BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF026B21

Length=460
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP21863.1|  hypothetical protein JCGZ_00650                       81.6    6e-15   Jatropha curcas
emb|CAN66483.1|  hypothetical protein VITISV_015390                   81.3    9e-15   Vitis vinifera
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  80.9    1e-14   Solanum tuberosum [potatoes]
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1           80.5    1e-14   Vitis vinifera
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  80.1    2e-14   Nicotiana tomentosiformis
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  80.1    2e-14   Nicotiana tomentosiformis
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...  79.7    3e-14   Solanum tuberosum [potatoes]
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.7    3e-14   Solanum tuberosum [potatoes]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.0    6e-14   Fragaria vesca subsp. vesca
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  79.0    7e-14   
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  79.0    7e-14   
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  78.6    7e-14   Solanum lycopersicum
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like      78.6    7e-14   Populus euphratica
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  78.6    7e-14   Solanum lycopersicum
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg           78.2    1e-13   Prunus persica
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like      78.2    1e-13   Prunus mume [ume]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like      77.4    2e-13   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                           77.4    2e-13   Glycine soja [wild soybean]
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like      77.0    2e-13   Nicotiana sylvestris
gb|KJB71519.1|  hypothetical protein B456_011G126800                  77.0    3e-13   Gossypium raimondii
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein             77.0    3e-13   Gossypium arboreum [tree cotton]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg              76.6    3e-13   Erythranthe guttata [common monkey flower]
emb|CDP06387.1|  unnamed protein product                              76.6    4e-13   Coffea canephora [robusta coffee]
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3              76.3    4e-13   
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like      76.6    4e-13   Populus euphratica
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like      76.6    4e-13   Glycine max [soybeans]
gb|KJB71518.1|  hypothetical protein B456_011G126800                  75.9    5e-13   Gossypium raimondii
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like      76.3    5e-13   Solanum lycopersicum
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1              75.9    6e-13   
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like      74.7    1e-12   Cicer arietinum [garbanzo]
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  74.7    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003626680.1|  Vacuolar sorting receptor                        74.7    2e-12   Medicago truncatula
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  73.9    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002309184.1|  vacuolar sorting receptor family protein         73.6    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like      73.6    4e-12   Nicotiana tomentosiformis
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g           73.2    6e-12   Phaseolus vulgaris [French bean]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative  72.4    8e-12   Ricinus communis
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  72.4    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  72.4    1e-11   Pyrus x bretschneideri [bai li]
gb|KGN58683.1|  hypothetical protein Csa_3G728010                     71.6    1e-11   Cucumis sativus [cucumbers]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein             71.6    2e-11   Gossypium arboreum [tree cotton]
gb|KJB29886.1|  hypothetical protein B456_005G122400                  71.6    2e-11   Gossypium raimondii
gb|KJB29888.1|  hypothetical protein B456_005G122400                  71.6    2e-11   Gossypium raimondii
gb|KJB29887.1|  hypothetical protein B456_005G122400                  71.6    2e-11   Gossypium raimondii
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like      71.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...  71.2    2e-11
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like      71.2    3e-11   
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg           70.9    4e-11   Citrus clementina [clementine]
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg           70.5    5e-11   
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like      70.1    5e-11   Cucumis sativus [cucumbers]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1           70.1    5e-11   Cucumis melo [Oriental melon]
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                68.9    6e-11   Citrus sinensis [apfelsine]
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                68.9    8e-11   Citrus sinensis [apfelsine]
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                68.9    8e-11   Citrus sinensis [apfelsine]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like      69.3    1e-10   
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like      68.9    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  69.3    1e-10   Nicotiana sylvestris
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  69.3    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  69.3    1e-10   Nicotiana sylvestris
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like      68.9    1e-10   Phoenix dactylifera
emb|CDY38157.1|  BnaA07g02260D                                        67.8    2e-10   Brassica napus [oilseed rape]
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like      68.2    2e-10   Phoenix dactylifera
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940           68.2    3e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1           67.8    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like      67.8    4e-10   Sesamum indicum [beniseed]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg           67.0    6e-10   
emb|CDY04821.1|  BnaAnng00030D                                        66.6    7e-10   
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like      66.6    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2           66.6    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like      66.6    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  66.2    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  66.2    1e-09   Tarenaya hassleriana [spider flower]
gb|EEE51529.1|  hypothetical protein OsJ_32728                        66.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68730.1|  hypothetical protein OsI_37233                        66.2    1e-09   Oryza sativa Indica Group [Indian rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                        66.2    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001065992.1|  Os12g0116000                                     66.2    1e-09   
gb|EEE52644.1|  hypothetical protein OsJ_35003                        65.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg              65.9    2e-09   Erythranthe guttata [common monkey flower]
gb|AAN60346.1|  unknown                                               62.8    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like      65.1    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like      65.1    3e-09   Elaeis guineensis
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                      64.7    3e-09   Morus notabilis
gb|EMT24279.1|  Vacuolar-sorting receptor 1                           64.7    3e-09   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like      64.3    5e-09   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like      64.3    5e-09   Zea mays [maize]
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  64.3    5e-09   
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like      64.3    5e-09   Cucumis sativus [cucumbers]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222            64.3    5e-09   
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                  64.3    5e-09   Arabis alpina [alpine rockcress]
emb|CDX78128.1|  BnaA09g33230D                                        64.3    6e-09   
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1           63.9    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg           63.9    6e-09   Capsella rubella
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160        63.9    6e-09   Sorghum bicolor [broomcorn]
