BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025P22

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               161   3e-43   Nicotiana sylvestris
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               155   3e-41   Nicotiana tomentosiformis
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               152   4e-40   Solanum tuberosum [potatoes]
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               149   7e-39   Prunus mume [ume]
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               148   2e-38   Solanum lycopersicum
dbj|BAC53892.1|  cytochrome P450                                        144   4e-37   Petunia x hybrida [garden petunia]
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               142   3e-36   Sesamum indicum [beniseed]
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               140   8e-36   Nicotiana sylvestris
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               139   3e-35   Nicotiana tomentosiformis
emb|CDP15344.1|  unnamed protein product                                134   9e-35   Coffea canephora [robusta coffee]
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               138   1e-34   Sesamum indicum [beniseed]
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               137   2e-34   Solanum tuberosum [potatoes]
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               136   3e-34   Nicotiana tomentosiformis
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    136   4e-34   Vitis vinifera
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    136   4e-34   Solanum melongena [aubergine]
emb|CAN77399.1|  hypothetical protein VITISV_015277                     135   8e-34   Vitis vinifera
emb|CBI30226.3|  unnamed protein product                                136   9e-34   Vitis vinifera
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               135   1e-33   Nicotiana sylvestris
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             134   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    134   2e-33   Nicotiana sylvestris
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    134   2e-33   Nicotiana sylvestris
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             134   3e-33   Citrus clementina [clementine]
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               134   3e-33   Populus euphratica
ref|XP_007027589.1|  Cytochrome P450 76A2                               133   5e-33   
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               131   2e-32   Fragaria vesca subsp. vesca
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               131   2e-32   
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   130   3e-32   Citrus sinensis [apfelsine]
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               130   6e-32   Eucalyptus grandis [rose gum]
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               129   6e-32   Solanum tuberosum [potatoes]
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             128   3e-31   
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               128   3e-31   
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               127   4e-31   Solanum lycopersicum
gb|KJB62266.1|  hypothetical protein B456_009G409000                    127   5e-31   Gossypium raimondii
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               127   6e-31   Solanum lycopersicum
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               127   7e-31   Solanum tuberosum [potatoes]
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               126   9e-31   Eucalyptus grandis [rose gum]
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               126   9e-31   Eucalyptus grandis [rose gum]
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               126   9e-31   Eucalyptus grandis [rose gum]
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               126   1e-30   
ref|XP_010112510.1|  Cytochrome P450 76A2                               125   2e-30   
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               125   3e-30   Prunus mume [ume]
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               125   3e-30   Fragaria vesca subsp. vesca
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               125   3e-30   Vitis vinifera
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               124   5e-30   
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                124   6e-30   Erythranthe guttata [common monkey flower]
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         124   6e-30   Jatropha curcas
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               123   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               123   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               123   2e-29   Cicer arietinum [garbanzo]
gb|AGT03776.1|  CYP76 hydroxylase                                       123   2e-29   Withania somnifera [ashwagandha]
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               122   2e-29   Eucalyptus grandis [rose gum]
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             122   4e-29   Paeonia lactiflora [common garden peony]
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               121   5e-29   Eucalyptus grandis [rose gum]
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     121   5e-29   Eucalyptus grandis [rose gum]
ref|XP_002528645.1|  cytochrome P450, putative                          121   8e-29   Ricinus communis
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               120   1e-28   Nicotiana tomentosiformis
gb|KEH24104.1|  cytochrome P450 family protein                          120   2e-28   Medicago truncatula
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     119   2e-28   Eucalyptus grandis [rose gum]
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               119   4e-28   Glycine max [soybeans]
gb|AJD25180.1|  cytochrome P450 CYP76A36                                117   1e-27   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               117   1e-27   Solanum tuberosum [potatoes]
gb|KHN18720.1|  Cytochrome P450 76A2                                    117   2e-27   Glycine soja [wild soybean]
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    117   3e-27   Vitis vinifera
gb|AHX24365.1|  CYP76A26-like protein                                   117   3e-27   Cinchona calisaya [quinine]
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               116   3e-27   Solanum tuberosum [potatoes]
emb|CBI30225.3|  unnamed protein product                                117   9e-27   Vitis vinifera
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     114   1e-26   Eucalyptus grandis [rose gum]
ref|XP_002528647.1|  cytochrome P450, putative                          114   3e-26   Ricinus communis
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               113   5e-26   Solanum lycopersicum
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                     111   1e-25   Eucalyptus grandis [rose gum]
gb|AHK60833.1|  iridoid oxidase                                         111   3e-25   Catharanthus roseus [chatas]
gb|AHX24370.1|  CYP76A26                                                111   3e-25   Catharanthus roseus [chatas]
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    111   4e-25   Solanum lycopersicum
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         110   7e-25   Jatropha curcas
gb|AHX24367.1|  CYP76A26-like protein                                   110   7e-25   Rauvolfia serpentina [devilpepper]
gb|KCW84357.1|  hypothetical protein EUGRSUZ_B012102                    105   8e-25   Eucalyptus grandis [rose gum]
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             109   2e-24   Phaseolus vulgaris [French bean]
emb|CBI30232.3|  unnamed protein product                                108   2e-24   Vitis vinifera
gb|AHX24366.1|  CYP76A26-like protein                                   109   2e-24   Amsonia hubrichtii
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             108   4e-24   Citrus clementina [clementine]
emb|CAN76784.1|  hypothetical protein VITISV_028823                     108   4e-24   Vitis vinifera
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    108   4e-24   Vitis vinifera
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   108   4e-24   Citrus sinensis [apfelsine]
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               108   4e-24   Citrus sinensis [apfelsine]
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    107   4e-24   Solanum melongena [aubergine]
emb|CBI30229.3|  unnamed protein product                                108   5e-24   Vitis vinifera
gb|AHX24368.1|  CYP76A26-like protein                                   107   6e-24   Tabernaemontana elegans
dbj|BAC53891.1|  cytochrome P450                                        107   7e-24   Petunia x hybrida [garden petunia]
gb|KCW84346.1|  hypothetical protein EUGRSUZ_B011962                    103   7e-24   Eucalyptus grandis [rose gum]
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               107   8e-24   Vitis vinifera
emb|CDP15345.1|  unnamed protein product                                106   1e-23   Coffea canephora [robusta coffee]
gb|AHX24369.1|  CYP76A26-like protein                                   106   2e-23   Vinca minor [common periwinkle]
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    106   2e-23   Vitis vinifera
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     106   2e-23   Eucalyptus grandis [rose gum]
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               106   2e-23   Podophyllum peltatum
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                     105   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               105   5e-23   
emb|CAN77400.1|  hypothetical protein VITISV_015278                     104   6e-23   Vitis vinifera
gb|KDP24879.1|  hypothetical protein JCGZ_25132                         100   7e-23   Jatropha curcas
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               104   8e-23   Nicotiana sylvestris
gb|KDP43102.1|  hypothetical protein JCGZ_27051                         104   9e-23   Jatropha curcas
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               103   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               103   1e-22   Eucalyptus grandis [rose gum]
gb|KDP20523.1|  hypothetical protein JCGZ_05069                         103   2e-22   Jatropha curcas
gb|AHX24364.1|  CYP76A26-like protein                                   103   2e-22   Lonicera japonica [Japanese honeysuckle]
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               102   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               102   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               101   1e-21   Eucalyptus grandis [rose gum]
ref|XP_002528653.1|  cytochrome P450, putative                          100   2e-21   Ricinus communis
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         100   4e-21   Jatropha curcas
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               100   4e-21   Sesamum indicum [beniseed]
ref|XP_006381328.1|  hypothetical protein POPTR_0006s11830g           98.2    4e-21   
ref|XP_002528650.1|  cytochrome P450, putative                        99.8    5e-21   
gb|KDP26150.1|  hypothetical protein JCGZ_22831                       95.1    7e-21   Jatropha curcas
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg           98.6    9e-21   
ref|XP_002528649.1|  cytochrome P450, putative                        99.0    1e-20   
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like             98.2    2e-20   Sesamum indicum [beniseed]
gb|KDP26153.1|  hypothetical protein JCGZ_22834                       97.8    2e-20   Jatropha curcas
ref|XP_002528654.1|  cytochrome P450, putative                        97.1    5e-20   
gb|AJD25179.1|  cytochrome P450 CYP76A35                              95.5    1e-19   Salvia miltiorrhiza [Chinese salvia]
gb|KDP27489.1|  hypothetical protein JCGZ_20024                       91.7    3e-18   Jatropha curcas
ref|XP_003600328.1|  Cytochrome P450                                  90.5    8e-18   Medicago truncatula
gb|ADD91442.1|  cytochrome P450                                       88.2    9e-18   Nicotiana tabacum [American tobacco]
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g           89.7    2e-17   
gb|EYU22208.1|  hypothetical protein MIMGU_mgv1a024264mg              89.0    2e-17   Erythranthe guttata [common monkey flower]
gb|KEH34024.1|  cytochrome P450 family 71 protein                     89.0    3e-17   Medicago truncatula
dbj|BAH84782.1|  cytochrome P450                                      88.2    6e-17   Nicotiana tabacum [American tobacco]
gb|KDP39088.1|  hypothetical protein JCGZ_00845                       87.8    6e-17   Jatropha curcas
ref|XP_004248583.1|  PREDICTED: premnaspirodiene oxygenase-like i...  87.8    7e-17   Solanum lycopersicum
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like            87.8    7e-17   Populus euphratica
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like       87.8    8e-17   Solanum tuberosum [potatoes]
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...  87.8    8e-17   Solanum lycopersicum
ref|XP_003630839.1|  Cytochrome P450                                  85.5    9e-17   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...  87.4    1e-16   Populus euphratica
ref|XP_006350771.1|  PREDICTED: cytochrome P450 71A9-like             87.4    1e-16   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like            87.0    1e-16   Populus euphratica
ref|XP_009620580.1|  PREDICTED: cytochrome P450 71A9-like             87.0    2e-16   Nicotiana tomentosiformis
ref|XP_006841384.1|  hypothetical protein AMTR_s00181p00056510        86.7    2e-16   Amborella trichopoda
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like             86.7    2e-16   Cicer arietinum [garbanzo]
ref|XP_003636948.1|  Cytochrome P450                                  84.7    3e-16   
ref|XP_002310007.2|  cytochrome P450 family protein                   85.5    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006854378.1|  hypothetical protein AMTR_s00039p00170480        85.1    6e-16   Amborella trichopoda
gb|KHG11226.1|  Cytochrome P450                                       85.1    6e-16   Gossypium arboreum [tree cotton]
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g           85.1    8e-16   
gb|EYU21984.1|  hypothetical protein MIMGU_mgv1a019764mg              82.4    9e-16   Erythranthe guttata [common monkey flower]
ref|XP_011047545.1|  PREDICTED: cytochrome P450 71D11-like isofor...  84.7    9e-16   Populus euphratica
gb|KJB27712.1|  hypothetical protein B456_005G005900                  84.7    9e-16   Gossypium raimondii
ref|XP_003600322.1|  Cytochrome P450                                  84.3    1e-15   Medicago truncatula
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like           84.3    1e-15   Vitis vinifera
ref|XP_010663828.1|  PREDICTED: cytochrome P450 71A9-like             84.3    1e-15   Vitis vinifera
gb|EYU24235.1|  hypothetical protein MIMGU_mgv1a005267mg              84.0    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like       84.0    2e-15   Solanum tuberosum [potatoes]
ref|XP_004236286.1|  PREDICTED: cytochrome P450 71A22-like            84.0    2e-15   
gb|AAS92624.1|  cytochrome P450                                       83.6    2e-15   Hypericum androsaemum
ref|XP_010102940.1|  Cytochrome P450 71A1                             84.0    2e-15   
ref|XP_009419066.1|  PREDICTED: premnaspirodiene oxygenase-like       83.6    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004241226.1|  PREDICTED: cytochrome P450 71A9-like             83.6    2e-15   Solanum lycopersicum
ref|XP_011072187.1|  PREDICTED: cytochrome P450 71A9-like             83.6    2e-15   
gb|KEH34017.1|  cytochrome P450 family 71 protein                     83.6    2e-15   Medicago truncatula
gb|AJD25161.1|  cytochrome P450 CYP71BE37                             83.6    2e-15   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg           81.6    3e-15   
dbj|BAK04621.1|  predicted protein                                    83.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008439074.1|  PREDICTED: cytochrome P450 71A1-like             83.2    3e-15   Cucumis melo [Oriental melon]
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g           83.2    3e-15   Phaseolus vulgaris [French bean]
ref|XP_006351420.1|  PREDICTED: cytochrome P450 71A22-like            83.2    3e-15   Solanum tuberosum [potatoes]
ref|XP_003600327.1|  Cytochrome P450                                  82.8    4e-15   Medicago truncatula
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like             82.8    4e-15   Eucalyptus grandis [rose gum]
emb|CDM87092.1|  unnamed protein product                              82.8    4e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003615665.1|  Cytochrome P450                                  82.8    4e-15   Medicago truncatula
ref|XP_007210185.1|  hypothetical protein PRUPE_ppa020002mg           82.8    4e-15   Prunus persica
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like             82.8    5e-15   Glycine max [soybeans]
gb|KHM99472.1|  Cytochrome P450 71D11                                 82.8    5e-15   Glycine soja [wild soybean]
sp|O04164.1|C71A6_NEPRA  RecName: Full=Cytochrome P450 71A6           82.8    5e-15   Nepeta racemosa
gb|KJB61440.1|  hypothetical protein B456_009G358600                  82.0    5e-15   Gossypium raimondii
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g           82.4    5e-15   
emb|CDP20259.1|  unnamed protein product                              82.4    5e-15   Coffea canephora [robusta coffee]
ref|XP_006841385.1|  hypothetical protein AMTR_s00181p00057690        82.4    6e-15   Amborella trichopoda
ref|XP_002466122.1|  hypothetical protein SORBIDRAFT_01g001820        82.4    6e-15   
ref|NP_001239692.1|  cytochrome P450 71A9 precursor                   82.0    7e-15   Glycine max [soybeans]
gb|ACU20174.1|  unknown                                               82.0    7e-15   Glycine max [soybeans]
ref|XP_007146615.1|  hypothetical protein PHAVU_006G0551000g          78.6    7e-15   Phaseolus vulgaris [French bean]
gb|ABC69415.1|  CYP71AH2                                              82.0    8e-15   Nicotiana tabacum [American tobacco]
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609  83.2    8e-15   Fragaria vesca subsp. vesca
ref|XP_010102944.1|  Psoralen synthase                                79.3    8e-15   
gb|KHG19246.1|  Cytochrome P450                                       82.0    8e-15   Gossypium arboreum [tree cotton]
gb|KJB61441.1|  hypothetical protein B456_009G358600                  82.0    8e-15   Gossypium raimondii
gb|KJB61438.1|  hypothetical protein B456_009G358400                  82.0    8e-15   Gossypium raimondii
ref|XP_007037775.1|  Cytochrome P450 71A1                             82.0    8e-15   
ref|XP_007048087.1|  Cytochrome P450                                  82.0    9e-15   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like             82.0    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_004304108.2|  PREDICTED: cytochrome P450 71D9-like             82.8    1e-14   Fragaria vesca subsp. vesca
gb|KHG17729.1|  Cytochrome P450                                       82.0    1e-14   Gossypium arboreum [tree cotton]
gb|KHG18333.1|  Cytochrome P450                                       82.0    1e-14   Gossypium arboreum [tree cotton]
gb|KEH34016.1|  cytochrome P450 family 71 protein                     81.3    1e-14   Medicago truncatula
ref|XP_010026997.1|  PREDICTED: cytochrome P450 71A9-like             81.6    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010093536.1|  Cytochrome P450 76C4                             81.3    1e-14   Morus notabilis
emb|CCO62222.1|  putative cytochrome P450 monooxygenase               81.6    1e-14   Actaea racemosa
ref|XP_007020550.1|  Cytochrome P450 71D10, putative                  80.9    1e-14   
gb|KHG02344.1|  Cytochrome P450                                       81.3    1e-14   Gossypium arboreum [tree cotton]
gb|AJD25151.1|  cytochrome P450 CYP71AH15                             81.3    1e-14   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg           81.3    1e-14   
ref|XP_010910705.1|  PREDICTED: cytochrome P450 71B9-like             77.4    1e-14   Elaeis guineensis
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like             81.3    1e-14   Cicer arietinum [garbanzo]
ref|XP_003559997.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...  81.6    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_007020549.1|  Cytochrome P450                                  81.3    1e-14   
gb|ABF70064.1|  cytochrome P450 family protein                        81.3    1e-14   Musa acuminata [banana]
ref|XP_009388203.1|  PREDICTED: premnaspirodiene oxygenase-like       81.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011005615.1|  PREDICTED: cytochrome P450 71A1-like             81.3    2e-14   Populus euphratica
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g           81.3    2e-14   
ref|XP_010910057.1|  PREDICTED: cytochrome P450 71A9-like             78.2    2e-14   Elaeis guineensis
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g           81.3    2e-14   Phaseolus vulgaris [French bean]
gb|KJB61456.1|  hypothetical protein B456_009G359000                  80.9    2e-14   Gossypium raimondii
gb|KJB61457.1|  hypothetical protein B456_009G359000                  80.9    2e-14   Gossypium raimondii
ref|XP_007210941.1|  hypothetical protein PRUPE_ppa024670mg           80.9    2e-14   Prunus persica
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like             80.9    2e-14   Populus euphratica
gb|KJB61458.1|  hypothetical protein B456_009G359100                  80.9    2e-14   Gossypium raimondii
gb|KHG28615.1|  Cytochrome P450                                       80.1    2e-14   Gossypium arboreum [tree cotton]
gb|KHG16719.1|  Cytochrome P450                                       80.5    2e-14   Gossypium arboreum [tree cotton]
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                80.5    2e-14   
gb|KCW80419.1|  hypothetical protein EUGRSUZ_C01775                   79.3    2e-14   Eucalyptus grandis [rose gum]
ref|XP_011034037.1|  PREDICTED: cytochrome P450 71B10-like            80.5    2e-14   Populus euphratica
gb|KEH34013.1|  cytochrome P450 family 71 protein                     80.5    3e-14   Medicago truncatula
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g           80.5    3e-14   
ref|XP_010102942.1|  Cytochrome P450 71A1                             78.6    3e-14   
ref|XP_007034575.1|  Cytochrome P450, putative                        80.5    3e-14   
ref|XP_006387000.1|  hypothetical protein POPTR_2285s00200g           77.8    3e-14   
gb|KCW83246.1|  hypothetical protein EUGRSUZ_B00186                   80.1    3e-14   Eucalyptus grandis [rose gum]
ref|XP_002321645.1|  hypothetical protein POPTR_0015s09760g           80.5    3e-14   Populus trichocarpa [western balsam poplar]
gb|EMT31346.1|  Cytochrome P450 71D7                                  80.5    3e-14   
gb|KJB51118.1|  hypothetical protein B456_008G202400                  80.5    3e-14   Gossypium raimondii
emb|CDP14652.1|  unnamed protein product                              80.1    3e-14   Coffea canephora [robusta coffee]
