BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026F15

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase             79.3    7e-17   Ipomoea batatas [batate]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                 55.1    8e-06   Citrus sinensis [apfelsine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.1    8e-06   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg           55.1    8e-06   Citrus clementina [clementine]
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      55.1    8e-06   
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                 55.1    9e-06   Morus notabilis
gb|KDO82335.1|  hypothetical protein CISIN_1g006968mg                 54.3    1e-05   Citrus sinensis [apfelsine]
gb|KDO82336.1|  hypothetical protein CISIN_1g006968mg                 54.3    1e-05   Citrus sinensis [apfelsine]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      53.9    2e-05   Eucalyptus grandis [rose gum]
gb|KDP26621.1|  hypothetical protein JCGZ_17779                       53.9    2e-05   Jatropha curcas
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  51.6    1e-04   Solanum tuberosum [potatoes]
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              50.8    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.8    2e-04   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      50.8    2e-04   Nelumbo nucifera [Indian lotus]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                   50.8    2e-04   Eucalyptus grandis [rose gum]
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   50.4    3e-04   Eucalyptus grandis [rose gum]
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   50.4    3e-04   Eucalyptus grandis [rose gum]
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   50.4    3e-04   Eucalyptus grandis [rose gum]
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   50.4    3e-04   Eucalyptus grandis [rose gum]
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   50.4    3e-04   Eucalyptus grandis [rose gum]
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.4    3e-04   Solanum tuberosum [potatoes]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.1    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      50.1    4e-04   
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.1    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  49.7    5e-04   Solanum lycopersicum
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  49.7    5e-04   Nicotiana tomentosiformis
gb|KJB61045.1|  hypothetical protein B456_009G337000                  49.3    6e-04   Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                  49.3    7e-04   Gossypium raimondii
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  49.3    7e-04   Elaeis guineensis
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  49.3    7e-04   Solanum lycopersicum



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score = 79.3 bits (194),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  454  KFWAWGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            K    GIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDP
Sbjct  10   KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDP  50


 Score = 34.3 bits (77),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  426  MEREWFLLFKVLGLG  470
            MEREWFL FKVLGLG
Sbjct  1    MEREWFLPFKVLGLG  15



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  454  KFWAWGIWML-IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            KFW  G  +L +   C ATLSP+G+NYEVVAL+A+K  LHDP
Sbjct  7    KFWRVGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDP  48



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  454  KFWAWGIWML-IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            KFW  G  +L +   C ATLSP+G+NYEVVAL+A+K  LHDP
Sbjct  7    KFWRVGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDP  48



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  454  KFWAWGIWML-IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            KFW  G  +L +   C ATLSP+G+NYEVVAL+A+K  LHDP
Sbjct  7    KFWRVGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDP  48



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  457  FWAWGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDP  576
            FW  G+ +L    CS +TLSPSGVNYEVVALIAIK  L DP
Sbjct  8    FWKVGLLVLAMVECSYSTLSPSGVNYEVVALIAIKNDLRDP  48



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  412  KKGRLWKGSGFCYSKFWAWGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            ++ R+ K   F ++   A  +++ +  + SATLSP+G+NYEVVAL+AIKT L+DP
Sbjct  5    REKRMGKSGSFLWNLVGALLVFLALLQASSATLSPTGINYEVVALVAIKTALNDP  59



>gb|KDO82335.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=540

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  454  KFWAWGIWML-IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            KFW  G  +L +   C ATLSP+G+NYEVVAL+A+K  LHDP
Sbjct  7    KFWRVGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDP  48



>gb|KDO82336.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=391

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  454  KFWAWGIWML-IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            KFW  G  +L +   C ATLSP+G+NYEVVAL+A+K  LHDP
Sbjct  7    KFWRVGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDP  48



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  460  WAWGIWMLIA--TSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W    ++++A   SCSA+LSP+GVNYEV+AL+AIKT LHDP
Sbjct  3    WRVSCFLVLAWLGSCSASLSPAGVNYEVMALMAIKTALHDP  43