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like      63.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                      63.9    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180588.1|  vacuolar-sorting receptor 2                         63.9    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like      63.9    8e-09   Eucalyptus grandis [rose gum]
gb|EPS73119.1|  hypothetical protein M569_01632                       63.5    9e-09   Genlisea aurea
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2           63.5    9e-09   Tarenaya hassleriana [spider flower]
gb|EPS72005.1|  hypothetical protein M569_02753                       63.2    1e-08   Genlisea aurea
ref|XP_004173121.1|  PREDICTED: vacuolar-sorting receptor 3-like      62.8    1e-08   
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg           62.8    1e-08   Eutrema salsugineum [saltwater cress]
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                  62.8    1e-08   Arabis alpina [alpine rockcress]
ref|NP_001169650.1|  hypothetical protein precursor                   62.0    3e-08   
gb|AAB72111.1|  vacuolar sorting receptor homolog                     62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82551.1|  AT3g52850/F8J2_20                                     62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190853.1|  vacuolar-sorting receptor 1                         62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK00302.1|  predicted protein                                    62.0    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230        62.0    3e-08   Amborella trichopoda
dbj|BAK03786.1|  predicted protein                                    62.0    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663           62.0    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1           61.6    4e-08   Brassica rapa
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...  61.6    4e-08   
gb|EMT19677.1|  Vacuolar-sorting receptor 1                           61.6    4e-08   
emb|CDX73599.1|  BnaC08g24040D                                        61.2    5e-08   
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein             61.2    5e-08   Gossypium arboreum [tree cotton]
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  60.8    6e-08   Brassica rapa
gb|KJB79450.1|  hypothetical protein B456_013G050300                  60.8    6e-08   Gossypium raimondii
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg           60.8    6e-08   Eutrema salsugineum [saltwater cress]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like      60.8    7e-08   Sesamum indicum [beniseed]
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg           60.5    9e-08   
emb|CDX67539.1|  BnaA07g15790D                                        60.5    9e-08   
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...  57.8    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like      60.5    9e-08   
emb|CDY13344.1|  BnaC06g14130D                                        60.5    1e-07   Brassica napus [oilseed rape]
ref|XP_002527509.1|  zinc finger protein, putative                    60.5    1e-07   Ricinus communis
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like      60.5    1e-07   Brassica rapa
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788            57.0    1e-07   
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like      59.7    2e-07   Eucalyptus grandis [rose gum]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1           59.7    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like      58.9    3e-07   Oryza brachyantha
ref|XP_003623631.1|  Vacuolar sorting receptor                        58.9    3e-07   Medicago truncatula
ref|NP_001050034.1|  Os03g0335300                                     58.9    3e-07   
dbj|BAK05589.1|  predicted protein                                    58.5    4e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like      58.2    6e-07   Solanum tuberosum [potatoes]
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80           58.2    6e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3           57.8    6e-07   Solanum lycopersicum
gb|EEC82690.1|  hypothetical protein OsI_27347                        57.8    7e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAB64531.1|  vacuolar sorting receptor                            57.8    7e-07   Vigna mungo [urad dal]
ref|NP_001060643.1|  Os07g0680000                                     57.8    7e-07   
gb|KJB32253.1|  hypothetical protein B456_005G231800                  57.4    7e-07   Gossypium raimondii
gb|EMT18407.1|  Vacuolar-sorting receptor 1                           57.4    8e-07   
emb|CDX91478.1|  BnaC04g06720D                                        57.4    8e-07   
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like      57.4    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like      57.0    1e-06   Brassica rapa
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like      54.7    1e-06   
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849            57.0    1e-06   
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849            54.3    1e-06   
gb|KJB32252.1|  hypothetical protein B456_005G231800                  56.6    1e-06   Gossypium raimondii
gb|EMS51356.1|  Vacuolar-sorting receptor 1                           56.6    2e-06   Triticum urartu
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like      56.6    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  56.6    2e-06   Glycine max [soybeans]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like      56.6    2e-06   Glycine max [soybeans]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                           56.6    2e-06   Glycine soja [wild soybean]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...  56.6    2e-06   Cucumis melo [Oriental melon]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...  56.6    2e-06   Cucumis melo [Oriental melon]
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2           56.2    2e-06   
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like      56.2    2e-06   Glycine max [soybeans]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                           56.2    2e-06   Glycine soja [wild soybean]
gb|KJB32254.1|  hypothetical protein B456_005G231800                  56.2    2e-06   Gossypium raimondii
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like      56.2    2e-06   Nicotiana tomentosiformis
gb|KDP44487.1|  hypothetical protein JCGZ_16320                       56.2    2e-06   Jatropha curcas
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like      56.2    2e-06   Nicotiana sylvestris
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g           55.8    2e-06   Phaseolus vulgaris [French bean]
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1           55.8    3e-06   
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849            55.5    3e-06   
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like      55.8    3e-06   Cicer arietinum [garbanzo]
emb|CDY60753.1|  BnaA05g34780D                                        55.8    3e-06   Brassica napus [oilseed rape]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1           55.8    3e-06   Theobroma cacao [chocolate]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like      55.5    4e-06   Brassica rapa
emb|CDY37219.1|  BnaA09g08400D                                        55.5    4e-06   Brassica napus [oilseed rape]
emb|CDX81459.1|  BnaC09g08700D                                        55.5    4e-06   
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170        55.1    4e-06   Sorghum bicolor [broomcorn]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like      55.1    5e-06   Sesamum indicum [beniseed]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                           55.1    5e-06   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...  55.1    5e-06   Glycine max [soybeans]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like      55.1    5e-06   Oryza brachyantha
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like      55.1    5e-06   Oryza brachyantha
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like      54.7    5e-06   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  54.7    6e-06   Setaria italica
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg           54.7    7e-06   Eutrema salsugineum [saltwater cress]
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  54.7    7e-06   
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g           54.7    7e-06   Phaseolus vulgaris [French bean]
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  54.3    8e-06   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  54.3    9e-06   
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80          54.3    9e-06   Populus trichocarpa [western balsam poplar]