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                  80.1    4e-14   
gb|KJB19523.1|  hypothetical protein B456_003G107400                  80.1    4e-14   Gossypium raimondii
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like            80.1    4e-14   Sesamum indicum [beniseed]
ref|XP_003610580.1|  Cytochrome P450                                  80.1    4e-14   Medicago truncatula
ref|XP_010027022.1|  PREDICTED: cytochrome P450 71A9-like             80.1    4e-14   Eucalyptus grandis [rose gum]
ref|XP_004173362.1|  PREDICTED: cytochrome P450 71A2-like             77.4    4e-14   
sp|O48958.1|C71E1_SORBI  RecName: Full=4-hydroxyphenylacetaldehyd...  80.1    4e-14   Sorghum bicolor [broomcorn]
ref|XP_007027586.1|  Cytochrome P450                                  80.9    4e-14   
ref|XP_007048751.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...  80.1    4e-14   
ref|XP_004152574.1|  PREDICTED: cytochrome P450 71A1-like             79.7    4e-14   
ref|XP_008239596.1|  PREDICTED: cytochrome P450 71A9-like             80.1    4e-14   
ref|XP_008382575.1|  PREDICTED: cytochrome P450 71A3-like             79.7    4e-14   
gb|KCW80420.1|  hypothetical protein EUGRSUZ_C01775                   79.3    4e-14   Eucalyptus grandis [rose gum]
ref|XP_002463548.1|  hypothetical protein SORBIDRAFT_01g001780        79.7    4e-14   Sorghum bicolor [broomcorn]
ref|XP_003600316.1|  Cytochrome P450                                  77.4    5e-14   
gb|KEH15784.1|  cytochrome P450 family 71 protein                     79.7    5e-14   Medicago truncatula
gb|KEH31755.1|  cytochrome P450 family 71 protein                     79.7    5e-14   Medicago truncatula
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g           79.0    5e-14   Phaseolus vulgaris [French bean]
gb|ABF70062.1|  cytochrome P450 family protein                        79.7    5e-14   Musa acuminata [banana]
gb|KCW83245.1|  hypothetical protein EUGRSUZ_B00184                   79.7    5e-14   Eucalyptus grandis [rose gum]
gb|KCW80422.1|  hypothetical protein EUGRSUZ_C01775                   79.0    5e-14   Eucalyptus grandis [rose gum]
gb|KCW54385.1|  hypothetical protein EUGRSUZ_I00337                   77.8    5e-14   Eucalyptus grandis [rose gum]
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like            79.7    5e-14   Fragaria vesca subsp. vesca
gb|ADE80941.1|  flavonoid 3'-hydroxylase                              79.7    6e-14   Epimedium sagittatum
ref|XP_007137994.1|  hypothetical protein PHAVU_009G172100g           79.7    6e-14   Phaseolus vulgaris [French bean]
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g           79.3    6e-14   Phaseolus vulgaris [French bean]
gb|AFK47133.1|  unknown                                               77.8    6e-14   Lotus japonicus
ref|XP_010027006.1|  PREDICTED: cytochrome P450 71A9-like             79.3    6e-14   Eucalyptus grandis [rose gum]
ref|XP_003636936.1|  Cytochrome P450                                  79.3    6e-14   
emb|CDP14646.1|  unnamed protein product                              79.3    6e-14   Coffea canephora [robusta coffee]
ref|XP_008810911.1|  PREDICTED: cytochrome P450 71A1-like             79.0    6e-14   
ref|XP_003600319.1|  Cytochrome P450                                  79.3    6e-14   Medicago truncatula
emb|CDP14649.1|  unnamed protein product                              79.3    7e-14   Coffea canephora [robusta coffee]
emb|CDP14647.1|  unnamed protein product                              79.3    7e-14   Coffea canephora [robusta coffee]
ref|XP_010053381.1|  PREDICTED: geraniol 8-hydroxylase-like           79.3    7e-14   Eucalyptus grandis [rose gum]
gb|EYU22202.1|  hypothetical protein MIMGU_mgv1a005074mg              79.3    7e-14   Erythranthe guttata [common monkey flower]
gb|EMS49585.1|  4-hydroxyphenylacetaldehyde oxime monooxygenase       79.3    7e-14   Triticum urartu
ref|XP_010644732.1|  PREDICTED: premnaspirodiene oxygenase-like       79.0    7e-14   
ref|XP_010502541.1|  PREDICTED: cytochrome P450 71B35-like isofor...  75.1    7e-14   
ref|XP_010921587.1|  PREDICTED: premnaspirodiene oxygenase-like       79.3    7e-14   
gb|KJB78919.1|  hypothetical protein B456_013G025300                  77.8    7e-14   Gossypium raimondii
ref|XP_006854382.1|  hypothetical protein AMTR_s00039p00172950        77.0    8e-14   
ref|XP_010048230.1|  PREDICTED: cytochrome P450 71A9-like             79.0    8e-14   Eucalyptus grandis [rose gum]
ref|XP_009344946.1|  PREDICTED: cytochrome P450 71D8-like             79.3    8e-14   
ref|XP_010502540.1|  PREDICTED: cytochrome P450 71B35-like isofor...  75.1    8e-14   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like            79.0    8e-14   Glycine max [soybeans]
gb|KCW80424.1|  hypothetical protein EUGRSUZ_C01776                   79.0    8e-14   Eucalyptus grandis [rose gum]
gb|EYU20527.1|  hypothetical protein MIMGU_mgv1a025870mg              76.3    8e-14   
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330        79.0    9e-14   
ref|XP_002323082.2|  hypothetical protein POPTR_0016s14440g           78.2    9e-14   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g           79.0    9e-14   
gb|KJB13847.1|  hypothetical protein B456_002G097400                  79.0    9e-14   
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like             79.0    9e-14   
ref|XP_010667687.1|  PREDICTED: cytochrome P450 71A3-like             79.0    9e-14   
ref|XP_010048231.1|  PREDICTED: cytochrome P450 71A9-like             79.0    9e-14   
gb|EMT03288.1|  4-hydroxyphenylacetaldehyde oxime monooxygenase       78.6    9e-14   
gb|KJB72081.1|  hypothetical protein B456_011G157400                  79.0    9e-14   
gb|KJB73410.1|  hypothetical protein B456_011G232300                  78.2    1e-13   
ref|XP_010102947.1|  Cytochrome P450 71A1                             79.0    1e-13   
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g           79.0    1e-13   
gb|KCW80423.1|  hypothetical protein EUGRSUZ_C01776                   78.6    1e-13   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1  79.0    1e-13   
ref|XP_002323081.2|  hypothetical protein POPTR_0016s14440g           79.0    1e-13   
ref|XP_002310015.1|  cytochrome P450 family protein                   78.6    1e-13   
gb|KJB83173.1|  hypothetical protein B456_013G233400                  76.3    1e-13   
ref|XP_010911520.1|  PREDICTED: cytochrome P450 71A9-like             78.2    1e-13   
gb|ADK62366.1|  cytochrome P450                                       75.1    1e-13   
ref|XP_008372132.1|  PREDICTED: premnaspirodiene oxygenase-like       79.0    1e-13   
ref|XP_008372134.1|  PREDICTED: premnaspirodiene oxygenase-like       79.0    1e-13   
gb|KCW80425.1|  hypothetical protein EUGRSUZ_C01776                   78.6    1e-13   
gb|KDO69444.1|  hypothetical protein CISIN_1g048790mg                 78.6    1e-13   
emb|CCO62223.1|  putative cytochrome P450 monooxygenase               78.6    1e-13   
ref|XP_010251006.1|  PREDICTED: cytochrome P450 71A1                  78.6    1e-13   
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like       78.6    1e-13   
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like        77.8    1e-13   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                       78.6    1e-13   
ref|XP_004299223.2|  PREDICTED: cytochrome P450 CYP736A12-like        78.6    1e-13   
ref|XP_007033576.1|  Cytochrome P450, putative                        77.4    1e-13   
ref|XP_009418039.1|  PREDICTED: cytochrome P450 71A9-like             77.0    1e-13   
ref|XP_003601148.1|  Cytochrome P450                                  76.3    1e-13   
ref|XP_002523238.1|  cytochrome P450, putative                        78.6    1e-13   
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                            78.6    1e-13   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like       78.2    1e-13   
ref|XP_007020023.1|  Cytochrome P450 71A9, putative                   78.2    1e-13   
gb|AEI59777.1|  cytochrome P450                                       78.2    1e-13   
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like       77.0    1e-13   
ref|XP_011025649.1|  PREDICTED: cytochrome P450 CYP736A12-like        76.6    1e-13   
gb|AFP95893.1|  F3'H                                                  78.6    1e-13   
ref|XP_008239593.1|  PREDICTED: cytochrome P450 71A25-like            77.4    1e-13   
ref|XP_009608153.1|  PREDICTED: cytochrome P450 71A22-like            78.6    1e-13   
ref|XP_008810925.1|  PREDICTED: cytochrome P450 71A1-like             77.8    1e-13   
gb|KJB81628.1|  hypothetical protein B456_013G153200                  78.6    1e-13   
ref|XP_002530058.1|  cytochrome P450, putative                        78.2    1e-13   
gb|AGB55874.1|  flavonoid 6-hydroxylase 3                             78.2    1e-13   
ref|XP_006439962.1|  hypothetical protein CICLE_v10023490mg           77.8    2e-13   
ref|XP_004157822.1|  PREDICTED: cytochrome P450 71A1-like             78.2    2e-13   
emb|CDP10758.1|  unnamed protein product                              78.2    2e-13   
gb|KDO62256.1|  hypothetical protein CISIN_1g0441781mg                75.1    2e-13   
ref|XP_003600323.1|  Cytochrome P450                                  78.2    2e-13   
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g           78.2    2e-13   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like        78.2    2e-13   
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                78.2    2e-13   
ref|XP_010911323.1|  PREDICTED: cytochrome P450 71A1-like             78.2    2e-13   
emb|CDM87088.1|  unnamed protein product                              78.2    2e-13   
gb|KJB34360.1|  hypothetical protein B456_006G062200                  78.2    2e-13   
ref|XP_009334095.1|  PREDICTED: cytochrome P450 71A3-like             78.6    2e-13   
ref|XP_010911404.1|  PREDICTED: cytochrome P450 71A1-like             77.8    2e-13   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like            77.8    2e-13   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like       77.8    2e-13   
ref|XP_011071980.1|  PREDICTED: cytochrome P450 71A6-like             77.8    2e-13   
gb|EMT03287.1|  4-hydroxyphenylacetaldehyde oxime monooxygenase       77.8    2e-13   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like             78.2    2e-13   
ref|XP_002540268.1|  cytochrome P450, putative                        75.5    2e-13   
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g           77.8    2e-13   
ref|XP_004152572.1|  PREDICTED: cytochrome P450 71A1-like             77.8    2e-13   
ref|XP_008659837.1|  PREDICTED: cytochrome P450 93A3-like             77.8    2e-13   
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like             77.8    2e-13   
gb|AES98625.2|  cytochrome P450 family 71 protein                     77.8    2e-13   
ref|XP_008231956.1|  PREDICTED: premnaspirodiene oxygenase-like       76.6    2e-13   
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like             77.8    2e-13   
emb|CDM87085.1|  unnamed protein product                              77.8    2e-13   
ref|XP_002509652.1|  cytochrome P450, putative                        77.0    2e-13   
ref|XP_002522214.1|  cytochrome P450, putative                        75.9    2e-13   
gb|KJB13848.1|  hypothetical protein B456_002G097500                  77.8    2e-13   
ref|XP_002318090.2|  hypothetical protein POPTR_0012s09160g           77.8    2e-13   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like       77.8    2e-13   
ref|XP_003636932.1|  Cytochrome P450                                  77.0    2e-13   
ref|XP_008229630.1|  PREDICTED: cytochrome P450 71A1-like             77.8    2e-13   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                  77.8    3e-13   
ref|XP_006388081.1|  hypothetical protein POPTR_0357s00220g           77.4    3e-13   
ref|XP_008392880.1|  PREDICTED: cytochrome P450 71A1-like             77.8    3e-13   
ref|XP_008783087.1|  PREDICTED: cytochrome P450 93A3                  77.4    3e-13   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g           77.4    3e-13   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like             77.4    3e-13   
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like        77.4    3e-13   
ref|XP_002450982.1|  hypothetical protein SORBIDRAFT_05g022050        77.4    3e-13   
ref|XP_009387189.1|  PREDICTED: cytochrome P450 71A1-like             76.3    3e-13   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like        77.4    3e-13   
gb|KHG24310.1|  Cytochrome P450                                       77.0    3e-13   
ref|XP_004972558.1|  PREDICTED: cytochrome P450 99A2-like             77.4    3e-13   
ref|XP_010272814.1|  PREDICTED: cytochrome P450 71A1-like             77.4    3e-13   
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like       77.4    3e-13   
gb|KHG07193.1|  Cytochrome P450                                       77.0    3e-13   
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like            77.4    3e-13   
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like       77.4    3e-13   
ref|XP_011025648.1|  PREDICTED: cytochrome P450 CYP736A12-like        75.5    3e-13   
ref|XP_008351758.1|  PREDICTED: cytochrome P450 71A1-like             77.4    3e-13   
gb|KHM99473.1|  Cytochrome P450 71D11                                 77.0    3e-13   
gb|KJB83171.1|  hypothetical protein B456_013G233300                  77.4    3e-13   
ref|XP_006841379.1|  hypothetical protein AMTR_s00181p00052110        72.4    3e-13   
ref|NP_001058164.1|  Os06g0640500                                     77.4    3e-13   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  77.4    3e-13   
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  77.4    3e-13   
gb|KJB13853.1|  hypothetical protein B456_002G098000                  74.3    3e-13   
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                77.0    3e-13   
emb|CBI33813.3|  unnamed protein product                              77.4    3e-13   
gb|AGG40645.1|  flavanone 3'-hydroxylase                              77.4    4e-13   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg              77.0    4e-13   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like             77.0    4e-13   
ref|XP_009333927.1|  PREDICTED: cytochrome P450 71A1-like             77.0    4e-13   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg              77.0    4e-13   
gb|ACU20890.1|  unknown                                               77.0    4e-13   
gb|ABR17055.1|  unknown                                               77.0    4e-13   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like             76.6    4e-13   
gb|KEH31752.1|  cytochrome P450 family 71 protein                     77.0    4e-13   
ref|XP_003615666.1|  Cytochrome P450                                  77.0    4e-13   
ref|XP_004294175.1|  PREDICTED: cytochrome P450 71A1-like             77.0    4e-13   
ref|XP_008372133.1|  PREDICTED: premnaspirodiene oxygenase-like       75.9    4e-13   
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1   77.0    4e-13   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like        77.0    4e-13   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2   77.0    4e-13   
ref|XP_006403743.1|  hypothetical protein EUTSA_v10010318mg           77.0    4e-13   
gb|AGB55868.1|  flavonoid 6-hydroxylase 1                             77.0    4e-13   
sp|O81971.1|C71D9_SOYBN  RecName: Full=Cytochrome P450 71D9; AltN...  77.0    4e-13   
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g           77.0    5e-13   
gb|AGB55870.1|  flavonoid 6-hydroxylase 1                             76.6    5e-13   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  77.0    5e-13   
gb|EMT05757.1|  Cytochrome P450 71A1                                  77.0    5e-13   
gb|AES70567.2|  cytochrome P450 family 71 protein                     76.6    5e-13   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                       76.6    5e-13   
ref|XP_009788504.1|  PREDICTED: premnaspirodiene oxygenase-like       75.1    5e-13   
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg           76.6    5e-13   
ref|XP_002523241.1|  cytochrome P450, putative                        76.6    5e-13   
gb|AJD25152.1|  cytochrome P450 CYP71AP14                             76.6    5e-13   
gb|EPS57376.1|  hypothetical protein M569_17442                       76.6    5e-13   
ref|XP_002466097.1|  hypothetical protein SORBIDRAFT_01g001180        77.0    5e-13   
ref|XP_003551491.1|  PREDICTED: cytochrome P450 71D9-like             76.6    5e-13   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like       76.6    5e-13   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                       76.6    5e-13   
ref|XP_004301023.1|  PREDICTED: cytochrome P450 71A9-like             76.6    5e-13   
ref|XP_010695999.1|  PREDICTED: cytochrome P450 71A1-like             76.6    5e-13   
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11     76.6    5e-13   
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11              76.6    5e-13   
ref|XP_008446128.1|  PREDICTED: cytochrome P450 71A1-like             75.1    6e-13   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like       76.6    6e-13   
ref|XP_003615678.1|  Cytochrome P450                                  76.6    6e-13   
gb|KJB81638.1|  hypothetical protein B456_013G154300                  76.6    6e-13   
emb|CAN81642.1|  hypothetical protein VITISV_036426                   76.3    6e-13   
ref|XP_002318091.2|  hypothetical protein POPTR_0012s09180g           76.6    6e-13   
gb|KHG00772.1|  Cytochrome P450                                       76.6    6e-13   
ref|XP_006452559.1|  hypothetical protein CICLE_v10010637mg           76.6    6e-13   
gb|KJB81637.1|  hypothetical protein B456_013G154300                  76.6    6e-13   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like        76.6    6e-13   
ref|XP_004956321.1|  PREDICTED: cytochrome P450 99A2-like             76.6    6e-13   
ref|XP_006585306.1|  PREDICTED: cytochrome P450 750A1-like isofor...  75.9    6e-13   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like       76.6    6e-13   
ref|XP_004301061.2|  PREDICTED: cytochrome P450 CYP736A12-like        76.6    6e-13   
ref|XP_003611883.1|  Cytochrome P450                                  76.6    6e-13   
gb|AGC29948.1|  CYP75B65                                              76.6    6e-13   
emb|CAE04106.1|  OSJNBa0096F01.14                                     76.3    6e-13   
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like           76.3    6e-13   
ref|NP_001052172.1|  Os04g0178400                                     76.3    6e-13   
gb|EYU30852.1|  hypothetical protein MIMGU_mgv1a020394mg              74.3    6e-13   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 CYP736A12-like        76.3    6e-13   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like             76.3    7e-13   
gb|KFK27280.1|  hypothetical protein AALP_AA8G361500                  76.3    7e-13   
gb|ADK62372.1|  cytochrome P450                                       76.3    7e-13   
ref|XP_002530922.1|  cytochrome P450, putative                        75.9    7e-13   
emb|CAN81641.1|  hypothetical protein VITISV_036425                   76.3    7e-13   
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...  76.3    7e-13   
gb|EEE66088.1|  hypothetical protein OsJ_22109                        76.3    7e-13   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like            76.6    7e-13   
ref|XP_002526055.1|  cytochrome P450, putative                        75.5    7e-13   
ref|XP_010519645.1|  PREDICTED: cytochrome P450 71B12-like isofor...  76.3    7e-13   
ref|XP_004157820.1|  PREDICTED: cytochrome P450 71A1-like             76.3    7e-13   
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                 76.3    7e-13   
gb|KHM99474.1|  Cytochrome P450 71D11                                 76.3    7e-13   
ref|XP_008364601.1|  PREDICTED: cytochrome P450 71A1-like             75.5    7e-13   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like            76.3    7e-13   
ref|NP_001268152.1|  ripening-related P-450 enzyme-like               76.3    7e-13   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like       76.3    7e-13   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like           76.3    7e-13   
ref|XP_010100353.1|  Cytochrome P450                                  75.1    7e-13   
gb|KEH28165.1|  cytochrome P450 family 71 protein                     75.9    8e-13   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g           76.3    8e-13   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g           76.3    8e-13   
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like           76.3    8e-13   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                 76.3    8e-13   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like             76.3    8e-13   
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                          76.3    8e-13   
gb|AJD25160.1|  cytochrome P450 CYP71AU53                             75.9    8e-13   
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like           75.9    9e-13   
dbj|BAB17054.1|  unnamed protein product                              72.4    9e-13   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like       75.9    9e-13   
ref|XP_003630098.1|  Cytochrome P450                                  75.9    9e-13   
gb|AES71399.2|  cytochrome P450 family 71 protein                     75.9    9e-13   
ref|XP_004515856.1|  PREDICTED: cytochrome P450 71A26-like            75.9    9e-13   
gb|KDP31013.1|  hypothetical protein JCGZ_11389                       75.9    9e-13   
ref|XP_002523242.1|  cytochrome P450, putative                        75.9    9e-13   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                       75.9    9e-13   
ref|XP_002466096.1|  hypothetical protein SORBIDRAFT_01g001160        76.3    9e-13   
dbj|BAP15887.1|  cytochrome P450 736A117                              75.9    9e-13   
ref|XP_010100350.1|  Cytochrome P450                                  75.9    1e-12   
ref|XP_010668023.1|  PREDICTED: cytochrome P450 71A26-like            75.9    1e-12   
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  75.9    1e-12   
gb|EYU32021.1|  hypothetical protein MIMGU_mgv1a005095mg              75.9    1e-12   
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase            75.1    1e-12   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g           75.9    1e-12   
ref|XP_006854383.1|  hypothetical protein AMTR_s00039p00174690        75.9    1e-12   
ref|XP_006653172.1|  PREDICTED: cytochrome P450 99A2-like             75.9    1e-12   
gb|EMT21977.1|  Cytochrome P450 99A2                                  75.9    1e-12   
ref|XP_010544668.1|  PREDICTED: cytochrome P450 76C1-like             75.9    1e-12   
gb|KCW83261.1|  hypothetical protein EUGRSUZ_B00199                   75.1    1e-12   
gb|ABK24689.1|  unknown                                               75.9    1e-12   
ref|XP_009415441.1|  PREDICTED: cytochrome P450 93A3-like             75.9    1e-12   
ref|XP_010102938.1|  Cytochrome P450 71A1                             75.9    1e-12   
ref|XP_003580527.1|  PREDICTED: cytochrome P450 99A2-like             75.9    1e-12   
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g           75.5    1e-12   