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +1

Query  457  FWAWGI----WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
             W W +    W L+  S SATLSP+G+NYEVVAL+ IKT LHDP
Sbjct  6    LWLWKVGLVVWALMEIS-SATLSPTGINYEVVALVNIKTALHDP  48



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 2/42 (5%)
 Frame = +1

Query  457  FWAWGIWML--IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            FW  G+ +   +  S SATLSP+GVNYEVVAL  IK  LHDP
Sbjct  5    FWNVGLLLFCTLMESSSATLSPAGVNYEVVALTEIKKALHDP  46



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = +1

Query  451  SKFWAWGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDP  576
            S FW   + +L     S +TLSPSGVNYEVVALIAIK+ LHDP
Sbjct  6    SLFWQVVLLVLAMVKGSYSTLSPSGVNYEVVALIAIKSDLHDP  48



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = +1

Query  466  WGIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            WG+ +L+ +     SATLSPSG+NYEV AL+ IKTGL DP
Sbjct  8    WGVGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDP  47



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = +1

Query  466  WGIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            WG+ +L+ +     SATLSPSG+NYEV AL+ IKTGL DP
Sbjct  8    WGVGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDP  47



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 3/43 (7%)
 Frame = +1

Query  457  FWAWGIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            FW  G+ +L+       +ATLSPSGVNYEVVAL+AIK  L+DP
Sbjct  7    FWGVGLVLLVLAWMEGSAATLSPSGVNYEVVALMAIKNDLNDP  49



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>gb|KCW86693.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>gb|KCW86692.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>gb|KCW86691.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=625

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>gb|KCW86690.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>gb|KCW86689.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=598

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  460  WAWGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W W + +L    S SATLSPSG+NYEVVAL+ IK  L DP
Sbjct  9    WGWSLLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDP  48



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  478  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            + +  SC A+LSP+G+NYEVVALI IK  LHDP
Sbjct  13   LTLMESCYASLSPTGINYEVVALIEIKKALHDP  45



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  493  SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            S SATLSPSG+NYEVVAL+AIK  LHDP
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDP  48



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +1

Query  466  WGIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W + +L+ T   SC A+LSP+G+NYEVVAL  IK  LHDP
Sbjct  9    WYVGLLVLTLMESCYASLSPTGINYEVVALTEIKKALHDP  48



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  493  SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            S SATLSPSG+NYEVVAL+AIK  LHDP
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDP  48



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +1

Query  466  WGIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            W +++ +     SC A+LSP+G+NYEVVALI IK  LHDP
Sbjct  5    WCMFLYVVALMESCYASLSPTGINYEVVALIEIKKALHDP  44



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 3/43 (7%)
 Frame = +1

Query  457  FWAWGIWM---LIATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
             W  G+ +   L+  S SATLSP+G+NYEVVAL  IK  LHDP
Sbjct  5    LWNVGLLLICTLMMESSSATLSPTGINYEVVALTEIKKALHDP  47



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  499  SATLSPSGVNYEVVALIAIKTGLHDP  576
            SATLSP+G+NYEVVAL+AIK+ LHDP
Sbjct  23   SATLSPTGINYEVVALMAIKSNLHDP  48



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  499  SATLSPSGVNYEVVALIAIKTGLHDP  576
            SATLSP+G+NYEVVAL+AIK+ LHDP
Sbjct  23   SATLSPTGINYEVVALMAIKSNLHDP  48



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = +1

Query  436  SGFCYSKFWAWGIWMLIAT-SCSATLSPSGVNYEVVALIAIKTGLHDP  576
            SGF    FW  G+ +     + +ATLSPSG+NYEVVAL+AIK  L+DP
Sbjct  6    SGF---SFWMLGLLLWAGPLASAATLSPSGINYEVVALMAIKMELNDP  50



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  484  IATSCSATLSPSGVNYEVVALIAIKTGLHDP  576
            +  SC A+LSP+G+NYEVVALI IK  LHDP
Sbjct  14   LMESCYASLSPTGINYEVVALIEIKKALHDP  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985