gb|AGV54776.1|  vacuolar-sorting receptor                             54.3    1e-05   Phaseolus vulgaris [French bean]
gb|EPS57970.1|  hypothetical protein M569_16845                       54.3    1e-05   Genlisea aurea
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like      53.9    1e-05   
ref|XP_003603017.1|  Vacuolar sorting receptor                        50.4    1e-05   
emb|CDO97275.1|  unnamed protein product                              53.9    1e-05   Coffea canephora [robusta coffee]
gb|AES73268.2|  vacuolar sorting receptor protein, putative           50.1    1e-05   Medicago truncatula
gb|KJB38063.1|  hypothetical protein B456_006G235500                  53.5    1e-05   Gossypium raimondii
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                53.5    1e-05   Medicago truncatula
gb|KJB12290.1|  hypothetical protein B456_002G010300                  53.5    2e-05   Gossypium raimondii
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3           53.5    2e-05   Populus euphratica
gb|AES62774.2|  vacuolar-sorting receptor-like protein                53.5    2e-05   Medicago truncatula
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like      53.5    2e-05   
ref|XP_003610620.1|  Vacuolar-sorting receptor                        53.5    2e-05   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like      53.5    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like      53.5    2e-05   
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like      53.5    2e-05   
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926           53.1    2e-05   
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like      53.1    2e-05   Cicer arietinum [garbanzo]
ref|NP_001169232.1|  hypothetical protein precursor                   53.1    2e-05   Zea mays [maize]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577           53.1    2e-05   Selaginella moellendorffii
gb|KJB12295.1|  hypothetical protein B456_002G010300                  53.1    2e-05   Gossypium raimondii
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like      53.1    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3           53.1    2e-05   Tarenaya hassleriana [spider flower]
gb|AEW09228.1|  hypothetical protein UMN_755_01                       49.3    2e-05   Pinus radiata
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like      52.8    3e-05   Oryza brachyantha
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220        52.8    3e-05   
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like      52.8    3e-05   Populus euphratica
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                   50.4    3e-05   Ziziphus jujuba [Chinese jujube]
gb|KJB12292.1|  hypothetical protein B456_002G010300                  52.4    4e-05   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                  52.4    4e-05   Gossypium raimondii
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like      52.4    4e-05   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI32834.3|  unnamed protein product                              50.1    4e-05   Vitis vinifera
ref|XP_003592523.1|  Vacuolar-sorting receptor                        52.4    4e-05   
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g           52.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg           52.0    5e-05   Eutrema salsugineum [saltwater cress]
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...  52.0    5e-05   Pisum sativum [garden pea]
gb|KJB12294.1|  hypothetical protein B456_002G010300                  52.0    5e-05   Gossypium raimondii
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010        52.0    6e-05   Sorghum bicolor [broomcorn]
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  51.6    6e-05   Cicer arietinum [garbanzo]
emb|CDX93144.1|  BnaA03g38660D                                        51.6    7e-05   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       47.8    7e-05   Pinus taeda
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                  51.6    7e-05   Arabis alpina [alpine rockcress]
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        48.5    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691           51.2    8e-05   
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3           51.2    8e-05   Camelina sativa [gold-of-pleasure]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                  51.2    8e-05   Arabis alpina [alpine rockcress]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like      51.2    8e-05   Camelina sativa [gold-of-pleasure]
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg              51.2    9e-05   Erythranthe guttata [common monkey flower]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  51.2    9e-05   
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4           51.2    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like      51.2    9e-05   Camelina sativa [gold-of-pleasure]
ref|NP_179079.1|  vacuolar-sorting receptor 4                         51.2    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3           51.2    9e-05   Brassica rapa
emb|CDY65441.1|  BnaCnng47180D                                        51.2    9e-05   Brassica napus [oilseed rape]
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3           51.2    1e-04   Prunus mume [ume]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg           51.2    1e-04   Prunus persica
ref|NP_179081.1|  vacuolar-sorting receptor 3                         50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg           50.8    1e-04   Capsella rubella
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like      50.8    1e-04   Sesamum indicum [beniseed]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg           50.8    1e-04   
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like      50.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002885935.1|  VSR-2                                            50.8    1e-04   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462           50.4    1e-04   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218           50.4    1e-04   
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like      50.4    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like      50.4    2e-04   Cucumis melo [Oriental melon]
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  50.4    2e-04   
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like      50.4    2e-04   Cucumis sativus [cucumbers]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                 49.7    2e-04   Citrus sinensis [apfelsine]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3           49.7    3e-04   Fragaria vesca subsp. vesca
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like      49.7    3e-04   Nelumbo nucifera [Indian lotus]
gb|EMT28756.1|  hypothetical protein F775_27608                       47.4    3e-04   
gb|KHN42313.1|  Vacuolar-sorting receptor 1                           49.3    4e-04   Glycine soja [wild soybean]
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                   49.3    4e-04   Eucalyptus grandis [rose gum]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like      48.9    4e-04   Eucalyptus grandis [rose gum]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                      48.9    4e-04   Morus notabilis
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                 48.9    5e-04   Citrus sinensis [apfelsine]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  48.9    5e-04   Glycine max [soybeans]
gb|ABR17683.1|  unknown                                               48.9    5e-04   Picea sitchensis
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like      48.9    5e-04   Elaeis guineensis
gb|KHN06808.1|  Vacuolar-sorting receptor 1                           48.9    5e-04   Glycine soja [wild soybean]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                 48.9    5e-04   Citrus sinensis [apfelsine]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg           48.9    5e-04   Citrus clementina [clementine]
gb|EMS62484.1|  Vacuolar-sorting receptor 1                           48.9    5e-04   Triticum urartu
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                 48.9    5e-04   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like      48.9    5e-04   Citrus sinensis [apfelsine]
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like      48.5    7e-04   
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  48.5    7e-04   Glycine max [soybeans]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g           48.1    8e-04   Phaseolus vulgaris [French bean]
gb|EEC66779.1|  hypothetical protein OsI_33169                        47.4    9e-04   Oryza sativa Indica Group [Indian rice]
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                 48.1    0.001   Zea mays [maize]