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + +RK+SSS Y LPPGPPGLP+ GNM DLG  P+QTIA 
Sbjct  1    MEWEWSYVVWSVIILVPTLIIVFSRKRSSS-YNLPPGPPGLPIFGNMFDLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K+KYG ++W  IGSV TM+ILSAK AA+ FKNHD +FA+R +ID M V  Y  GSLA A
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAADFFKNHDFAFAERKIIDTMLVHDYNKGSLALA  119

Query  529  PYGSYWRVL  555
            PYG+YWRVL
Sbjct  120  PYGTYWRVL  128



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + ++++S S Y LPPGPPGLP+ GNM +LG  P+QTIA 
Sbjct  1    MEWEWSYVVWSTIILVPTLIIVFSKRRSCS-YNLPPGPPGLPIFGNMFNLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K+KYG ++W  IGSV TM+ILSAK AAE FKNHD +FA+R ++D M V  Y  GSLA A
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAERKIMDTMLVHDYNKGSLAIA  119

Query  529  PYGSYWRVL  555
            PYG+YWRVL
Sbjct  120  PYGTYWRVL  128



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I ++P  + ++  K +SSSY+LPPGPPG P+ GNM DLG  P+QTIAE
Sbjct  1    MEWEWNYVVWSIIIIVPTTLIIVFSKTNSSSYKLPPGPPGFPIFGNMFDLGTLPYQTIAE  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K KYG V+W +IGSV TM+ILSA  A E FKNHD +FA+R +ID M V  Y +GSLA A
Sbjct  61   FKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKIIDTMLVHDYNLGSLAIA  120

Query  529  PYGSYWRVL  555
             YG+YWRVL
Sbjct  121  RYGTYWRVL  129



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSS-YRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS +RLPPGPPGLPV GNM DLG  PHQT+ 
Sbjct  2    MEWPWNFLVYFITFLLPALLFLIRRRSSNSSLHRLPPGPPGLPVFGNMFDLGTMPHQTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            E+ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT  +  +V  Y+ GSLA 
Sbjct  62   ELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  526  APYGSYWRVL  555
            APYG++WR+L
Sbjct  122  APYGAHWRML  131



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W+W Y+VWS I ++   + ++  K++SS Y+LPPGPPG+P+ GNM DLGA P+QTIA+
Sbjct  1    MDWDWNYVVWSIIIIVSTTLIIVFSKRNSSCYKLPPGPPGIPIFGNMFDLGALPYQTIAQ  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K KYG ++W +IGSV TM+ILSAK A E FKNHD  FA+R ++D M V  Y +GSLA A
Sbjct  61   YKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIMDTMLVHDYNLGSLAIA  120

Query  529  PYGSYWRVL  555
             YG+YWRVL
Sbjct  121  RYGTYWRVL  129



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M  +W Y  W +IFL+P    +L+RKKS S +RLPPGPPG P+ GN+ DLG  PHQTIA 
Sbjct  1    MVLDWCYFAWFSIFLVPFFFLVLSRKKSCS-HRLPPGPPGWPIFGNLFDLGTLPHQTIAG  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            MK +YG V+ LRIGSV T+AILSAK A E FKNHD  FADR +ID M V  Y   SL  A
Sbjct  60   MKLRYGPVVLLRIGSVKTIAILSAKVATEFFKNHDACFADRKIIDTMLVHNYNKSSLVLA  119

Query  529  PYGSYWRVL  555
            PYG+YWRVL
Sbjct  120  PYGTYWRVL  128



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            E  + V+ AI L+P L+F +   K S S RLPPGP G PV G+M +LG  PH+ IAE++ 
Sbjct  2    ELHFFVYPAIILLPPLIFAIIHSKRSGSERLPPGPLGWPVFGHMFNLGGTPHRAIAELEQ  61

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG  537
            KYG V+WL++GS++TMA+L AK A+E FKNHD+SFADRT+++ M   GY  GSLA APYG
Sbjct  62   KYGPVVWLKLGSINTMALLKAKPASEFFKNHDLSFADRTIVETMTAHGYNYGSLALAPYG  121

Query  538  SYWRVL  555
            S WRVL
Sbjct  122  SRWRVL  127



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+WEW YL +S I  +P L+ +  +KK++SSY+LPPGPPGLP+ GNM +LG+ P++ +A 
Sbjct  1    MQWEWSYLFFSTIIFLPVLLLIFPKKKANSSYKLPPGPPGLPIFGNMFELGSLPYKKVAV  60

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            +K KYG ++WL+IG S+++M + +A+AAA+LFKNHD+SFADR  +DV +   YY GS+A 
Sbjct  61   LKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCTVDVNQAHNYYQGSMAL  120

Query  526  APYGSYWRV  552
              YGS+WR+
Sbjct  121  GQYGSFWRL  129



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 98/129 (76%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKS-SSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S I  +P L+ +  +KK+ SSSYRLPPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYLFFSTIIFLPVLLLIFPKKKAISSSYRLPPGPPGLPIFGNMFELGTLPYKKVA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL+IG S+++M + +A+AAA+LFKNHD+SFADR  +DV +   YY GS+A
Sbjct  61   VLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCPVDVNQAHNYYQGSMA  120

Query  523  FAPYGSYWR  549
               YGS+WR
Sbjct  121  LGQYGSFWR  129



>emb|CDP15344.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME      VW    LIP L+ LL R K SS  RLPPGPPG P+ GNM DLG+ PH+T+A 
Sbjct  1    MELHVNQFVWGVAILIPSLL-LLLRHKKSSHNRLPPGPPGWPIFGNMFDLGSMPHRTLAG  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +KNKYG V+WLRIG+++TMA+ S+KAAAELF+NHD+SF +RTV + MK   +   SL+ A
Sbjct  60   LKNKYGPVVWLRIGAMNTMAVQSSKAAAELFRNHDISFVERTVTENMKSHNFDKSSLSLA  119

Query  529  PYGSYWRVL  555
            PYGSYWRVL
Sbjct  120  PYGSYWRVL  128



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+  W +LVW    L P ++FL  R++ S+S  LPPGPPG PV+GNM DLG+ PH+T+A 
Sbjct  35   MDSMWIFLVWCIGILGP-VLFLFCRQRCSTSGGLPPGPPGWPVVGNMFDLGSMPHKTVAG  93

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +K  YG V+WLRIGS++T+A+L+AKAAAELFKNHD +FA+RT+ +VMKV  ++  +L+ +
Sbjct  94   LKKDYGPVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITEVMKVHDFHKTALSLS  153

Query  529  PYGSYWRVL  555
            PYGSYWRV+
Sbjct  154  PYGSYWRVM  162



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P  +   +RKKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSSIILLPAFILFFSRKKSTKCSYKLPPGPPGLPIFGNMFELGTEPYKRMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S   M + +A+AA ELFKNHD+SFADR + D  +   YY GSLA
Sbjct  61   VLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADRFIPDANQAHSYYQGSLA  120

Query  523  FAPYGSYWR  549
             APYGS+WR
Sbjct  121  LAPYGSFWR  129



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +1

Query  169  MEWEWKYLVWS--AIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQT  339
            M+W W Y+ WS  +I +   L+    R++S+ + RL P  P   PV GNM +LG  PH+T
Sbjct  1    MDWNWDYVFWSITSILIPLLLLLHFHRRRSNKNRRLLPPGPQGWPVFGNMFELGNEPHKT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            +  +K KYGSV+WL++GS++TM ILSA+AAAE FKNHDV+FA+R+V +VMK  GY+ GSL
Sbjct  61   LMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKNHDVAFAERSVTEVMKSHGYHKGSL  120

Query  520  AFAPYGSYWRVL  555
            A APYG+YWR++
Sbjct  121  ALAPYGTYWRIM  132



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVL  555
            PYG +WR L
Sbjct  121  PYGPHWRSL  129



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW Y+ +SAI ++P  +   ++K ++ SSY+ PPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMA  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             ++ KYG V+WL++GS  TM + +A+A+ ELFKNHD+SFA+R + DV +   YY GSLA 
Sbjct  61   VLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAI  120

Query  526  APYGSYWR  549
            APYG +WR
Sbjct  121  APYGPFWR  128



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNXDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVL  555
            PYG +WR L
Sbjct  121  PYGPHWRSL  129



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   136 bits (342),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVL  555
            PYG +WR L
Sbjct  121  PYGPHWRSL  129



