  +  +DRL+S+V+P+L  AL
Sbjct  199  REQQRHFQAHQDRLESLVRPQLIGAL  224



>ref|XP_006730882.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Leptonychotes 
weddellii]
Length=731

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 111/197 (56%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P++  A +
Sbjct  181  KNRLEALASPQIVAAFT  197



>ref|XP_010717801.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Meleagris 
gallopavo]
Length=769

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 112/197 (57%), Gaps = 4/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D+S F  + F+ K W+N A ++   QD     D H   L MKLQ+  +E+   +EE S 
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQ-QDAAGQTDAHASTLVMKLQVFIQEVNNVVEEASQ  59

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ 
Sbjct  60   QALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQL  119

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   T LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L
Sbjct  120  AAESLQEADKWTTLSADIEETLKTQDVSAISAKLTSMQSSLAMLVDTPDYSEKCVHLEAL  179

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL++M  P++  A +
Sbjct  180  KNRLEAMASPQIVAAFN  196



>ref|XP_003795773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
1 [Otolemur garnettii]
Length=772

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIITAFT  197



>ref|XP_004020887.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ovis 
aries]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 111/197 (56%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P++  A +
Sbjct  181  KNRLEALASPQIVAAFT  197



>ref|XP_010835502.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bison 
bison bison]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSRFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  ++ + + +RK E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMTLVKEDIRKFEQDTSQSMKVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLIGMQNSLAMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL++   P++  A +
Sbjct  180  LKNRLEAFASPQIIAAFN  197



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 115/194 (59%), Gaps = 0/194 (0%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  212
            ++LS+FS + FD K+WIN A Q+   Q+  + +  ++  KLQ+  +E+  +LE+ +    
Sbjct  1    MNLSAFSSDTFDAKEWINNAFQAPEAQENKEAYASEVAFKLQLFIQEMNSALEDTAQQVQ  60

Query  213  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  392
              +P+  RDV  ++ +A  L+  ++++ + + K E  S+ S+ TL ++DT+K RM  A +
Sbjct  61   QNLPKVLRDVETMQQEAALLKLQMAAVQKDIAKVEQDSSTSMKTLLELDTIKLRMLEANQ  120

Query  393  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  572
             L++A   T LS+ V+ VF SGD+      L  ++  L  + +V +F +  ++LE L+++
Sbjct  121  ALREADNWTTLSADVDQVFQSGDVQAITARLVGLQTSLEILVDVPDFEHRLQRLESLKNQ  180

Query  573  LDSMVQPRLTDALS  614
            L++M+  +L  A +
Sbjct  181  LEAMLSTQLVQAFT  194



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 111/197 (56%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRLTDALS  614
            ++RL+++  P++  A +
Sbjct  181  KNRLEALASPQIVAAFT  197



>ref|XP_006148372.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tupaia 
chinensis]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|NP_001076841.1| conserved oligomeric Golgi complex subunit 7 [Bos taurus]
 sp|A2VDR8.1|COG7_BOVIN RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Bos taurus]
 gb|AAI33372.1| COG7 protein [Bos taurus]
 tpg|DAA15508.1| TPA: conserved oligomeric Golgi complex subunit 7 [Bos taurus]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004778381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004819145.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVTAFA  197



>gb|ELW66292.1| Conserved oligomeric Golgi complex subunit 7 [Tupaia chinensis]
Length=981

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 114/202 (56%), Gaps = 5/202 (2%)
 Frame = +3

Query  21   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSL  188
            G   +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++
Sbjct  44   GGAAMDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAV  102

Query  189  EELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVK  368
            EE S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK
Sbjct  103  EETSLQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVK  162

Query  369  RRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRK  548
             RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++    
Sbjct  163  SRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCV  222

Query  549  QLEVLEDRLDSMVQPRLTDALS  614
             LE L++RL+++  P++  A +
Sbjct  223  HLEALKNRLEALASPQIVAAFT  244



>ref|XP_005697660.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Capra 
hircus]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_007198346.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Balaenoptera acutorostrata scammoni]
Length=771

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_006071244.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bubalus 
bubalis]
Length=768

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_003513853.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
 gb|EGV91994.1| Conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQTSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEEDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_007105719.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Physeter 
catodon]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_005975366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pantholops 
hodgsonii]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_005054658.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Ficedula albicollis]
Length=769

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 110/192 (57%), Gaps = 3/192 (2%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  203
            +D S F  + FD K+WIN A ++   +  +   D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAGPKEAAVGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  204  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  383
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQL  120

Query  384  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  563
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  564  EDRLDSMVQPRL  599
            ++RL+++  P++
Sbjct  181  KNRLEALASPQI  192



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D    +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDTAVISAKLTGMQTSLTMLADTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_004855999.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_009565762.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Cuculus canorus]
Length=768

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  E F+ K W+N A ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSEDFEVKGWVNAAFRAVQHDGPAKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEVIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTXDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMASPQIVAAFN  196



>gb|KFO95573.1| Conserved oligomeric Golgi complex subunit 7, partial [Calypte 
anna]
Length=768

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 112/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVTVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMTSPQIVTAFN  196



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++    S
Sbjct  180  LKNRLEALASPQIVTVFS  197



>ref|XP_008488587.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Calypte 
anna]
Length=769

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 112/196 (57%), Gaps = 2/196 (1%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  206
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  207  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  386
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  387  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  566
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVTVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  567  DRLDSMVQPRLTDALS  614
            +RL++M  P++  A +
Sbjct  181  NRLEAMTSPQIVTAFN  196



>ref|XP_008150973.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Eptesicus 
fuscus]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSRFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D    +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDTAVISAKLTGMQTSLTMLADTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



>ref|XP_005905382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bos 
mutus]
Length=770

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +3

Query  33   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  200
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  201  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  380
              AL  +P+  RD+  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDIEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  381  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  560
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  561  LEDRLDSMVQPRLTDALS  614
            L++RL+++  P++  A +
Sbjct  180  LKNRLEALASPQIVAAFT  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660