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +WFLLCGSC GRFVVEKNSLKVTSP+S+  +YECAIGNFG+P
Sbjct  10   FVWFLLCGSCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVP  52



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+ D+YECAIGNFG+P
Sbjct  7    LLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVP  52



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SI ++YECAIGNFG+P
Sbjct  5    FLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVP  50



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+ D+YECAIGNFG+P
Sbjct  7    LLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVP  52



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFL+ GSC GRFVVEKNSL+VTSPESI D+YECAIGNFG+P
Sbjct  7    FLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVP  52



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFL+ GSC GRFVVEKNSL+VTSPESI D+YECAIGNFG+P
Sbjct  7    FLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVP  52



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SI ++YECAIGNFG+P
Sbjct  5    FLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVP  50



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WF++ GSCLGRFVVEKNSL+VTSP+SI D+YECAIGNFG+P
Sbjct  7    FLVCV-WFIVIGSCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVP  52



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WFLLCG C+GRFVVEKNSLKVTSP S+ ++YECAIGNFG+P
Sbjct  11   VWFLLCGFCVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVP  52



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WFLLCG C+GRFVVEKNSLKVTSP S+  LYECAIGNFG+P
Sbjct  11   VWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVP  52



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WFLLCG C+GRFVVEKNSLKVTSP S+  LYECAIGNFG+P
Sbjct  11   VWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVP  52



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SI ++YECAIGNFG+P
Sbjct  7    FLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVP  52



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFLLCG C GRFVVEKNSLK+TSPES+  +YECAIGNFG+P
Sbjct  7    FLVCV-WFLLCGFCFGRFVVEKNSLKLTSPESLKGVYECAIGNFGVP  52



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SI ++YECAIGNFG+P
Sbjct  7    FLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVP  52



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WFLLCG C+GRFVVEKNSLKVTSP S+  +YECAIGNFG+P
Sbjct  11   VWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVP  52



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WFLLCG C+GRFVVEKNSLKVTSP S+  +YECAIGNFG+P
Sbjct  11   VWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVP  52



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LW LLCGSC+GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  13   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVP  54



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LW LLCGSC+GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  11   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVP  52



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+L  +LCGSCLGRFVVEKNSL+VTSP SI D+YECAIGNFG+P
Sbjct  7    FLVCILC-VLCGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVP  52



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESI  +YECAIGNFG+P
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVP  52



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESI  +YECAIGNFG+P
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVP  52



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +WF+L  SCLGRFVVEKNSLKVTSP+S+ D+YECAIGNFG+P
Sbjct  11   VWFVLVVSCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVP  52



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +3

Query  318  LIVCLLWFL-LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+V LLWFL L GSC GRFVVEKNSLK+TSP+S+  +YECAIGNFG+P
Sbjct  9    LVVYLLWFLFLLGSCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVP  56



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESI  +YECAIGNFG+P
Sbjct  7    FLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVP  52



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W LLCG CLGRFVVEKNSLK+TSP+S+  +YECAIGNFG+P
Sbjct  11   VWLLLCGFCLGRFVVEKNSLKLTSPDSLKGVYECAIGNFGVP  52



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W LLCGSC+GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  13   VWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVP  54



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESI  +YECAIGNFG+P
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVP  52



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+L F++CG C+GRFVVEKNSL+VTSP+SI ++YECAIGNFG+P
Sbjct  5    FLVCIL-FVMCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVP  50



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESI  +YECAIGNFG+P
Sbjct  7    FLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVP  52



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W  LCGSC+GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  13   VWIFLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVP  54



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +3

Query  330  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +W L LCGSCLGRFVVEKNSL+VTSP+S+  +YECAIGNFG+P
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVP  51



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W  LCGSC+GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  11   VWIYLCGSCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVP  52



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +3

Query  330  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +W L LCGSCLGRFVVEKNSL+VTSP+S+  +YECAIGNFG+P
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVP  51



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W LLCG C GRFVVEKN+LK+TSP+S+  +YECAIGNFG+P
Sbjct  11   VWLLLCGFCFGRFVVEKNNLKLTSPDSLKGVYECAIGNFGVP  52



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+L  +L GSCLGRFVVEKNSL+VTSP SI D+YECAIGNFG+P
Sbjct  7    FLVCILC-VLSGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVP  52



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W LLCGSC+G FVVEKN+LK+TSP S+  +YECAIGNFG+P
Sbjct  14   VWILLCGSCVGTFVVEKNNLKITSPNSLKGIYECAIGNFGVP  55



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +LCGSCLGRFVVEKNSL+VTSP+S+  ++ECAIGNFG+P
Sbjct  13   LMLCGSCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVP  52



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+   YECAIGNFG+P
Sbjct  7    FLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVP  52



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+   YECAIGNFG+P
Sbjct  7    FLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVP  52



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SI  +YECAIGNFG+P
Sbjct  9    LFVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVP  52



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +++C+ W +L G+CLGRFVVE+NSLKVTSP SI  +YECAIGNFG+P
Sbjct  7    VLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVP  52



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +++C+ W +L G+CLGRFVVE+NSLKVTSP SI  +YECAIGNFG+P
Sbjct  7    VLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVP  52



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +++C+ W +L G+CLGRFVVE+NSLKVTSP SI  +YECAIGNFG+P
Sbjct  7    VLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVP  52



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +++C+ W +L G+CLGRFVVE+NSLKVTSP SI  +YECAIGNFG+P
Sbjct  7    VLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVP  52



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +3

Query  330  LLW------FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +LW      FLL GSC GRFVVEKNSLKVTSP+S+  +YECAIGNFG+P
Sbjct  5    MLWISVWVLFLLWGSCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVP  53



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L VC   FLLC SC GRFVVEKNSLKVT P+SI  +YECAIGNFG+P
Sbjct  9    LSVC---FLLCVSCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVP  52



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ WFLLC  C+GRFVVEKN LKVTSP S+   YECAIGNFG+P
Sbjct  7    FLVCV-WFLLCRVCVGRFVVEKNRLKVTSPSSMKGDYECAIGNFGVP  52



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLLCG   GRFVVEKNSLKVTSPE I  +YECAIGNFG+P
Sbjct  13   FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVP  52



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 2/43 (5%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +LWF   GSC GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  16   MLWF--TGSCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVP  56



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SI  +YECAIGNFG+P
Sbjct  9    LFVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVP  52



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SI  +YECAIGNFG+P
Sbjct  9    LYVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVP  52



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLLCG   GRFVVEKNSLKVTSPE I  +YECAIGNFG+P
Sbjct  13   FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVP  52



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLLCG   GRFVVEKNSLKVTSPE I  +YECAIGNFG+P
Sbjct  13   FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVP  52