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIA  345
            M+W W Y+ WS   ++  L+    R++S+ + RL P      PV GNM +LG  PH+T+ 
Sbjct  1    MDWNWDYVFWSITSILILLLLHFHRRRSNKNGRLLPPGSRGWPVFGNMFELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             +K KYG V+WL++GS++TM ILSA AA E FKNHDV+FA+R+V +VMK  GY+ GSLA 
Sbjct  61   GLKQKYGPVVWLKLGSINTMVILSADAATEFFKNHDVAFAERSVTEVMKSHGYHKGSLAL  120

Query  526  APYGSYWRVL  555
            APYG+YWR++
Sbjct  121  APYGTYWRIM  130



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG+ PH+T+ +M+ KYG+VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   IFGNLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + + M+  GY  GSLA APYGSYWRVL
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVL  130



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV     +Y  S+
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  520  AFAPYGSYWRV  552
            A APYG+YWR+
Sbjct  121  ALAPYGNYWRL  131



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV     +Y  S+
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  520  AFAPYGSYWRV  552
            A APYG+YWR+
Sbjct  121  ALAPYGNYWRL  131



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  154  KNF*EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            +N  +M+W    LV   IF   G V LL R+KSS   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLHRRKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            +T+ E++ KYG V+WL+ G+++TMAILSAKAA + FKNHD +FA+R V + M+V GY   
Sbjct  70   RTLTELRQKYGDVLWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  514  SLAFAPYGSYWRVL  555
            SLA APYG++WRVL
Sbjct  130  SLALAPYGAFWRVL  143



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+ DLG+ PH+T+  M+ KYG VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   VLGNLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + + M+  GY  GSLA APYGSYWRVL
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVL  130



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   133 bits (335),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 71/129 (55%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W   +LV   IF    ++FL  R+++S+  +LPPGPPG P+IGNM DLG  PH+T+  
Sbjct  90   MDWPTSFLVCLVIF-SSSVLFLFFRRRNSNPGKLPPGPPGWPIIGNMFDLGTMPHRTLTC  148

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG VIWLR+G+V+TM +LS KAA ELFKNHD+SFA+R + ++M+   Y+  SLA A
Sbjct  149  LRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAERNITEIMRAHDYHKSSLALA  208

Query  529  PYGSYWRVL  555
            PYGSYWRVL
Sbjct  209  PYGSYWRVL  217



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = +1

Query  184  KYLVWSAI-FLIPGLVFLLARKKSSSSYRlp--pgppglpVIGNMLDLGAFPHQTIAEMK  354
            ++L+W+ +  +IP L+FL  R++S+SS  L   PGPPG P+IGNMLDLG  PH+T  +++
Sbjct  2    EHLLWNFLSLIIPALLFLFIRRRSNSSKELELPPGPPGWPIIGNMLDLGQMPHKTQTKLR  61

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            + +G VIWLRIG+ +TMAILSAKAA E FKNHD+SFA+R+V +  KV  Y+ GSLA APY
Sbjct  62   HTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERSVTEGSKVLDYHKGSLALAPY  121

Query  535  GSYWRVL  555
            GS+WR+L
Sbjct  122  GSHWRLL  128



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH+T+ E
Sbjct  1    MDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLTE  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            ++ KYG VIWL+ G+++TMAILSAKAA + FKNHD +FA+R V + M+V GY   SLA A
Sbjct  60   LRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKSSLALA  119

Query  529  PYGSYWRVL  555
            PYG++WRVL
Sbjct  120  PYGAFWRVL  128



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  154  KNF*EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            +N  +M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            +T+ E++ KYG VIWL+ G+++TM ILSAKAA + FKNHD +FA+R V + M+V GY   
Sbjct  70   RTLTELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  514  SLAFAPYGSYWRVL  555
            SLA APYG++WRVL
Sbjct  130  SLALAPYGAFWRVL  143



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +FL   L F L RKKS S + LPPGP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FILISIVFLSTALFFSLRRKKSGS-WVLPPGPSGWPIFGNIFSLGTMPHRTVAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
              IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVL  555
            RV+
Sbjct  128  RVM  130



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+   +   ++KKS+   Y+LPPGPPGLP+ GNM +LG  P + ++
Sbjct  1    MEWEWSYLFFSSIILLSVFILFFSQKKSTKCCYKLPPGPPGLPIFGNMFELGTEPFKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR + DV +   YY GSLA
Sbjct  61   VLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADRFIPDVNQAHSYYQGSLA  120

Query  523  FAPYGSYWR  549
             APYG +WR
Sbjct  121  LAPYGPFWR  129



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS+ RLPPGPPGLPV GNM DLG  PH+T+ 
Sbjct  2    MEWPWNFLVYFIPFLLPALLFLIRRRSSNSSHHRLPPGPPGLPVFGNMFDLGTMPHKTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT  +  +V  Y+ GSLA 
Sbjct  62   DLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  526  APYGSYWRVL  555
            APYG++WR+L
Sbjct  122  APYGAHWRML  131



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P L+   ++KK++  SY+LPPGPPGLP  GNM +LG  P++ +A
Sbjct  1    MEWEWSYLCFSSIILLPVLILFFSQKKTTKCSYKLPPGPPGLPFFGNMFELGTEPYKRMA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S + M + +A AAAELFKNHD SFADR + DV +   YY GSLA
Sbjct  61   ALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADRFIPDVNQAHSYYQGSLA  120

Query  523  FAPYGSYWR  549
               YGS+WR
Sbjct  121  IGRYGSFWR  129



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI  +P L+   ++KKSS   Y LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIIFLPILILFFSQKKSSKCCYNLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR ++DV +   Y+ GSLA
Sbjct  61   ALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIVDVNQAHNYFQGSLA  120

Query  523  FAPYGSYWR  549
               YGS+WR
Sbjct  121  VGRYGSFWR  129



>gb|KJB62266.1| hypothetical protein B456_009G409000 [Gossypium raimondii]
Length=512

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+    +L+   +F    L   + R+ +S + +LPPGPPG P+ GNM DLG  PH+T+  
Sbjct  1    MDLSPSFLLCFIVFASSALFLFIQRRNNSVTGKLPPGPPGWPIFGNMFDLGTMPHRTLTR  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG VIWLR+G+V+TM ILS KAA E FKN+D++FA+R + ++M+  GY+  S+A A
Sbjct  61   LRDKYGQVIWLRLGAVNTMVILSTKAATEFFKNYDLTFAERHITEIMRAHGYHKSSVALA  120

Query  529  PYGSYWRVL  555
            PYGSYWRVL
Sbjct  121  PYGSYWRVL  129



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAI-FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W Y+ +S I  L P L F       +   +LPPGP G PV G+ML+LG  PH+T+ 
Sbjct  1    MEWIWGYIFFSIITVLFPFLHFRWRTLLYNVRQQLPPGPRGWPVFGSMLELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++K KYG V+WL++GS++TM ILSAKAA E F+NHD++FA+R+V +VMK  GY  GSLA 
Sbjct  61   DLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTEVMKSHGYDKGSLAL  120

Query  526  APYGSYWRVL  555
            APYG+YWR++
Sbjct  121  APYGTYWRIM  130



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI L+P L+   ++KKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIILLPVLILFFSQKKSTKCSYKLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++ KYG V+ L++G S + M + +A AAAELFKNHD SFADR ++DV     YY GSLA
Sbjct  61   VLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADRPMVDVNLAHNYYQGSLA  120

Query  523  FAPYGSYWR  549
               YGS+WR
Sbjct  121  IGRYGSFWR  129



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y  GS+A APYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  550  V  552
            V
Sbjct  129  V  129



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y  GS+A APYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  550  V  552
            V
Sbjct  129  V  129



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   LP GP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LPRGPSGWPIFGNIFSLGTMPHRTLAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVL  555
            RV+
Sbjct  128  RVM  130



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW +LV   IF +P LVFL+ R  SSS +R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNFLVCLIIFFLPVLVFLIRRSSSSSGHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVL  555
            G++WRV+
Sbjct  129  GTHWRVM  135



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 96/133 (72%), Gaps = 9/133 (7%)
 Frame = +1

Query  169  MEWEW----KYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            ME  W     ++V S + ++P L     RK +S   RLPPGPPG PV GN  DLG  PH+
Sbjct  1    MECSWVIFLAFIVMSFLLIMPHL-----RKGTSGHRRLPPGPPGWPVFGNTFDLGPMPHR  55

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
            ++A++++KYG V+WL++G+++TM ILS+KAAAE FKNHD+SF +RTV +  +V GY+ GS
Sbjct  56   SLAQLRHKYGDVLWLKLGAINTMVILSSKAAAEFFKNHDLSFVERTVTETSRVYGYHKGS  115

Query  517  LAFAPYGSYWRVL  555
            +A A YGSYWRV+
Sbjct  116  VALANYGSYWRVM  128



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +1

Query  169  MEW-EWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTI  342
            MEW  W +LV+  IFL+P L+FLL R++S S ++ LPPGPPG P+ GNM DLG  PH+T+
Sbjct  1    MEWCSWNFLVYFLIFLLPALLFLLIRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             E+  K+G VIWLR+G+ +TM++ SAKAA+E FKNHD+SFA+RT+ +  +V  Y+ GSLA
Sbjct  61   TELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRTINEACRVYDYHKGSLA  120

Query  523  FAPYGSYWRVL  555
             APYGS+WRVL
Sbjct  121  LAPYGSHWRVL  131



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +1

Query  181  WKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl--pVIGNMLDLGAFPHQTIAEMK  354
            W +LV+    +IP L+FLL R +S+S       P     P++GNMLDLGA PH+T+ E++
Sbjct  6    WNFLVY---VVIPSLLFLLIRWRSNSGGEQAFPPGPPGWPILGNMLDLGAMPHKTLTELR  62

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +++GSV+WLR+G  +TM I SAKAA E FKNHD++F +R +    +V  Y+ GSLA APY
Sbjct  63   HRFGSVLWLRLGVRNTMVIQSAKAATEFFKNHDLTFVERNINIGARVHDYHKGSLALAPY  122

Query  535  GSYWRVL  555
            G+ WRVL
Sbjct  123  GTQWRVL  129



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  EWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEM  351
            +W    L+W  I +IP ++FLL R++ S S RLPPGPPG PV GNM DLGA PH+T+A +
Sbjct  13   DWASNILLWCIILVIP-VLFLLLRRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGL  71

Query  352  KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP  531
            ++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA AP
Sbjct  72   RHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNKDLCFSDRTITETMRAQGYHESSLALAP  131

Query  532  YGSYWRVL  555
            YG +WR L
Sbjct  132  YGPHWRSL  139



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW +   +W AIFLI   +F + +++  ++ RLPPGP GLP+IGNM DLG  PH+ +A+
Sbjct  1    MEWPFSIPLW-AIFLIFLPIFTIIQQRIRTTRRLPPGPRGLPIIGNMFDLGTMPHRALAK  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +  K+G VIWLR+GS   M IL+A+ AAE FK+HD+SF DR + + M+V  Y+ GSL  A
Sbjct  60   LGTKHGPVIWLRLGSQRIMVILTAEIAAEFFKHHDLSFVDRNINETMRVLDYHKGSLILA  119

Query  529  PYGSYWRVL  555
            PYG +WRV+
Sbjct  120  PYGPHWRVM  128



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W W   +   I L+     L  R+ S++   LPPGP G PV GNM  LG+ PH+TIA 
Sbjct  1    MDWLWSTFLVCCISLV---AVLYHRRYSTTRANLPPGPRGWPVFGNMFQLGSMPHKTIAG  57

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +K+ YG V+WLRIGS++TMA+L+A AAAELFKNHD SFA+RT+ DVM    ++  +L+ +
Sbjct  58   LKSHYGPVVWLRIGSINTMALLTAGAAAELFKNHDASFAERTITDVMTSHNFHKAALSLS  117

Query  529  PYGSYWRVL  555
            PYG YWR +
Sbjct  118  PYGPYWRSM  126



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVST  402
            L FL   +K+   +R PPGPPG P++GN+LDLG  PH+T+ +++ KYG VI LR+GSV+T
Sbjct  20   LFFLFGSRKN---HRFPPGPPGWPILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNT  76

Query  403  MAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            M ILSAK A+ELFK HD+SFA+R + + M+  GY  GSLA APYGSYWRVL
Sbjct  77   MVILSAKPASELFKYHDLSFAERNITETMRSHGYNEGSLAIAPYGSYWRVL  127



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVL  555
            G++WRV+
Sbjct  129  GTHWRVM  135



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVL  555
            G++WRV+
Sbjct  129  GTHWRVM  135



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +1

Query  217  PGLVFLLARKK---SSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
            P  +FLL R++   ++ + RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG ++WL+I
Sbjct  16   PVFLFLLNRRRKISATKNRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLREKYGPILWLKI  75

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            G+V+TMAILSAK A   FKNHD +F+DRTVI+ M+V  Y   SLA APYGSYWR++
Sbjct  76   GAVNTMAILSAKEATIFFKNHDHAFSDRTVIETMRVHNYDKSSLALAPYGSYWRLM  131



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY--RlppgppglpVIGNMLDLGAFPHQTI  342
            MEWEW YL +S I L+P  + L +RKK++  Y   LPPGPPGLP+ GN+  LG  P + +
Sbjct  1    MEWEWSYLFFSTIILLPAFILLFSRKKATKCYYNLLPPGPPGLPIFGNVFQLGTEPFKAM  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A ++ KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR +  V +   Y  GS+
Sbjct  61   ACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADRFIPIVNQAHNYCQGSM  120

Query  520  AFAPYGSYWR  549
            A   YGSYWR
Sbjct  121  ALCQYGSYWR  130



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   L PGP G P+ GN+  LG  PH+ +A +  KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVL  555
            RV+
Sbjct  128  RVM  130



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            +W  LVW   FL+  LV +++++++    + PPGPPG PVIGN+ DLG  PHQ++  +++
Sbjct  5    DWTSLVWGG-FLLAALVVMVSKRENK---QRPPGPPGWPVIGNLFDLGTMPHQSLYHLRS  60

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG  537
            KYG V+WL+ GS++TM I S KAAA+LFKNHD++F+DR    V+K   Y+ G+LAF  YG
Sbjct  61   KYGPVLWLKFGSMNTMVIQSPKAAAQLFKNHDLNFSDRKCPGVLKAHDYFQGTLAFGRYG  120

Query  538  SYWRVL  555
             YWRVL
Sbjct  121  PYWRVL  126



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++  A+F+   L+  L R K S S RLPPGPPG P+ GNM +LG  PH+T+A ++ KYG
Sbjct  9    FVLICALFVSATLLVSL-RWKKSRSCRLPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             VIWLR+GS+ TM ILS++ A E FKN D++FA+RTV D+M+   Y+ GS+A APYGSYW
Sbjct  68   PVIWLRLGSIDTMVILSSRVATEFFKNQDLNFAERTVTDLMRSHDYHEGSVALAPYGSYW  127

Query  547  RV  552
            R+
Sbjct  128  RM  129



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  253  SSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAA  432
            S S+RLPPGP   P+ GN+ +LG  P +T+A ++ KYG VIWLR+GS+ TM  LS++ AA
Sbjct  31   SRSHRLPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTLSSRVAA  90

Query  433  ELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            E FKNHD++F +RT+ D+M+ Q YY GS+A APYG+YWRV
Sbjct  91   EFFKNHDLNFVERTITDLMQSQEYYKGSIALAPYGTYWRV  130



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+LDLG+ PH T+ +++ KYG ++ LR+G+++T+ ILSAKAA+ELFKNHD++FA+R 
Sbjct  43   ILGNLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVILSAKAASELFKNHDLTFAERF  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            +   M+V GY  GSLA APYGSYWRV+
Sbjct  103  LTITMRVHGYDQGSLALAPYGSYWRVM  129



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW+Y+ WS I L+P L+ L+A+ KSSSS  +LPPGPPGLP+ GNM DL G+ PH+ +
Sbjct  1    MELEWRYIFWSIIILLPALILLIAKNKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPHKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A  K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV      Y GS+
Sbjct  61   ANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNIYQGSI  120

Query  520  AFAPYGSYWRV  552
            + APYG+YWR+
Sbjct  121  SLAPYGNYWRM  131



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +1

Query  217  PGLVFLLAR--KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            P  +FLL R  K S++  RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG V+WL+IG
Sbjct  27   PVFLFLLIRRAKISATKRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLRQKYGPVLWLKIG  86

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            +V+TMAILSAK A   FKNHD +F+DRTVI+ M+   Y   SLA APYG YWR++
Sbjct  87   AVNTMAILSAKEATIFFKNHDHNFSDRTVIETMRAHNYDKSSLALAPYGPYWRLM  141



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+  LG  PH+ +A +  KYG +IWLR+GS+ TM ILS++ AAE FKN D++FADRT
Sbjct  15   IFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRT  74

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            VIDV++ + Y+ GS+A APYG+YWRV+
Sbjct  75   VIDVLRCRDYHEGSVAVAPYGTYWRVM  101



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAILSA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAE  91

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            AA   FK+HD +FADRT+ ++M+V  Y   SLA APYG YWR++
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLM  135



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 89/131 (68%), Gaps = 5/131 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKK--SSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            M+W W   V    FL+P +V L  R++   SS+ RLPPGP G PV GNM +LG  PH+TI
Sbjct  1    MDWIWTLCVG---FLVPFVVLLHYRRQRAGSSASRLPPGPRGWPVFGNMFELGPMPHKTI  57

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
            A +  ++G V+WLRIGS+ TM + +A AAA+LFKNHD SF +RT+ +VM+  G+   +++
Sbjct  58   AGLSREHGPVVWLRIGSIDTMVVQTAAAAADLFKNHDASFVERTITEVMRAHGFDRAAVS  117

Query  523  FAPYGSYWRVL  555
             +P G YWR +
Sbjct  118  LSPPGPYWRAM  128



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            ME+EW YL +S+  L+   +   ++KK++  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEYEWSYLFFSSTILLSIFILFFSKKKTTKCSYKLPPGPPGLPIFGNMFELGTEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR ++DV     YY GS A
Sbjct  61   ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPA  120

Query  523  FAPYGSYWR  549
             A YG +WR
Sbjct  121  LARYGPFWR  129



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAI SA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAE  91

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            AA   FK+HD +FADRT+ ++M+V  Y   SLA APYG YWR++
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLM  135



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A 
Sbjct  1    MEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR++ + M+V  Y   SL+ A
Sbjct  61   LRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSLA  120

Query  529  PYGSYWRVL  555
            PYG YWR L
Sbjct  121  PYGPYWRSL  129



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLL-----ARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            MEW  K L    I +  GLV LL      R ++ SS R PPGPPG P+ GNM DLG  PH
Sbjct  1    MEWTLKSLNPITIAISAGLVILLLISFIKRSRNGSSKRKPPGPPGWPIFGNMFDLGDLPH  60

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            QT+  +++KYG VIWL++GS++TM + +A AAAELFK HDV FADR V D +    +  G
Sbjct  61   QTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKHDVPFADRKVPDALTAFEFNQG  120

Query  514  SLAFAPYGSYWRVL  555
            SL    +G +WRVL
Sbjct  121  SLGMNTFGGHWRVL  134



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 5/132 (4%)
 Frame = +1

Query  169  MEWEWKY--LVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQ  336
            M+WE  Y  ++ S I  +   +FL+ +KKSS S + LPPGP GLP+ GNM DL G+ P++
Sbjct  1    MDWELNYFYILCSTIIFLLAFIFLIYQKKSSFSKFNLPPGPNGLPIFGNMFDLAGSEPYK  60

Query  337  TIAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
             IA +K+KYG ++WL+IG S++TM I +A ++ ELFKNHD  F+DR +IDV     +Y G
Sbjct  61   KIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELFKNHDAIFSDRNIIDVNLAHNFYKG  120

Query  514  SLAFAPYGSYWR  549
            S+A APYG+YWR
Sbjct  121  SMALAPYGNYWR  132



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  166  EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            +MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A
Sbjct  530  QMEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLA  589

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR++ + M+V  Y   SL+ 
Sbjct  590  GLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSL  649

Query  526  APYGSYWRVL  555
            APYG YWR L
Sbjct  650  APYGPYWRSL  659


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST+ I S + A E+FKNHDV  A R 
Sbjct  62   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  121

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + + MK      GS+  A YG  WR+L
Sbjct  122  IYEAMKGDRGNEGSIITAQYGPQWRML  148



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A ++ KYG  IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+
Sbjct  2    PHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYH  61

Query  508  MGSLAFAPYGSYWRVL  555
             GS+A APYG+YWRV+
Sbjct  62   EGSVAVAPYGTYWRVM  77



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQT+ +++ KYG V+WLR+GS +TM I SA AA ELFKNHD SF DR+
Sbjct  42   VIGNIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNHDSSFCDRS  101

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             +DV+    Y  GSLA   YG +WRVL
Sbjct  102  SLDVLTSHNYCKGSLAIGRYGPFWRVL  128



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWE  YL +S+I L+   +F+L   K +S+Y LPPGPPGLPV GNM +LG   ++ +A 
Sbjct  1    MEWELSYLFFSSIILLS--IFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMAA  58

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR  +DV     YY GS A 
Sbjct  59   LKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQVDVNSAHNYYQGSPAL  118

Query  526  APYGSYWR  549
            A YG +WR
Sbjct  119  ARYGPFWR  126



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A ++ KYG VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y 
Sbjct  2    PHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYC  61

Query  508  MGSLAFAPYGSYWRV  552
             GS+A APYG+YWRV
Sbjct  62   KGSIALAPYGTYWRV  76



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVL
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVL  133



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVL
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVL  133



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +1

Query  169  MEWEWK-YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQT  339
            M+WE+  Y++ S I  +   +FL+ +K SS S Y LPPGP GLP+ GN  DL G+ P++ 
Sbjct  1    MDWEFNFYILCSTIIFLLAFIFLIYQKNSSFSKYNLPPGPNGLPIFGNXFDLAGSEPYKK  60

Query  340  IAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
            IA +K+KYG ++WL+IG S++ M I ++ +++ELFK HDV+F+DR ++DV     +Y GS
Sbjct  61   IASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNIVDVNLAHNFYKGS  120

Query  517  LAFAPYGSYWR  549
            +A APYG+YWR
Sbjct  121  MALAPYGNYWR  131



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  223  LVFLLARK-KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            L+ L  RK +  ++ R PPGP   P+ GN+LDLG+ PH+T+ +++ KYG V+WLR+G  +
Sbjct  22   LLLLNQRKARHGANRRRPPGPKAWPIFGNILDLGSMPHRTLYKLRFKYGPVLWLRLGCAN  81

Query  400  TMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            T+ I SAKAA ELFKNHD++F+DR V +      YY GSL+   YGSYWR L
Sbjct  82   TLVIQSAKAAEELFKNHDITFSDRKVAESWTAHNYYQGSLSLGRYGSYWRFL  133



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            S  FL+  ++F+ AR++SS   R PPGPPG P+ GNM DLG  PHQT+ ++++KYG ++W
Sbjct  16   SVGFLLLLVIFVKARRRSSK--RTPPGPPGWPIFGNMFDLGDLPHQTLYKLRSKYGPIVW  73

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVL
Sbjct  74   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVL  132



>gb|KCW84357.1| hypothetical protein EUGRSUZ_B012102, partial [Eucalyptus grandis]
Length=166

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + ++G V WL++GSV+TM I SA+AAAE FK HD++FADR 
Sbjct  40   VIGNILDLGIMPHQNLHSFRAEHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDLAFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +   GY  GSLA   YG YWRVL
Sbjct  100  CPHALTALGYDQGSLAVGRYGGYWRVL  126



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            RK ++ + RLPPGPPG P+ GN+  LG  PH+T+A+++ K+G V+WL+IG++ TM ILSA
Sbjct  26   RKTAARNRRLPPGPPGWPIFGNLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSA  85

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             AA+  FK+HD +FADRT+ + M+   Y   SLA APYG YWR++
Sbjct  86   DAASVFFKHHDHAFADRTITETMRAHNYNKSSLALAPYGPYWRLM  130



>emb|CBI30232.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  10   LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  68

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  69   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  128

Query  541  YWRVL  555
            YWR L
Sbjct  129  YWRTL  133



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS   PPGPPG P+ GNM DLG  PHQT
Sbjct  1    MEWTFDSVNPVTIAVSAGFLLLLVIFVKGRSGSSKSKPPGPPGWPIFGNMFDLGDLPHQT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            + + ++KYG V+WLR+GS++TM + +A +AAELFK HDV F+DR V D +    +  GSL
Sbjct  61   LYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKHDVPFSDRKVPDTLTAFQFNQGSL  120

Query  520  AFAPYGSYWRVL  555
                YG +WRVL
Sbjct  121  GMNTYGGHWRVL  132



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  8    VIGNILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  67

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +   GY  GSLA   YGSYWRVL
Sbjct  68   CPHALTALGYDQGSLAIGRYGSYWRVL  94



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V D +  + YY GSLAF  YG YWR+L
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRIL  132



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  122

Query  541  YWRVL  555
            YWR L
Sbjct  123  YWRTL  127



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  122

Query  541  YWRVL  555
            YWR L
Sbjct  123  YWRTL  127



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V D +  + YY GSLAF  YG YWR+L
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRIL  132



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V D +  + YY GSLAF  YG YWR+L
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRIL  132



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  301  GNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRT  474
            GNM DL G+ P++ IA +K KYG ++WL+IGS ++TM I +A +A+ELF+NHDVSF+DR 
Sbjct  2    GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP  61

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++DV     YY GS+A APYG+YWR
Sbjct  62   IVDVNLAHNYYKGSMALAPYGNYWR  86



>emb|CBI30229.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL   K +  S +  P  P   P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  58   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  117

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            +WL++G+++TM + SAKAAAELFKNHD+SF+DR V   +    Y  GS+A   YG YWR+
Sbjct  118  LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  177

Query  553  L  555
            +
Sbjct  178  I  178



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS R PPGPPG P+ GNM DLG  PHQ+
Sbjct  1    MEWTFDSVNSVTIAVSAGFLLLLVSFVKARSGSSKRRPPGPPGWPIFGNMFDLGDLPHQS  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            + ++++KYG ++WL++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL
Sbjct  61   MYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFDFNRGSL  120

Query  520  AFAPYGSYWRVL  555
                YG +WRVL
Sbjct  121  GMNTYGGHWRVL  132



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  226  VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM  405
            VF    KK+S SY+LPPGP GLP++GNM DLG  PH  +  M+N+YG V+WL+IG+++T+
Sbjct  20   VFFFLLKKTSRSYKLPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTL  79

Query  406  AILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             I SA+AA   FKNHD +F +R V++V +V  Y  GSLA APYG+YWR+L
Sbjct  80   VIQSAQAATAFFKNHDANFLERVVVEVNRVCNYLQGSLALAPYGNYWRML  129



>gb|KCW84346.1| hypothetical protein EUGRSUZ_B011962, partial [Eucalyptus grandis]
Length=169

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                    GY  GSLA   +G YWR L
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRAL  126



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL L +    S+   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            +WL++G+++TM + SAKAAAELFKNHD+SF+DR V   +    Y  GS+A   YG YWR+
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  553  L  555
            +
Sbjct  131  I  131



>emb|CDP15345.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +1

Query  232  LLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAI  411
            L+ R+  S   R PPGP G P+ GNM +LG  PHQT+   KNKYG V+WL++GS++TM +
Sbjct  32   LIKRRFGSPDKRRPPGPLGWPIFGNMFELGELPHQTMYRWKNKYGPVMWLQLGSINTMVV  91

Query  412  LSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             +A AAAELFK HDV FADR V D +    +  G+L    +G +WRVL
Sbjct  92   QNATAAAELFKKHDVPFADRKVPDTLTAFDFNQGTLGMNTFGGHWRVL  139



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +1

Query  220  GLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            G +FLLA   + ++ SS R PPGPPG PV GNM DLG  PHQT+ ++++KYG ++WL++G
Sbjct  18   GFLFLLAIFLKSRTGSSKRRPPGPPGWPVFGNMFDLGDLPHQTLYKLRSKYGPIVWLQLG  77

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            S++TM + +A AA ELFK HDV F DR V D +    +   SL    YG +WRVL
Sbjct  78   SINTMVVQNAVAAGELFKKHDVPFCDRKVPDTLTTFNFNSSSLGMNTYGGHWRVL  132



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL   K +  S +  P  P   P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLHRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            +WL++G+++TM + SAKAAAELFKNHD+ F+DR V   +    Y  GS+A   YG YWR+
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLPFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  553  L  555
            +
Sbjct  131  I  131



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +   GY  GSLA   YG YWRVL
Sbjct  99   CPHALTALGYDQGSLAIGRYGGYWRVL  125



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 4/133 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLAR----KKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            MEW+   LV+S + L    + L+      K ++ S +LPPGPPG P+ GNM DLG+ P++
Sbjct  1    MEWDLILLVFSTVCLATAFLLLIPSRIKPKPNAGSRKLPPGPPGWPLFGNMFDLGSTPNE  60

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
             +A +  KYG V+WLR+G  +T+ I S +AA E+FKNHD++F +R + + ++V  Y+ G+
Sbjct  61   ALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRNITEALRVHSYHQGA  120

Query  517  LAFAPYGSYWRVL  555
            ++   YG YWR+L
Sbjct  121  ISTMNYGPYWRML  133



>gb|KCW84356.1| hypothetical protein EUGRSUZ_B01208 [Eucalyptus grandis]
Length=441

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                M    Y  GSLA   YG YWRVL
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVL  125



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                M    Y  GSLA   YG YWRVL
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVL  125



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+
Sbjct  2    PHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYH  61

Query  508  MGSLAFAPYGSYWRVL  555
              SLA APYG +WR L
Sbjct  62   ESSLALAPYGPHWRSL  77



>gb|KDP24879.1| hypothetical protein JCGZ_25132 [Jatropha curcas]
Length=160

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V  V+    Y  GSLA   +G YWR L
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTL  130



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS I L+P L+ L+ +KKSSS + +LPPGPPGLP+ GNM DL G+ P++  
Sbjct  1    MELEWSYIFWSIIILLPALILLITKKKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPYKKA  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IG S++T+ + +A+AAAELFKNHDV+FADR ++DV      +  S+
Sbjct  61   ANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFADRYIVDVNLAHNNHQASM  120

Query  520  AFAPYGSYWRVL  555
            A APYG+YWR+L
Sbjct  121  ALAPYGNYWRML  132



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+L LG+ PH+T+  ++ KYG V+WL +G  +T+ I SAKAA ELFKNHD++F+DR 
Sbjct  47   IFGNILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNHDITFSDRK  106

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V +      YY GSLAF  YGSYW+ L
Sbjct  107  VPESWTAHNYYQGSLAFGRYGSYWQFL  133



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                    GY  GSLA   +G YWR L
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRAL  126



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +    Y  GSLA   YG YWRVL
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVL  125



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 75/129 (58%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  MEWEWKYL-VWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTI  342
            MEW +  L  W +   +  +  LL  +KS S  +L P  P    + GN+ +LG  PHQ +
Sbjct  1    MEWRYSNLFTWFSFLFLATVFLLLKHRKSKSGAKLRPPGPKPWLIFGNIFNLGTTPHQNL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             + + KYG ++WLR+GS++T+ I SAKAA ELFKNHD SF DR V +      Y   S++
Sbjct  61   YKYRFKYGPILWLRLGSINTLVIQSAKAAEELFKNHDFSFCDRKVPECYTAHNYNQSSVS  120

Query  523  FAPYGSYWR  549
               YGS WR
Sbjct  121  LGQYGSRWR  129



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V GNM +LG  PHQT+ ++++KYG ++WLR+GS+ T+ + S  AAAELFK HDV+F+DR 
Sbjct  46   VFGNMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKHDVAFSDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V D +    +  GSL    YG +WRVL
Sbjct  106  VPDALTAFNFNAGSLGMNAYGGHWRVL  132



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                    GY  GSLA   +G YWR L
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRAL  126



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AA E FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +    Y  GSLA   YG YWRVL
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVL  125



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG   HQ +  ++ K+G V+WL++GSV+T+AI SA+AA ELFK HD  FADR 
Sbjct  40   VIGNILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                +   GY  GSLA   YG YWR L
Sbjct  100  CPHALTALGYDQGSLAVGRYGDYWRAL  126



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = +1

Query  190  LVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            L W + +F +  +V L  R+    + + PPGPP  P+IGN+ DLGA PHQ + ++  KYG
Sbjct  10   LAWFTLLFSVTIVVLLKKRRPRHDAKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYG  69

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             V+WLR+G ++TM I SAKAA ELFK+HD+SF DR V      + Y   +LA   Y S+W
Sbjct  70   PVLWLRLGYINTMVIQSAKAAEELFKHHDISFCDRKVPQSFTARNYCKAALALGRYDSHW  129

Query  547  R  549
            R
Sbjct  130  R  130



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V  V+    Y  GSLA   +G YWR L
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTL  130