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLLCG   GRFVVEKNSLKVTSPE I  +YECAIGNFG+P
Sbjct  13   FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVP  52



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 5/47 (11%)
 Frame = +3

Query  333  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LWF      L GS LGRFVVEKNSLKVTSPES+  +YECAIGNFG+P
Sbjct  5    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVP  51



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 5/48 (10%)
 Frame = +3

Query  330  LLWFL-----LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +LW L     LCG+C GRFVVEKNSLKVTSP S+  +YE AIGNFG+P
Sbjct  5    MLWLLVPVLFLCGTCWGRFVVEKNSLKVTSPNSLKGIYESAIGNFGVP  52



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ W L+ G   GRFVVEKNSL+VTSP+SI D+YECAIGNFG+P
Sbjct  7    FLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVP  52



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +3

Query  318  LIVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+   +W L   GSCLGRFVVEKNSLKVTSPE +  +YECAIGNFG+P
Sbjct  5    LLPIFIWALFFWGSCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVP  52



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             +VC+ W L+ G   GRFVVEKNSL+VTSP+SI D+YECAIGNFG+P
Sbjct  7    FLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVP  52



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 5/47 (11%)
 Frame = +3

Query  333  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LWF      L GS LGRFVVEKNSLKVTSPES+  +YECAIGNFG+P
Sbjct  9    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVP  55



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  336  WFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            W +  GSC+G FVVEKNSL+VTSPESI  +YECA+GNFG+P
Sbjct  39   WVMWWGSCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVP  79



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  333  LWFL-LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W L L GS LGRFVVEKNSLKVTSPES+  +YECAIGNFG+P
Sbjct  9    VWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVP  51



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V ++W +   SC GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LVVIVWVMGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  53



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  342  LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LL GSC G+FVVEKNSLKVTSP+S+  +YECAIGNFG+P
Sbjct  16   LLWGSCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVP  54



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLL  SC GRFVVEKNSLKV SP+S+  L+ECAIGNFG+P
Sbjct  13   FLLLASCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVP  52



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V ++W ++   SC+GRFVVEKN+L+VTSPESI  +YECA+GNFGIP
Sbjct  6    LVVIVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIP  52



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            SC+GRFVVEKNSL+VTSPESI  +YECA+GNFG+P
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVP  63



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  54



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  54



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  54



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+ G+ LGRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVP  52



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+ G+ LGRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVP  52



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CGSC GRFVVEKNSLKVTSP  +   YECAIGNFG+P
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVP  58



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CGSC GRFVVEKNSLKVTSP  +   YECAIGNFG+P
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVP  58



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CGSC GRFVVEKNSLKVTSP  +   YECAIGNFG+P
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVP  58



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CGSC GRFVVEKNSLKVTSP  +   YECAIGNFG+P
Sbjct  124  CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVP  160



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CGSC GRFVVEKNSLKVTSP  +   YECAIGNFG+P
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVP  58



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            CLGRFVVEKN+LKVTSPES+  +YECAIGNFG+P
Sbjct  22   CLGRFVVEKNNLKVTSPESVRGVYECAIGNFGVP  55



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +  L + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  5    LFTLSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  50



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             ++  L  ++   CLGRFVVEKNSLKVTSP S+  +YECAIGNFG+P
Sbjct  10   FVIVSLLMMMISLCLGRFVVEKNSLKVTSPSSLRGVYECAIGNFGVP  56



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 5/47 (11%)
 Frame = +3

Query  333  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LWF      L GS  GRFVVEKNSLKVTSPES+   +ECAIGNFG+P
Sbjct  5    LWFSVWVLFLWGSSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVP  51



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++VC+L F+   SC+ GRFVVEKNSLKVTSP  +  +YECAIGNFG+P
Sbjct  7    ILVCVLVFVSWSSCVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVP  54



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LLW   CG C  RFVVEKNSL+VT+PE++   YECAIGNFG+P
Sbjct  18   LLW---CGGCDARFVVEKNSLRVTAPEALKGAYECAIGNFGVP  57



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +3

Query  330  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+W  LL G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  13   LVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVP  56



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+VC    LL G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  12   LLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVP  56



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  318  LIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++  L+W  LL G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  9    MLQLLVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVP  56



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LLW  L   C+GRFVVEKNSL+VTSPE I   Y+ AIGNFGIP
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIP  56



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+VC    LL G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  12   LLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVP  56



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+V  L  +  G C GRFVVEKN+L+VTSPE+I  +YECA+GNFG+P
Sbjct  9    LVVMGLVMVWLGPCTGRFVVEKNNLRVTSPEAIRGVYECALGNFGVP  55



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  336  WFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + L+ G  +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  13   FLLILGLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            I  L + L+    LGRFVVEKN+LKVTSPESI  +YECAIGNFG+P
Sbjct  8    IFTLSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVP  53



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    LGRFVVEKN+LKVTSPESI  +YECAIGNFG+P
Sbjct  11   LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVP  53



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  342  LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LL G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  21   LLLGCCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVP  59



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    LGRFVVEKN+LKVTSPESI  +YECAIGNFG+P
Sbjct  11   LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVP  53



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V ++W  +   SC GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  54



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V ++W  +   SC GRFVVEKN+L+VTSPESI  +YECA+GNFG+P
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVP  54



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  LWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +W +LCGSC+GRFVVEK+SLKV++P+S+   YE ++GNFG+P
Sbjct  14   VWCVLCGSCVGRFVVEKSSLKVSAPKSLKGSYESSMGNFGVP  55



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+ C+ WF + G+C GRFVVEKN L VTSP S+  +YE AIGNFG+P
Sbjct  1    LLTCV-WFAVFGACFGRFVVEKNRLTVTSPGSLSGVYETAIGNFGVP  46



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  324  VCLLWFLLCGS-CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            V + W ++ G  C GRFVVEKN+L+VTSPESI  +YECAIGNFG+P
Sbjct  9    VMMSWVMVMGWWCEGRFVVEKNNLRVTSPESIRGIYECAIGNFGVP  54