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW    +   AI +  GL+ L+   +  +S + PPGP G+P+ GN+L LG  PH+T+ +
Sbjct  1    MEWALTSINPLAISIFAGLLLLVLFLRPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHK  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K  YG VIWL++GSV TM +  A +A+ELFK HD+ FADR V DV+    +  G+L   
Sbjct  61   WKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADRKVPDVLTAYDFNQGTLGMN  120

Query  529  PYGSYWRVL  555
             +G +WRVL
Sbjct  121  QFGGHWRVL  129



>ref|XP_006381328.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
 gb|ERP59125.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
Length=343

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V GN+ DLGA PHQT+ ++K KYG VIWL++G  +T+ I SA+ AA LFKNHD++F+DR 
Sbjct  19   VFGNIFDLGAIPHQTLYKLKEKYGPVIWLKLGYTNTLVIQSAETAAGLFKNHDLAFSDRK  78

Query  475  VIDVMKVQGYYMGSLAFA  528
            V+ V     YY GSLA A
Sbjct  79   VLLVFTAHNYYQGSLALA  96



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            ++ +F++  +V L  R+   ++ + PPGPP  P+IGN+ DLG  PHQ + +++ KYG V+
Sbjct  16   FTLLFVLTIVVLLKKRRPRHNAKQRPPGPPAWPIIGNIFDLGGNPHQNLYKLRFKYGPVL  75

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            WLR+G ++T+ I S KAA ELFK HD+SF+DR V        +   SLA   Y S+WR
Sbjct  76   WLRLGCINTLVIQSTKAAEELFKRHDISFSDRKVPQSFTAHNFNKASLALGQYDSHWR  133



>gb|KDP26150.1| hypothetical protein JCGZ_22831 [Jatropha curcas]
Length=162

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG   H+ + E K KYG V+ LRIGS+ T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFYLGTLAHRILYEHKFKYGPVLRLRIGSMDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V  V     Y  GSLA   +G YWR L
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTL  130



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            + R+  S ++ LPPGPPG P+ GNM DLG  PH+T+ E+  K+G VIWLR+G+ +TM++ 
Sbjct  23   IRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQ  82

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            SAKAA+E FKNHD+SFA+RT  +V +V  Y+ G L
Sbjct  83   SAKAASEFFKNHDLSFANRTTNEVCRVYDYHKGRL  117



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG  PH+ + + + KYG V+WLR+G  +T+ I SA+AA ELFKNHD+SF DR 
Sbjct  56   IFGNIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDRK  115

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
            V D      Y  G+++   YGS WR
Sbjct  116  VPDCCTAHNYDQGAVSLGRYGSIWR  140



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            +GN+ DLG  PHQT  +++ KYG VIWL++G+V+TM + SA+ A ELFK  D+ FADR  
Sbjct  45   VGNIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADRKA  104

Query  478  IDVMKVQGYYMGSLAFAPYGSYWRVL  555
             D +    Y+ GS+A   Y  YWR L
Sbjct  105  PDSLTALDYHQGSVAIGAYREYWRTL  130



>gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LRIGSV T+ I SAKAA ELFKNHD SF  RT
Sbjct  44   LVGNIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNHDASFCART  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V  V     Y  GSLA   +G YWR L
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTL  130



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 5/129 (4%)
 Frame = +1

Query  178  EWKY----LVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            E++Y    L W + +F +   V L  R+    + + PP PPG P+IGN+ DLGA PHQ +
Sbjct  2    EFRYSTYSLAWFTLLFSVTIAVLLTKRRPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNL  61

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++  KYG V+WLR+G ++TM I SAKAA ELF++HD+SF DR V        Y   +LA
Sbjct  62   YKLGIKYGPVLWLRLGYINTMVIQSAKAAEELFRHHDISFCDRKVPQSFTACNYSKAALA  121

Query  523  FAPYGSYWR  549
               Y S+WR
Sbjct  122  LGRYDSHWR  130



>gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza]
Length=503

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L W  I  +  L+F    K  SS  RLPPGPPG P+IGN+ DLG  PH+    ++++YG 
Sbjct  7    LTWFTISFLVALLFWFKLKNRSSKLRLPPGPPGWPIIGNIFDLGTQPHRDFHILQSRYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V+WL++G+++T+ + SA AAAELFK +D++FADR   D M    Y  GSLA APY  YWR
Sbjct  67   VLWLKLGNLNTVVVQSAAAAAELFKRNDLAFADRKTPDSMTACDYINGSLAQAPYNEYWR  126

Query  550  VL  555
            +L
Sbjct  127  IL  128



>gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  304  NMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVID  483
            N+ DLG   H+ + E+K KYG V+ LRIG V T+ I SAKA  ELFKNHD SF DRTV  
Sbjct  47   NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRTVPC  106

Query  484  VMKVQGYYMGSLAFAPYGSYWRVL  555
            V+    Y  GS+A   +G YWR +
Sbjct  107  VLTSHNYKEGSIAVGRFGPYWRTI  130



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 5/131 (4%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFL----LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            + + + +++IF +   VF+    L +K  SS+  LPPGP  LP+IGN+ +L G+ PH  +
Sbjct  2    DLQIICFTSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIGSLPHHRL  61

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++  KYG ++ L++G VST+ + SA+ A E+ KNHD+ FA R  I   K+  Y    LA
Sbjct  62   RDLSTKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLA  121

Query  523  FAPYGSYWRVL  555
            FAPYG YWR L
Sbjct  122  FAPYGDYWRNL  132



>gb|ADD91442.1| cytochrome P450 [Nicotiana tabacum]
Length=252

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL--ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            LV +++FL    VFL+  A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+Y
Sbjct  5    LVVASLFL---FVFLILSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEY  61

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G  I+L++GSV T+ + SA  A E+F+  D+ F+ R  +   K   Y   +++FAPYG+Y
Sbjct  62   GDFIFLQLGSVPTVVVFSAGIAREIFRTQDLVFSGRPALYAGKRFSYNCCNVSFAPYGNY  121

Query  544  WR  549
            WR
Sbjct  122  WR  123



>ref|XP_002310636.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
 gb|EEE91086.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
Length=509

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PHQ + +M NKYG V+ L+IG V T+ I S +AA E  K H+++F DR
Sbjct  48   LIGNLHQLLGSLPHQVLRDMANKYGPVMQLQIGEVPTVIISSPEAAKEAIKTHEINFVDR  107

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V KV  Y    +AFAPYG YWR
Sbjct  108  PCLLVAKVMFYNSKDIAFAPYGDYWR  133



>gb|EYU22208.1| hypothetical protein MIMGU_mgv1a024264mg [Erythranthe guttata]
Length=468

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            I LIP +  LL +KK++    LPPGP  LP+IGN+  LG  PH+T+  +  KYG++++L+
Sbjct  14   ITLIPFICVLLIKKKTN----LPPGPKKLPIIGNLHQLGKLPHRTLRNLSKKYGNLMFLQ  69

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            +G V T+ I SA  A E+FK+HD+ F+ R  +   K   Y  GS++FAPYG YWR
Sbjct  70   LGFVPTIVISSADVAREVFKSHDLVFSGRPSLYGAKKISYDFGSISFAPYGEYWR  124



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNK  360
            YL +   F++  L+    RKK S S+Y +PPGP  LP+IGN+ +L  + PHQ + ++  K
Sbjct  7    YLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLSSQPHQKLRDLAKK  66

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+ L++G VS M I S + A+E+ K HD+ F+ R  I   ++  Y   S+AFAPYG+
Sbjct  67   YGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFAPYGN  126

Query  541  YWRVL  555
            YWR L
Sbjct  127  YWRQL  131



>dbj|BAH84782.1| cytochrome P450 [Nicotiana tabacum]
 gb|ADD91443.1| cytochrome P450 [Nicotiana tabacum]
Length=500

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL--ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            LV +++FL    VFL+  A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+Y
Sbjct  5    LVVASLFL---FVFLILSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEY  61

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G  I+L++GSV T+ + SA  A E+F+  D+ F+ R  +   K   Y   +++FAPYG+Y
Sbjct  62   GDFIFLQLGSVPTVVVFSAGIAREIFRTQDLVFSGRPALYAGKRFSYNCCNVSFAPYGNY  121

Query  544  WR  549
            WR
Sbjct  122  WR  123



>gb|KDP39088.1| hypothetical protein JCGZ_00845 [Jatropha curcas]
Length=460

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIA  345
            ME+  ++ ++SA+      +FLL RK  +SS +  PGP  LP+IGNM  L G+ PH  + 
Sbjct  1    MEYLQQFSIFSALVTFLLFIFLLQRKPKTSSRKSAPGPWKLPIIGNMHQLLGSLPHHRLK  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++ +KYGSV+ L++G VS + I S +AA ++ K HD+ F  R  +    +  Y    + F
Sbjct  61   DLSDKYGSVMNLQLGQVSNIVISSPEAAKQVMKTHDIIFVQRPFLLAANIIMYNSKDIVF  120

Query  526  APYGSYWRVL  555
            APYG  WR +
Sbjct  121  APYGDSWRQM  130



>ref|XP_004248583.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
lycopersicum]
Length=469

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              I V  + GY    + F+PYG +WR L
Sbjct  105  PKILVADIIGYNSTQITFSPYGDHWRQL  132



>ref|XP_011014080.1| PREDICTED: cytochrome P450 71D11-like [Populus euphratica]
Length=508

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PHQ + +M +KYG V+ L+IG V T+ I S +AA E  KNH+++F DR
Sbjct  47   LIGNLHQLLGPLPHQVLRDMASKYGPVMQLQIGEVPTVIISSPEAAKEAMKNHEINFVDR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V +V  Y    +AFAPYG YWR
Sbjct  107  PCLLVAEVMFYNSKDIAFAPYGDYWR  132



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              I V  + GY    + F+PYG +WR L
Sbjct  105  PKILVADIIGYNSTQITFSPYGDHWRQL  132



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              I V  + GY    + F+PYG +WR L
Sbjct  105  PKILVADIIGYNSTQITFSPYGDHWRQL  132



>ref|XP_003630839.1| Cytochrome P450 [Medicago truncatula]
 gb|AET05315.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=283

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +L+++ IF++  +   L RK+     R PPGP G PVIGN+  LG  PH+ +  +  K+G
Sbjct  9    FLIFTLIFILSAITLFLRRKQPKYDRRQPPGPRGYPVIGNLHLLGTLPHRALQALSKKHG  68

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             ++ LR+G V T+ + S+ AA +  K HDV F+ R  ++      Y    L FA YG+YW
Sbjct  69   PIMLLRLGQVPTIIVSSSSAAEQFLKTHDVVFSSRPKLEATHYLSYGSKGLVFAEYGAYW  128

Query  547  R  549
            R
Sbjct  129  R  129



>ref|XP_011047544.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Populus euphratica]
Length=508

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PHQ + +M +KYG V+ L+IG V T+ I S +AA E  KNH+++F DR
Sbjct  47   LIGNLPQLLGPLPHQVLRDMASKYGPVMQLQIGEVPTVIISSPEAAKEAMKNHEINFVDR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V KV  Y    + FAPYG YWR
Sbjct  107  PCLLVAKVMYYNSKDVGFAPYGDYWR  132



>ref|XP_006350771.1| PREDICTED: cytochrome P450 71A9-like, partial [Solanum tuberosum]
Length=496

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH+++ ++ N+YG +I+L++GS+ T+ + SA  A E+F+ HDV+FA R 
Sbjct  35   IIGNLHQLGKLPHRSLQKLSNEYGDLIFLQLGSIPTLLVSSADVAKEIFRVHDVAFAGRP  94

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             +   K   Y   +++FAPYG+YWR
Sbjct  95   PLYAAKRLSYNCCNVSFAPYGNYWR  119



>ref|XP_011012702.1| PREDICTED: cytochrome P450 71D11-like [Populus euphratica]
Length=515

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PHQ + +M +KYG V+ L+IG VST+ I S +AA E  K H+++F DR
Sbjct  47   LIGNLHQLLGSLPHQVLRDMASKYGPVMQLQIGEVSTVIISSPEAAKEAMKTHEINFVDR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V KV  Y    + FAPYG YWR
Sbjct  107  PCLLVAKVMFYNSKDIGFAPYGDYWR  132



>ref|XP_009620580.1| PREDICTED: cytochrome P450 71A9-like [Nicotiana tomentosiformis]
Length=500

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL--ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            LV +++FL    VFL+  A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+Y
Sbjct  5    LVVASLFL---FVFLILSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEY  61

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G  I+L++GSV T+ + SA  A E+F+  D+ F+ R  +   K   Y   +++FAPYG+Y
Sbjct  62   GDFIFLQLGSVPTVVVSSAGIAREIFRTQDLVFSGRPALYAGKRFSYNCCNVSFAPYGNY  121

Query  544  WR  549
            WR
Sbjct  122  WR  123



>ref|XP_006841384.1| hypothetical protein AMTR_s00181p00056510 [Amborella trichopoda]
 gb|ERN03059.1| hypothetical protein AMTR_s00181p00056510 [Amborella trichopoda]
Length=504

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++W+ +F +  L   L  K+S +  +LPPGP GLP+IGN+  LG+ PH+++A +   YG 
Sbjct  9    ILWTFLFSVLSLQLFLLWKRSGTRKKLPPGPIGLPIIGNLHQLGSMPHRSLAHLAEGYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ LRIG V T+ + S+K A ++ K HD++F  R  +   K   Y    + FAPYGSYWR
Sbjct  69   LMHLRIGQVPTLVVSSSKMAEQVMKAHDLAFCSRPTLLSPKRLTYNCSDIIFAPYGSYWR  128



>ref|XP_004506715.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=507

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  211  LIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRI  387
            L+  +V  + +KKS S+Y LPPGP  LP+IGN+ +L  + PH+ + ++  KYG ++ L++
Sbjct  16   LLTLIVQKIRKKKSYSTYNLPPGPIKLPIIGNIHNLLSSQPHKKLRDLAKKYGPLMHLQL  75

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            G VST+ I S + A+E+ K HD++FA R  I   ++  Y   ++AFAPYG+YWR L
Sbjct  76   GEVSTIIISSPECASEVMKTHDINFASRPQILATEIMSYNTTNIAFAPYGNYWRQL  131



>ref|XP_003636948.1| Cytochrome P450 [Medicago truncatula]
Length=333

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +1

Query  184  KYLVWSAIFLIPGLVFLL----ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAE  348
            + L +++IF +   VF++     +K +SS+  LPPGP  LP+IGN+ +L G+ PH  + +
Sbjct  4    QTLYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLPHHRLRD  63

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +  KYG ++ L++G VST+ + SA+ A E+ K HD+ FA R  I   K+  Y    L+F+
Sbjct  64   LSTKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFS  123

Query  529  PYGSYWRVL  555
            PYG YWR L
Sbjct  124  PYGDYWRQL  132



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + G++  LG FPHQ + ++ NKYG ++++R+G V T+ + S +AA  + K HD+ FA+R 
Sbjct  40   IFGSLHLLGKFPHQDLHQLANKYGPIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRP  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
              +  K   Y   SL+FAPYGSYWR
Sbjct  100  PNEAAKHISYEQKSLSFAPYGSYWR  124



>ref|XP_006854378.1| hypothetical protein AMTR_s00039p00170480 [Amborella trichopoda]
 gb|ERN15845.1| hypothetical protein AMTR_s00039p00170480 [Amborella trichopoda]
Length=492

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+  LG  PHQ++A +  +YG +++L++GSV T+ + SA+ A E+ K  D++FA+R 
Sbjct  40   VIGNLHQLGELPHQSLARLSQQYGRLMFLKLGSVPTIVVSSAEIAKEVMKTQDLAFANRP  99

Query  475  VIDVMKVQGYYMGS-LAFAPYGSYWR  549
            V+ V   Q +Y G+ +AF+PYG YWR
Sbjct  100  VL-VAAEQLFYGGTDVAFSPYGEYWR  124



>gb|KHG11226.1| Cytochrome P450 [Gossypium arboreum]
Length=508

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH ++  + NK+G VI+L++G + TM + SAK A ++ K HD++ ++R 
Sbjct  49   IIGNLHQLGTMPHLSLRRLSNKFGPVIYLQLGQIPTMVVSSAKLAKQVMKTHDLALSNRP  108

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             I   K+  Y    +AFAPYG+YWR
Sbjct  109  PIFSAKLLFYDCTDIAFAPYGAYWR  133