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = +3

Query  333  LWFLLCGS----CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             W ++ GS    C  RFVVEKN+LKVTSPES+  LYECAIGNFG+P
Sbjct  4    FWAIIFGSSSRSCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVP  49



>ref|XP_004173121.1| PREDICTED: vacuolar-sorting receptor 3-like, partial [Cucumis 
sativus]
Length=517

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LLW  L   C+GRFVVEKNSL+VTSPE I   Y+ AIGNFGIP
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIP  56



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    LGRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + ++    LGRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LFFLVILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVP  55



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  8    LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  50



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  8    LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  50



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  8    LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  50



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LLW   CG C  RFVVEKNSL+VT+P ++   YECAIGNFG+P
Sbjct  35   LLW---CGGCDARFVVEKNSLRVTAPVALKGAYECAIGNFGVP  74



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  318  LIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+  L+W  L+     GRFVVEKNSL+VTSP+S+ D YECAIGNFG+P
Sbjct  4    LLCLLVWASLIWVPVYGRFVVEKNSLRVTSPDSLKDTYECAIGNFGVP  51



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  345  LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             C  C GRFVVEKNSLKVT+P+S+   YECAIGNFG+P
Sbjct  90   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVP  127



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  8    LSFLLILNLSMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  50



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  336  WFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  13   FLLILSVAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G C GRFVVEKNSLKVT+P+ +   YECAIGNFG+P
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVP  55



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  345  LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             C  C GRFVVEKNSLKVT+P+S+   YECAIGNFG+P
Sbjct  15   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVP  52



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  336  WFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + L+    +GRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  13   FLLILSLAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V   W LLC  C  GRFVVEKNSL VTSPE I   Y+ AIGNFGIP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIP  55



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            SC+GRFVVEKNSL+VTS E I  +YECA+GNFG+P
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVP  64



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  321  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +V   W LLC  C  GRFVVEKNSL VTSPE I   Y+ AIGNFGIP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIP  55



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ L + L+    LG+F+VEKN+LKVTSPE+I  +YECAIGNFGIP
Sbjct  7    VITLSFVLILQLALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIP  52



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  324  VCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +CL+       C GRFVVEKN+L+VTSP S+  +YECAIGNFG+P
Sbjct  15   ICLILLGSLPCCWGRFVVEKNNLRVTSPGSVRGIYECAIGNFGVP  59



>ref|XP_006403762.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45215.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=654

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    LGRFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    L RFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LSFLLISSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>pdb|4TJV|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vacuolar Sorting Receptor 1
 pdb|4TJX|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vsr1 In Complex With Aleurain Peptide
Length=165

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  3    RFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  33



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    L RFVVEKN+LKVTSPESI  +YECAIGNFG+P
Sbjct  11   LSFLLILNLALCRFVVEKNNLKVTSPESIKGVYECAIGNFGVP  53



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    L RFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 4/47 (9%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+ CL+      SC+GRFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  18   LVACLM----VSSCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  60



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L + L+    L RFVVEKN+LKVTSP+SI  +YECAIGNFG+P
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVP  53



>tpg|DAA39320.1| TPA: hypothetical protein ZEAMMB73_030788 [Zea mays]
Length=143

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+VC    LL G C GRFVV+KN+LKVT+P+ +   YECAIGNF +P
Sbjct  12   LLVCAT--LLLGCCHGRFVVDKNNLKVTAPDDLKGTYECAIGNFEVP  56



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G C GRFVV+KNSLKVTSP S+   +ECAIGNFG+P
Sbjct  23   GGCEGRFVVQKNSLKVTSPNSMKGAHECAIGNFGVP  58



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +3

Query  348  CGS-CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C S C GRFVVEKNSLKVT+P+++   YECAIGNFG+P
Sbjct  19   CASFCEGRFVVEKNSLKVTAPDALRGTYECAIGNFGVP  56



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+SI   YECAIGNFG+P
Sbjct  24   GRFVVEKNSLRVTSPDSIKGKYECAIGNFGVP  55



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C GRF+VEKNSL++TSP+S+   YECAIGNFG+P
Sbjct  20   CFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVP  53



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSPE I   YECAIGNFG+P
Sbjct  22   GRFVVEKNSLRVTSPEGIKGKYECAIGNFGVP  53



>dbj|BAK05589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=802

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP S+  +YECAIGNFG+P
Sbjct  198  GRFVVEKNSLRVTSPASLRGVYECAIGNFGMP  229



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             LW  L  S +GRFVVEKNSL+V SP+ I   Y+ AIGNFGIP
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIP  57



>gb|AAF80450.1|AF161719_1 vacuolar targeting receptor bp-80 [Triticum aestivum]
Length=624

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+   +  +  GRFVVEKNS++VTSPES+   YECAIGNFG+P
Sbjct  10   LVLLAMADAVAGRFVVEKNSVQVTSPESLKGKYECAIGNFGLP  52



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             LW  L  S +GRFVVEKNSL+V SP+ I   Y+ AIGNFGIP
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIP  57



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  345  LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + G   GRFVVEKNSL+VTSP  +  +YECAIGNFG+P
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMP  53



>dbj|BAB64531.1| vacuolar sorting receptor [Vigna mungo]
Length=619

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G  +GRFVVEKNSL+VT+P S+   YECAIGNFG+P
Sbjct  17   GCTVGRFVVEKNSLRVTAPSSLKGTYECAIGNFGVP  52



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  345  LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + G   GRFVVEKNSL+VTSP  +  +YECAIGNFG+P
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMP  53



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G+C  RFVVEKNSL++TSPE I   Y+ AIGNFGIP
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIP  57



>gb|EMT18407.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=596

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSPES+   YECAIGNFG+P
Sbjct  7    GRFVVEKNSVQVTSPESLKGKYECAIGNFGLP  38



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ L + L+     G F+VEKN+LKVTSP+SI  +YECAIGNFGIP
Sbjct  5    VLALSFILILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIP  50



>ref|XP_010233902.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=646

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LIV L+  ++  S   RFVVEKNSL+VTSP ++  +YECAIGNFG+P
Sbjct  27   LIVALV--MMAESAAARFVVEKNSLRVTSPAALRGVYECAIGNFGMP  71