>ref|XP_002310634.2| hypothetical protein POPTR_0007s07300g [Populus trichocarpa]
 gb|EEE91084.2| hypothetical protein POPTR_0007s07300g [Populus trichocarpa]
Length=512

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PHQ + +M NKYG V+ L+IG V T+ I S +AA E  K  +++F DR
Sbjct  51   LIGNLHQLLGSLPHQVLRDMANKYGPVMQLQIGEVPTVIISSPEAAKEAMKTQEINFVDR  110

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V KV  Y    + FAPYG YWR
Sbjct  111  PCLLVAKVMYYNSKDIGFAPYGDYWR  136



>gb|EYU21984.1| hypothetical protein MIMGU_mgv1a019764mg, partial [Erythranthe 
guttata]
Length=234

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGNM +L G+ PH+ + E+  KYG V+ L++G +ST+ I S+ AA ++ K HD++FA R
Sbjct  39   LIGNMHNLIGSLPHRALHELALKYGPVMHLQLGELSTVIISSSDAAKQVMKTHDMNFASR  98

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + V ++  Y   S+AFA YG YWR L
Sbjct  99   PSVIVTEILSYSCTSIAFAEYGDYWRQL  126



>ref|XP_011047545.1| PREDICTED: cytochrome P450 71D11-like isoform X2 [Populus euphratica]
Length=508

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PHQ + +M +KYG V+ L+IG V T+ I S +AA E  K H+++F DR
Sbjct  47   LIGNLHQLLGPLPHQVLRDMASKYGPVMQLQIGEVPTVIISSPEAAKEAMKTHEINFVDR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              + V KV  Y    + FAPYG YWR
Sbjct  107  PCLLVAKVMYYNSKDVGFAPYGDYWR  132



>gb|KJB27712.1| hypothetical protein B456_005G005900 [Gossypium raimondii]
Length=498

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGNM  L G+ PHQT+A M   YGS+I L+ GS+S + I S + A E  K +D+SFA R
Sbjct  39   LIGNMHQLVGSLPHQTLANMAKTYGSLIHLKTGSISYIVISSPELAEEALKTNDISFASR  98

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              I   K+  Y   ++ F+PYGSYWR L
Sbjct  99   PTILASKIMSYDSTNIVFSPYGSYWRHL  126



>ref|XP_003600322.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=499

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 80/127 (63%), Gaps = 5/127 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL----ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            L +++IF +   VF++     +K +SS+  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    LYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLPHHRLRDLS  65

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
             KYG ++ L++G VST+ + SA+ A E+ K HD+ FA R  I   K+  Y    L+F+PY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPY  125

Query  535  GSYWRVL  555
            G YWR L
Sbjct  126  GDYWRQL  132



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W++I+++    F + R    ++Y+LPPGP  LP+IGN+L+LG  PH+++AE+   YG ++
Sbjct  14   WTSIYIM----FSVRRGSQHTAYKLPPGPVPLPIIGNLLNLGNRPHESLAELAKTYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             L++G V+T+ I SA  A E+ +  D+SF +R V D ++   +   S+A+ P  + WRVL
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRFVPDAIRATNHNQLSMAWMPVSTTWRVL  129



>ref|XP_010663828.1| PREDICTED: cytochrome P450 71A9-like [Vitis vinifera]
Length=511

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            ++KS +S RLPPGP  LP+IGN+  LG+ PH  +  + N+YG +++L++GSV T+ + SA
Sbjct  38   KRKSVASRRLPPGPKKLPLIGNLHQLGSLPHVGLQRLSNEYGPLMYLKLGSVPTLVVSSA  97

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
              A E+F+ HD+ F+ R      K   Y    + FAPYG YWR
Sbjct  98   DMAREIFREHDLVFSSRPAPYAGKKLSYGCNDVVFAPYGEYWR  140



>gb|EYU24235.1| hypothetical protein MIMGU_mgv1a005267mg [Erythranthe guttata]
Length=491

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             I LIP +  LL +KK++    LPPGP  LP+IGN+  LG  PH+T+  +  KYG +++L
Sbjct  13   TITLIPFIFVLLIKKKTN----LPPGPKKLPIIGNLHQLGKLPHRTLRNLSEKYGDLMFL  68

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++G V T+ I SA  A E+FK+HD+ F+ R  +   K   Y   SL+ APYG YWR
Sbjct  69   QLGFVPTIVISSADVAREIFKSHDLVFSGRPSLYGAKKISYDFRSLSLAPYGEYWR  124



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L +G+ PH ++A +  K+G ++ L++G +S + I S + A E+ K HD++FA+R 
Sbjct  46   IIGNLLQMGSLPHISLANLATKHGPLMHLKLGQLSAIVISSPQLAKEMMKTHDLTFANRP  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             + V K+  Y    +AF+PYG YW+
Sbjct  106  QLSVAKIMFYDCQDIAFSPYGDYWK  130



>ref|XP_004236286.1| PREDICTED: cytochrome P450 71A22-like [Solanum lycopersicum]
Length=522

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +1

Query  208  FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
             LI  LV  L   KS +   LPP PP LP IG+M  LG +PH ++ ++  +YG +++L++
Sbjct  26   LLISFLVMSLLMSKSKTKKNLPPSPPKLPFIGHMHKLGVYPHHSLHKLAQQYGPLMFLKL  85

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            GSV+T+ + SA+AA+E+ K HD+ F DR   +V K   Y    ++ APYG YWR
Sbjct  86   GSVNTLVVSSAEAASEIMKTHDLVFCDRPKSNVNKKLLYDFKDVSVAPYGEYWR  139



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L++ A +L+   V L  R K++ S +LPPGP  LP+IGN+L L   PH+++A++   +G 
Sbjct  11   LLFVATYLLVNHVILRGRSKNNGSTKLPPGPRPLPIIGNLLALRDKPHKSLAKLARVHGP  70

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ L++G V+T+ + S   A E+ + HD + ++R +ID ++ QG++   LA+ P G  WR
Sbjct  71   LVTLKLGQVTTVVVSSPATAREILQKHDATLSNRYIIDAIRAQGHHEAGLAWVPVGPTWR  130



>ref|XP_010102940.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB94458.1| Cytochrome P450 71A1 [Morus notabilis]
Length=534

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++  IFL+  L+F + +KK +   + LPP PP LP+IGN+  LG  PH ++  +  KYG 
Sbjct  10   LFPTIFLLVLLMFFILKKKPTKLEFNLPPSPPKLPIIGNLHQLGNNPHISLHHLAQKYGP  69

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            + +L +G + T+ I SA+ A E  K HD++FA R  +   K   Y    +AF+PYG+YWR
Sbjct  70   IFYLELGQIPTVIISSARLAKEALKTHDLAFASRPKLIAAKYLFYNCTDMAFSPYGAYWR  129



>ref|XP_009419066.1| PREDICTED: premnaspirodiene oxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  316  LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV  495
            LG  P++++A +  K+G+V+ L++G V T+ + S +AAAE+ K  DVSFA R +I  +++
Sbjct  51   LGPLPYRSLAALSEKFGAVMLLKLGEVPTLVVSSPEAAAEIMKTQDVSFASRPMISSVRI  110

Query  496  QGYYMGSLAFAPYGSYWR  549
             GY   S AFAPYGSYWR
Sbjct  111  IGYGDKSPAFAPYGSYWR  128



>ref|XP_004241226.1| PREDICTED: cytochrome P450 71A9-like [Solanum lycopersicum]
Length=504

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG  PH+++ ++ ++YG  I+L++GS+ T+ + SA  A E+F+ HDV+FA R 
Sbjct  42   IVGNLHQLGKLPHRSLQKLSHEYGDFIFLQLGSIPTLLVSSADVAKEIFRVHDVAFAGRP  101

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             +   K   Y   +++FAPYG+YWR
Sbjct  102  PLYAAKRLSYNCCNVSFAPYGNYWR  126



>ref|XP_011072187.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=498

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSS---SYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            I L   L FLL  KK      S RLPPGP  LP+IGN+  LG  PH+++  M  +YG ++
Sbjct  8    IMLFITLFFLLMLKKKRQVMISRRLPPGPKKLPIIGNLHQLGKLPHRSLQNMSQRYGDLM  67

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            +L++GSV  + + S   A ++FKNHD+ F+ R  +   K   Y + S++ APYG YWR
Sbjct  68   FLQLGSVPALVVSSPDMARDIFKNHDLVFSGRPPLYSAKRFTYNLSSISLAPYGEYWR  125



>gb|KEH34017.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIW  378
            +  L+  +V  +  KKS S+Y +PPGP  LP+IGN+ +L  + PH+ + ++  KYG ++ 
Sbjct  13   SFILLTLVVQKIGNKKSYSTYNIPPGPIKLPIIGNIHNLLTSQPHRKLRDLAKKYGPLMH  72

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            L++G VS M I S + A E+ K HD+ FA R  I   ++  Y   ++AFAPYG+YWR L
Sbjct  73   LQLGEVSAMVISSPECAGEVMKTHDIHFASRPQILATEIMSYNSTNIAFAPYGNYWRQL  131



>gb|AJD25161.1| cytochrome P450 CYP71BE37 [Salvia miltiorrhiza]
Length=498

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 2/131 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL--GAFPHQTI  342
            M++++  LV     L+P L+FL   +    + +LPPGP  LP++GNM ++  G  PH+ +
Sbjct  1    MDFQFPSLVLCIQILLPTLIFLTFIRNKKRNAKLPPGPWRLPLLGNMHNMISGDAPHRVL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++  K+G V+ L++G +S   I S +AA ++ K HD+ FA R+ I V ++  Y   S+ 
Sbjct  61   HKLSQKFGPVMHLQLGELSVAVISSPEAAKQVMKTHDIQFASRSPIIVAEIISYGSTSIT  120

Query  523  FAPYGSYWRVL  555
            F PYG YWR L
Sbjct  121  FGPYGEYWRQL  131



>ref|XP_007212458.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
 gb|EMJ13657.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
Length=331

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G+ PHQ + ++  KYG ++ L++G VST+ + SA+ A E+ K HD+ FA R
Sbjct  47   VIGNLHQLAGSLPHQRLRDLAKKYGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +  +++  Y    + FAPYG YWR L
Sbjct  107  PHVLAIRILSYDFTDIVFAPYGEYWRQL  134



>dbj|BAK04621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +1

Query  196  WSAIFLIPGLVFL------LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            W ++  I G   L      L+R+K++ + +LPPGP  LP+IG++L + GAFPH+TIAE+ 
Sbjct  4    WLSLCFIAGSTLLSIWFLVLSRRKNNPNKKLPPGPWTLPIIGSLLHVVGAFPHRTIAELS  63

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
             ++G ++ LR+G V+TM + SA+ AA + K +D++F+DR       + G     +AFAPY
Sbjct  64   RRHGPLMHLRLGEVATMVVSSAEVAALVMKTNDLTFSDRPRTVTQDIFGSGGKDIAFAPY  123

Query  535  GSYWR  549
            G  WR
Sbjct  124  GDAWR  128



>ref|XP_008439074.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=500

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG +PH+++ ++  KYGS+++L++GS  T+ + SA    E+FKNHD++F++R 
Sbjct  40   IIGNLHQLGRYPHRSLQDLSKKYGSLMFLQLGSTPTLVVSSADMVREIFKNHDITFSNRP  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
                  +  Y    + F+PYG YWR L
Sbjct  100  KSTAANLFFYGYKDVGFSPYGEYWRGL  126



>ref|XP_007146610.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
 gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
Length=508

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             RK+  ++ ++P GP  LP+IGN+ +L  + PH+ + ++  KYG ++ L++G VST+ I 
Sbjct  28   PRKRDETTSKIPHGPTKLPIIGNIHNLLSSQPHRKLRDLALKYGPLMHLQLGEVSTIVIS  87

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            S + A E+ K HD++FA R  +  M +  Y    +AFAPYG+YWR L
Sbjct  88   SPECAKEVMKTHDINFASRPKVPAMDLMTYNCTDIAFAPYGNYWRQL  134



>ref|XP_006351420.1| PREDICTED: cytochrome P450 71A22-like [Solanum tuberosum]
Length=518

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = +1

Query  208  FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
             LI  +V  L   KS +   LPP PP LP+IG+M  LG +PH ++ ++  +YG +++L++
Sbjct  22   LLISFVVMSLLMTKSKTKKNLPPSPPKLPLIGHMHKLGVYPHHSLHKLAQQYGPLMFLKL  81

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            GSV+T+ + SA+AA+E+ K HD+ F DR   +V K   Y    ++ APYG YWR
Sbjct  82   GSVNTLVVSSAEAASEIMKTHDLVFCDRPKSNVNKKLLYDFKDVSVAPYGEYWR  135



>ref|XP_003600327.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70578.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=493

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDL-GAFPHQTIAEMKNKY  363
            L +++IF+   +V  +  KKS+SS   LPPGP  LP IGN+ +L G+ PH  + ++  KY
Sbjct  6    LYFTSIFIFMFIVNKIVTKKSNSSTPNLPPGPLKLPFIGNIHNLIGSLPHHRLRDLSTKY  65

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G ++ L++G VST+ + SA+ A E+ K HD+ FA R  I   K+  Y    L+F+PYG Y
Sbjct  66   GPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPYGDY  125

Query  544  WRVL  555
            WR L
Sbjct  126  WRQL  129



>ref|XP_010061478.1| PREDICTED: cytochrome P450 71D9-like [Eucalyptus grandis]
 gb|KCW68420.1| hypothetical protein EUGRSUZ_F02072 [Eucalyptus grandis]
Length=507

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDLGA-FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGNM  LG   PH+T++E+  KYG ++ L++G VST+   S + A E+ K HDV FA R
Sbjct  46   IIGNMHQLGGPLPHRTLSELAKKYGPLMHLKMGEVSTVVFSSLETAKEVLKTHDVIFASR  105

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              I    +  Y   S+ FAPYG YWR L
Sbjct  106  PPILASSIISYDCTSITFAPYGEYWRQL  133



>emb|CDM87092.1| unnamed protein product [Triticum aestivum]
Length=508

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            R+ S+   RLPPGP   PV+GN+  LG  PHQ++ ++  ++G V+ L++G+V T+ + SA
Sbjct  32   RRPSNKGLRLPPGPAPAPVLGNLHQLGLLPHQSLRDLARRHGPVMQLQLGTVPTVVVSSA  91

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
            +AA E+ K HD     R V   MK   Y + ++ FAPYG YW
Sbjct  92   EAAREVMKTHDEDCCTRPVSPGMKRLSYGLNNVGFAPYGPYW  133



>ref|XP_003615665.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003615670.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98623.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98628.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +1

Query  229  FLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
            F L  K+++ +++ PPGPP LP+IGN+  LG  PH+T+  +  KYGS++ L++G V T+ 
Sbjct  22   FYLREKQNTINHKKPPGPPTLPIIGNLHMLGKLPHRTLQSLSKKYGSIMSLQLGQVPTIV  81

Query  409  ILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            I S+KAA    K HD++FA R      ++  Y    LAF+ YG YWR
Sbjct  82   ISSSKAAESFLKTHDINFASRPKTQASQLIFYGSKGLAFSEYGPYWR  128



>ref|XP_007210185.1| hypothetical protein PRUPE_ppa020002mg [Prunus persica]
 gb|EMJ11384.1| hypothetical protein PRUPE_ppa020002mg [Prunus persica]
Length=511

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +1

Query  205  IFLIPGLVFLL--ARKKSSSSY--RlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGS  369
            +FL+P + +LL   R+KSS+S   RLPPGP  LP+IGN+  L    PH  +  +  +YG 
Sbjct  12   VFLLPVIFWLLIKQRRKSSASQGRRLPPGPRRLPLIGNLHKLPNGLPHHVLEHLALQYGP  71

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            +++L++GS+ST+ + S   A+E+FK HD+ F+ R V+ V     Y   +LAFAPYG YWR
Sbjct  72   LMFLQLGSISTLVVSSDHMASEIFKTHDLVFSGRPVLYVANKLSYGCVNLAFAPYGEYWR  131



>ref|XP_003530792.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=512

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             +K   +++++P GP  LP+IGN+ +L  + PH+ + +M  KYG +++L++G VST+ I 
Sbjct  28   PKKTDDTTFKIPDGPRKLPIIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVIS  87

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            S + A E+ K HD++FA R  +  + +  Y   ++AFAPYG+YWR L
Sbjct  88   SPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQL  134



>gb|KHM99472.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             +K   +++++P GP  LP+IGN+ +L  + PH+ + +M  KYG +++L++G VST+ I 
Sbjct  28   PKKTDDTTFKIPDGPRKLPIIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVIS  87