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++ L + L+     G F+VEKN+LKVTSP+SI  +YECAIGNFGIP
Sbjct  5    VLTLSFVLILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIP  50



>ref|XP_010039169.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
Length=195

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +I   +W +   SC GRF V KNSL+VTSPES+   Y+ +IG+FG+P
Sbjct  6    MISVWVWCIFFESCSGRFTVAKNSLEVTSPESMKGFYDSSIGSFGVP  52



>tpg|DAA45229.1| TPA: hypothetical protein ZEAMMB73_518849, partial [Zea mays]
Length=606

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  193  GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  224



>tpg|DAA45231.1| TPA: hypothetical protein ZEAMMB73_518849 [Zea mays]
Length=173

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  55



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G+C  RFVVEKNSL++TSPE I   Y+ AIGNFGIP
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIP  57



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP ++  +YECAIGNFG+P
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMP  67



>ref|XP_010228654.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=627

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSPE +   YECAIGNFG+P
Sbjct  21   GRFVVEKNSVRVTSPEGLKGKYECAIGNFGVP  52



>ref|XP_003534638.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
 gb|KHN29499.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=619

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKNSLKVTSP+S+   YECAIGNFG+P
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVP  53



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKNSLKVTSP+S+   YECAIGNFG+P
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVP  53



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKNSLKVTSP+S+   YECAIGNFG+P
Sbjct  22   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVP  52



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C+ RFVVEKNSL+VTSPE I   Y+ AIGNFGIP
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIP  56



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C+ RFVVEKNSL+VTSPE I   Y+ AIGNFGIP
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIP  56



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+V  +   + G+C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIP  53



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +3

Query  333  LWF----LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LWF    L+  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  55



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +3

Query  333  LWF----LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LWF    L+  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  55



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  351  GSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G+C  RFVVEKNSL++TSPE I   Y+ AIGNFGIP
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIP  57



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  330  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             LW  LL  S +GRFVVEKNSL+V SP+ I   Y+ AIGNFGIP
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIP  58



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LL +L+    + RFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  15   LLMYLMVTGSVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  57



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  330  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             LW  LL  S +GRFVVEKNSL+V SP+ I   Y+ AIGNFGIP
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIP  58



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +GRFVVEKNSL+VT+P S+   YECAIGNFG+P
Sbjct  20   VGRFVVEKNSLRVTAPTSLKGTYECAIGNFGVP  52



>ref|XP_008660179.1| PREDICTED: vacuolar-sorting receptor 1 [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+ +   YECAIGNFG+P
Sbjct  24   GRFVVEKNSLEVTSPDELKGKYECAIGNFGVP  55



>tpg|DAA45230.1| TPA: hypothetical protein ZEAMMB73_518849, partial [Zea mays]
Length=378

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  193  GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  224



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRF+VEKNSLK+TSP+S+   YECAIGNFG+P
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVP  52



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             G F+VEKN+LKVTSP+SI  +YECAIGNFGIP
Sbjct  18   FGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIP  50



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+V  +   + G+C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIP  53



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  330  LLWFLLCGS----CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             L FLL  S    C  RFVVEKNSL VTSP+SI   ++CAIGNFGIP
Sbjct  5    FLCFLLLLSIPFLCESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIP  51



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  330  LLWFLLCGS----CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             L FLL  S    C  RFVVEKNSL VTSP+SI   ++CAIGNFGIP
Sbjct  5    FLCFLLLLSIPFLCESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIP  51



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  330  LLWFLLCGS----CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             L FLL  S    C  RFVVEKNSL VTSP+SI   ++CAIGNFGIP
Sbjct  5    FLCFLLLLSIPFLCESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIP  51



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  55



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  333  LWFLL-CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             W L+   + +GRFVVEKNSL+VTSPESI   ++ AIGNFGIP
Sbjct  15   FWVLIFTQAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIP  57



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  70



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  70



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  345  LCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + G   GRFV EKNSL+VTSP  +  +YECAIGNFG+P
Sbjct  20   MAGEAAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMP  57



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +C G FVVEKNSL+VT+P  +   YECAIGNFG+P
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVP  85



>ref|XP_008655380.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=444

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  55



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  54



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            SC  RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  53



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  54



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+   +  +L  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  53



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  54



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNS++VTSP+ +   YECAIGNFG+P
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVP  54



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  342  LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+  S + RFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  19   LIVPSSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  57



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+   +  +L  S +GRFVVEKNSL+VTSPE I   ++ AIGNFGIP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIP  53



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSPESI   ++ AIGNFGIP
Sbjct  1    GRFVVEKNSLRVTSPESIKGTHDSAIGNFGIP  32



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL+VTSP ++  +YECAIGNFG+P
Sbjct  32   ARFVVEKNSLRVTSPAALRGVYECAIGNFGMP  63



>ref|XP_003603017.1| Vacuolar sorting receptor [Medicago truncatula]
Length=98

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + +FVVEKN+L+VTSP+SI   Y+  IGNFGIP
Sbjct  1    MAKFVVEKNNLRVTSPDSIKGTYDSTIGNFGIP  33



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +GRFVVEKNSL+VTSP+SI   ++ AIGNFGIP
Sbjct  25   MGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIP  57



>gb|AES73268.2| vacuolar sorting receptor protein, putative [Medicago truncatula]
Length=80

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + +FVVEKN+L+VTSP+SI   Y+  IGNFGIP
Sbjct  1    MAKFVVEKNNLRVTSPDSIKGTYDSTIGNFGIP  33



>gb|KJB38063.1| hypothetical protein B456_006G235500 [Gossypium raimondii]
Length=510

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +3

Query  330  LLW--FLLCGSCLGRFVVEKNSLKVTS-PESIXDLYECAIGNFGIP  458
            L+W   LL G+CLG FVVEKNSLKVTS  +SI  +Y+ +IG+FG+P
Sbjct  8    LIWVCMLLWGNCLGSFVVEKNSLKVTSWAKSIVGVYDSSIGSFGVP  53



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            S + +FVVEKNSL+VTSP+SI   Y+ AIGNFGIP
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIP  57



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LL F+   +C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIP  56



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  342  LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+  S + RFVVEKNSL++TSP+ I   Y+ AIGNFGIP
Sbjct  19   LIVPSSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIP  57



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            S + +FVVEKNSL+VTSP+SI   Y+ AIGNFGIP
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIP  57



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIP  55



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  321  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +  L+ F+L G    RFVVEKNSL VTSP+ I   ++ AIGNFGIP
Sbjct  9    VFMLVGFMLTGMSTARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIP  54



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  55



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  55



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  55



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            SC G+F+VEKNS+ +T+P+SI   Y+ AIGNFG+P
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVP  56



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            S + +FVVEKNSL+VTSP+SI   Y+ AIGNFGIP
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIP  56



>ref|NP_001169232.1| hypothetical protein precursor [Zea mays]
 gb|ACN32039.1| unknown [Zea mays]
 gb|ACN34630.1| unknown [Zea mays]
 tpg|DAA64135.1| TPA: hypothetical protein ZEAMMB73_440222 [Zea mays]
Length=633

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKNSL+VTSP  +  +YECAIGNFG+P
Sbjct  27   RFVVEKNSLRVTSPAVLRGVYECAIGNFGMP  57



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            SC G+F+VEKNS+ +T+P+SI   Y+ AIGNFG+P
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVP  56



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIP  56



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C  RFVVEKNSL VTSPESI   ++ AIGNFG+P
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVP  62



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C  RFVVEKNSL VTSPESI   ++ AIGNFG+P
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVP  62



>gb|AEW09228.1| hypothetical protein UMN_755_01, partial [Pinus radiata]
 gb|AFG69845.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69846.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69847.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69848.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69849.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69850.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69851.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69852.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
 gb|AFG69853.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
Length=63

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            F +    + +FVVEKNSL+V SPE++   Y+ AIGNFG+P
Sbjct  18   FTVPMPAMSKFVVEKNSLRVISPENLKGNYDSAIGNFGVP  57



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C G F+VEKNSL+VT+P  +   YECAIGNFG+P
Sbjct  97   CHGGFLVEKNSLRVTAPSDLKGTYECAIGNFGVP  130



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL VTSP+SI  +++ AIGNFG+P
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVP  38



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  LLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            LL  L+    + RFVVEKNSL++TSP+ I   Y+ AIGNFGIP
Sbjct  15   LLISLIAPRSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIP  57



>gb|AIY30334.1| vacuolar-sorting receptor 3 protein, partial [Ziziphus jujuba]
Length=155

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  366  RFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            RFVVEKN+L+VTSPE I   ++ AIGNFGIP
Sbjct  29   RFVVEKNNLRVTSPEKIRGTHDSAIGNFGIP  59



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIP  56



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIP  56



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +3

Query  318  LIVCLLWFLL--CGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +I+ L +FLL    S   RFVVEKNSL+VTSP+ +   Y+ AIGNFGIP
Sbjct  14   VILLLGFFLLTWVSSIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIP  62



>emb|CBI32834.3| unnamed protein product [Vitis vinifera]
Length=166

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +3

Query  330  LLW--FLLCGSCLGR--FVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+W  F  C + LG   FVV KNSL+VT PES+ D YECA GNFGIP
Sbjct  25   LIWVGFFTCVTYLGSCGFVV-KNSLRVTYPESLKDAYECATGNFGIP  70



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            + +FVVEKNSL+VTSP+SI   Y+ AIGNFGIP
Sbjct  1    MAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIP  33



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  342  LLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            L+    + RFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  19   LIAPRSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  57



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  CLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            C  RFVVEKNSL VTSP+SI   ++ AIGNFGIP
Sbjct  25   CKARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIP  58



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  324  VCLLWFLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +  L F+L      RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  9    ILFLGFMLTSLSTARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIP  53



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  354  SCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +C  RFVVEKNSL VTSPE I   ++ AIGNFGIP
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIP  56



>ref|XP_002463394.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
 gb|EER99915.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
Length=636

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  369  FVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FVVEKNSL+VTSP ++  +YECAIGNFG+P
Sbjct  31   FVVEKNSLRVTSPAALRGVYECAIGNFGMP  60



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLL    + RFVVEKNSL VTSP+ I   ++ AIGNFGIP
Sbjct  14   FLLLTLSMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIP  53



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  28   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  59



>gb|AFG69854.1| hypothetical protein UMN_755_01, partial [Pinus taeda]
Length=63

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            F +    + +FV EKNSL+V SPE++   Y+ AIGNFG+P
Sbjct  18   FTVPMPAMSKFVAEKNSLRVISPENLKGNYDSAIGNFGVP  57



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  54



>gb|EAZ37923.1| hypothetical protein OsJ_22274 [Oryza sativa Japonica Group]
Length=115

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +GRFVVEK+S++V SPE I   ++ AIGNFG+P
Sbjct  32   MGRFVVEKSSVRVLSPEHIRGHHDAAIGNFGVP  64



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  54



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  53



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  54



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  53



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            GRFVVEKNSL+V SPESI   ++ AIGNFGIP
Sbjct  26   GRFVVEKNSLRVISPESIKGNHDSAIGNFGIP  57



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FLLCGSCLGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            FLL    + RFVVEKNSL VTSP+ I   ++ AIGNFGIP
Sbjct  14   FLLLTLSMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIP  53



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  53



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  56



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  55



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  58



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  58



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  56



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL+VTSP+ I   Y+ AIGNFGIP
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIP  56



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  55



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  56



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  360  LGRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            +GRFVVEKNSL+V SP+SI   ++ AIGNFGIP
Sbjct  25   VGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIP  57



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  125



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  53



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
             RFVVEKNSL VTSPESI   ++ AIGNFGIP
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIP  54



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G+F+VEKNSL VTSP+S+   Y+ AIGNFG+P
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVP  53



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  363  GRFVVEKNSLKVTSPESIXDLYECAIGNFGIP  458
            G+F+VEKNSL VTSP+S+   Y+ AIGNFG+P
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVP  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320