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            S + A E+ K HD++FA R  +  + +  Y   ++AFAPYG+YWR L
Sbjct  88   SPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQL  134



>sp|O04164.1|C71A6_NEPRA RecName: Full=Cytochrome P450 71A6, partial [Nepeta racemosa]
 emb|CAA70576.1| cytochrome P450 [Nepeta racemosa]
Length=511

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  214  IPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGS  393
            +P L FL   ++S S    PP PP LPV+GN+  LG FPH+++  +  +YG V+ L  GS
Sbjct  9    LPFLFFLKKWRRSYSGKTPPPSPPKLPVLGNLHQLGTFPHRSLQSLSRRYGPVMQLHFGS  68

Query  394  VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V  +   S +AA E+ KN D++F++R  + + +   Y    +AFAPYG YWR
Sbjct  69   VPVLVASSPEAAREIMKNQDLNFSNRPNLSIPRRLLYDNHDVAFAPYGEYWR  120



>gb|KJB61440.1| hypothetical protein B456_009G358600 [Gossypium raimondii]
Length=416

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L     PH T+ ++  KYG+++ L++G +ST+ + SA+ A E+ K HD+ FA+
Sbjct  47   LIGNLHQLAGPGLPHHTLRDLATKYGAIMHLQLGQISTVVVSSAEMAKEIMKTHDIVFAN  106

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF PYG+YWR L
Sbjct  107  RPVLASAKILTYGCTDIAFTPYGNYWRNL  135



>ref|XP_006380104.1| hypothetical protein POPTR_0008s21950g [Populus trichocarpa]
 gb|ERP57901.1| hypothetical protein POPTR_0008s21950g [Populus trichocarpa]
Length=490

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 1/113 (1%)
 Frame = +1

Query  220  GLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSV  396
            G++F+      +S+  LPP P  LP+IGNM +L G+ PH    +M  KYG V+ LR+G V
Sbjct  2    GMLFIFLVIFKNSNLNLPPVPSQLPLIGNMHNLVGSLPHHRFRDMAKKYGPVMHLRLGEV  61

Query  397  STMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + + I SA+ A E+ K HD+ FA R      K+  Y    +AFAPYG YWR+L
Sbjct  62   THVLISSAETAKEVMKTHDLIFAQRPAPIAAKILSYNCMDIAFAPYGDYWRML  114



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +1

Query  298  IGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            IGN+ +L G+ PHQ +  +  K+G ++ L++G VS + + S ++A E+ K HD++FADR 
Sbjct  46   IGNLHNLLGSLPHQALTNLAKKHGDLMHLQLGEVSAIVVSSPRSAKEILKTHDLAFADRP  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             + V K+  Y   S+AF PYG YWR
Sbjct  106  EVLVGKIICYDYSSIAFCPYGEYWR  130



>ref|XP_006841385.1| hypothetical protein AMTR_s00181p00057690 [Amborella trichopoda]
 gb|ERN03060.1| hypothetical protein AMTR_s00181p00057690 [Amborella trichopoda]
Length=506

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K+S +  ++PPGP GLP+IGN+  LG+ PH T+A +   YG +I L++G V T+ + SAK
Sbjct  27   KRSGTKKKVPPGPSGLPIIGNLHQLGSMPHLTLARLAETYGPLIHLKMGQVPTLVVSSAK  86

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
             A E+ K HD++F  R  +   +   Y    + FAPYG YWR
Sbjct  87   MAEEIMKTHDLTFCSRPALLSPRHLHYECSGIVFAPYGPYWR  128



>ref|XP_002466122.1| hypothetical protein SORBIDRAFT_01g001820 [Sorghum bicolor]
 gb|EER93120.1| hypothetical protein SORBIDRAFT_01g001820 [Sorghum bicolor]
Length=514

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PHQ + E+  ++G V+ LR+G+V  + + SA+AA E+ K HDV    R 
Sbjct  46   VLGNLHLLGPLPHQNLRELARRHGPVMLLRLGTVPAVVVSSAEAAREMLKAHDVDCCSRP  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            V    K   Y +  +AFAPYG YWR +
Sbjct  106  VSPGSKRLSYDLKDVAFAPYGEYWREM  132



>ref|NP_001239692.1| cytochrome P450 71A9 precursor [Glycine max]
 sp|O81970.1|C71A9_SOYBN RecName: Full=Cytochrome P450 71A9; AltName: Full=Cytochrome 
P450 CP1 [Glycine max]
 emb|CAA71513.1| putative cytochrome P450 [Glycine max]
Length=499

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+  LG  PHQ++  + NK+G +++L++GS+ T+ + SA+ A E+FKNHD  F+ R  
Sbjct  43   IGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGRPS  102

Query  478  IDVMKVQGYYMGSLAFAPYGSYWR  549
            +      GY   +++FAPYG YWR
Sbjct  103  LYAANRLGYG-STVSFAPYGEYWR  125



>gb|ACU20174.1| unknown [Glycine max]
Length=499

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+  LG  PHQ++  + NK+G +++L++GS+ T+ + SA+ A E+FKNHD  F+ R  
Sbjct  43   IGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGRPS  102

Query  478  IDVMKVQGYYMGSLAFAPYGSYWR  549
            +      GY   +++FAPYG YWR
Sbjct  103  LYAANRLGYG-STVSFAPYGEYWR  125



>ref|XP_007146615.1| hypothetical protein PHAVU_006G0551000g, partial [Phaseolus vulgaris]
 gb|ESW18609.1| hypothetical protein PHAVU_006G0551000g, partial [Phaseolus vulgaris]
Length=163

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             RK+  ++ ++P GP  LP+IGN+ +L  + PH+ + ++  KYG ++ L++G VST+ I 
Sbjct  29   PRKRDETTSKIPHGPTKLPIIGNIHNLLSSQPHRKLRDLALKYGPLMHLQLGEVSTIVIS  88

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            S + A E+ K HD++FA R  I   ++  Y    + FAPYG+YWR L
Sbjct  89   SPECAKEVMKTHDINFATRPKILASEIISYNSTGIVFAPYGNYWRQL  135



>gb|ABC69415.1| CYP71AH2 [Nicotiana tabacum]
Length=494

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  +G  PH+++ ++ N+YG  I+L++GSV T+ + SA  A E+F+ HD+ F+ R 
Sbjct  34   IIGNLHQIGKLPHRSLQKLSNEYGDFIFLQLGSVPTVVVSSADIAREIFRTHDLVFSGRP  93

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             +   +   Y   +++FAPYG+YWR
Sbjct  94   ALYAARKLSYNCYNVSFAPYGNYWR  118



>ref|XP_004305999.2| PREDICTED: uncharacterized protein LOC101299609 [Fragaria vesca 
subsp. vesca]
Length=1065

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L GA PH+ + ++  ++G ++ L++G VST+ + SAK A E+ K HD+ FA R
Sbjct  60   IIGNIHQLIGALPHRVLTDLAKQHGPLMHLKLGEVSTVVVSSAKFAKEVMKTHDIIFASR  119

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +  +++  Y   ++AFAPYG+YWR L
Sbjct  120  PQVIALRIMAYDSTNIAFAPYGNYWRKL  147


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L GA PH+ + ++  K+G ++ LR+G VST+ + SAK A E+ K HD+ FA R
Sbjct  592  IIGNIHQLIGALPHRGLRDLAKKHGPLMHLRLGEVSTVVVSSAKFAEEVMKTHDIIFASR  651

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +   ++  Y    + FAPYG YWR L
Sbjct  652  PEVIASRIISYNSTDIVFAPYGDYWRRL  679



>ref|XP_010102944.1| Psoralen synthase [Morus notabilis]
 gb|EXB94462.1| Psoralen synthase [Morus notabilis]
Length=226

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARK----KSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            +E++   L ++ IFL+  L F++ +     +   S+ LPP PP LP+IGN+  LG  PH 
Sbjct  8    LEFKPSSLFFALIFLVISLKFIIRKNPIIIERKKSFNLPPSPPKLPIIGNLHQLGKNPHI  67

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
            ++  +  KYG +  L +G + T+ I SA+ A E FK HD++ + R  I   K   Y    
Sbjct  68   SLRNLAQKYGPIFCLNLGQIPTVIISSARIAKEAFKTHDLALSGRPQIVAAKYLFYNCTD  127

Query  517  LAFAPYGSYWR  549
            +AFA YG YWR
Sbjct  128  MAFASYGDYWR  138



>gb|KHG19246.1| Cytochrome P450 [Gossypium arboreum]
Length=484

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGNM  L     PH+T+ ++  KYG+++ L++G  ST+ + SA+ A E+ K HD+ FA 
Sbjct  47   LIGNMHQLAGPRLPHRTLRDLATKYGAIMHLQLGQTSTVVVSSAEMAKEIMKTHDIVFAT  106

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF+PYG+YWR L
Sbjct  107  RPVLASAKILTYGCTDIAFSPYGNYWRNL  135



>gb|KJB61441.1| hypothetical protein B456_009G358600, partial [Gossypium raimondii]
Length=485

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L     PH T+ ++  KYG+++ L++G +ST+ + SA+ A E+ K HD+ FA+
Sbjct  31   LIGNLHQLAGPGLPHHTLRDLATKYGAIMHLQLGQISTVVVSSAEMAKEIMKTHDIVFAN  90

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF PYG+YWR L
Sbjct  91   RPVLASAKILTYGCTDIAFTPYGNYWRNL  119



>gb|KJB61438.1| hypothetical protein B456_009G358400 [Gossypium raimondii]
Length=508

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L     PH T+ ++  KYG+++ L++G +ST+ + SA+ A E+ K HD+ FA+
Sbjct  47   LIGNLHQLAGPGLPHHTLRDLATKYGAIMHLQLGQISTVVVSSAEMAKEIMKTHDIVFAN  106

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF+PYG+YWR L
Sbjct  107  RPVLASAKIITYGCTDIAFSPYGNYWRNL  135



>ref|XP_007037775.1| Cytochrome P450 71A1 [Theobroma cacao]
 gb|EOY22276.1| Cytochrome P450 71A1 [Theobroma cacao]
Length=527

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH++  ++  KYGS++ L++G   T+ + SA+ A E+ KNHD+ F++R 
Sbjct  67   IIGNIHQLGKLPHRSFRDLSRKYGSLLLLQLGHNPTLVVSSAEMAREIVKNHDIVFSNRP  126

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
                  +  Y  G + FAPYG YWR
Sbjct  127  RTTAANILLYGCGDIGFAPYGEYWR  151



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSA-IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            M+W W  L  +A IF    LV+    K+S+ + RLPPGP GLP++GN+L +G  PH+ + 
Sbjct  1    MDWTWTTLAVAALIFFFQSLVW----KRSAKNKRLPPGPRGLPILGNLLMIGDKPHRDLQ  56

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++  KYG ++ LR GS+  + + S +AA +  K +D+ FA R   +  K   Y   +++F
Sbjct  57   QLAQKYGPIMHLRFGSMPVIVVSSPEAAEQFLKTYDLVFASRPPHEGSKYICYNQQNISF  116

Query  526  APYGSYWR  549
            +PYGSYWR
Sbjct  117  SPYGSYWR  124



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 4/133 (3%)
 Frame = +1

Query  169  MEWEWK-YLVWSAIFLIPGLVFLLARKKSSSSYRlppgpp--glpVIGNMLDL-GAFPHQ  336
            ME +W  + +  A  L   +V  + R  ++++Y     P    LP IGN+  L G  PH 
Sbjct  1    MEHQWPSFPIMFAFLLFIIMVLKIGRSGNTNNYASNLPPGPWKLPFIGNLHQLIGCLPHH  60

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
             + ++  KYG ++ LR+G VST+ + SA+ A E+ K HDV FA R  I   ++  Y   +
Sbjct  61   GLRDLAEKYGPLMHLRLGEVSTIVVSSAEFAKEVMKTHDVIFASRPQILATRILSYGSTN  120

Query  517  LAFAPYGSYWRVL  555
            +AFAPYG YWR L
Sbjct  121  IAFAPYGDYWRQL  133



>ref|XP_004304108.2| PREDICTED: cytochrome P450 71D9-like [Fragaria vesca subsp. vesca]
Length=942

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PH+ + ++  KYG V+ LR+G VST+ + SA+ A E+ K HD+ FA R
Sbjct  48   IIGNIHQLIGTLPHRGLRDLAKKYGPVMHLRLGEVSTIVVSSAELAKEVMKTHDIIFASR  107

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + V ++  Y    +AFAPYG YWR L
Sbjct  108  PQVLVTRILYYDSKDIAFAPYGDYWREL  135


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L GA PH+ + ++  ++G ++ L++G VST+ + SAK A E+ K HD+ FA R
Sbjct  512  IIGNIHQLIGAPPHRRLRDLAKQHGPLMHLKLGEVSTVVVSSAKFAKEVMKTHDIIFASR  571

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +   ++  Y   ++AFAPYG YWR L
Sbjct  572  PQVIAPRIMAYDSTNIAFAPYGDYWRKL  599



>gb|KHG17729.1| Cytochrome P450 [Gossypium arboreum]
Length=534

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+  LG  PH+++ ++  KYGS++ L++G   T+ + SA    E+ KNHDV+F+DR  
Sbjct  73   IGNIHQLGKLPHRSLRDLSRKYGSLLLLQLGHNQTLVVSSADMVKEIVKNHDVAFSDRPS  132

Query  478  IDVMKVQGYYMGSLAFAPYGSYWR  549
                 +  Y    +AFAPYG YWR
Sbjct  133  TTAANILFYGCTDVAFAPYGEYWR  156



>gb|KHG18333.1| Cytochrome P450 [Gossypium arboreum]
Length=549

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+  LG  PH+++ ++  KYGS++ L++G   T+ + SA    E+ KNHDV+F+DR  
Sbjct  73   IGNIHQLGKLPHRSLRDLSRKYGSLLLLQLGHNQTLVVSSADMVKEIVKNHDVAFSDRPS  132

Query  478  IDVMKVQGYYMGSLAFAPYGSYWR  549
                 +  Y    +AFAPYG YWR
Sbjct  133  TTAANILFYGCTDVAFAPYGEYWR  156



>gb|KEH34016.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+ +L  + PH+ + ++  KYG V+ L++G VS M I S + A+E+ K HD+ F+ R
Sbjct  10   IIGNIHNLLSSQPHRKLRDLAKKYGPVMHLQLGEVSNMVISSPECASEVMKTHDIHFSSR  69

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
              I V ++  Y   S+AFAPYG+YWR
Sbjct  70   PQILVTEIISYNSTSIAFAPYGNYWR  95



>ref|XP_010026997.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
 gb|KCW83243.1| hypothetical protein EUGRSUZ_B00182 [Eucalyptus grandis]
Length=500

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  +KK+ +S  LPP P  LP+IGN+  LG+ PH+++  +  +YG ++ L++GS+ 
Sbjct  19   LVFLIDTKKKTRASRNLPPRPRKLPIIGNLHQLGSLPHRSLVRLSKQYGQIMLLQLGSIP  78

Query  400  TMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            T+ I S   A E+FK HD +F+ R V   +K   Y    ++FA YG  WR L
Sbjct  79   TLVISSEDVAREVFKAHDRAFSGRPVFYAVKKLTYNCSDVSFAAYGDSWREL  130



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 72/118 (61%), Gaps = 4/118 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLARK---KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            +F IP + FL  R    + S + RLPPGP G+P++GN+L LG  PH+++ EM   YG ++
Sbjct  9    LFSIP-IFFLFIRPFILRKSDTKRLPPGPRGIPILGNLLQLGPRPHESLHEMAKLYGPLM  67

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
             LR+GSV+T+   S   A EL  NHD  FA+R + D +  Q  + G+LA+ P    WR
Sbjct  68   TLRLGSVTTVVASSPDMARELLHNHDQVFANRPIPDSVTAQPNHQGTLAWVPGDHRWR  125



>emb|CCO62222.1| putative cytochrome P450 monooxygenase [Actaea racemosa]
Length=507

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  211  LIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            ++P L+FL+ R+ +    +LPPGP  LP+IGN+  L   PH ++  + NK+G +++L++G
Sbjct  25   IVPPLLFLVQRRPALGMRKLPPGPTRLPLIGNLHQLSDMPHLSLQRLSNKHGPLMFLQLG  84

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            S  T+   SA+ A E+FK  D+ F+ R ++   K   Y    +AFAPY  YWR
Sbjct  85   SKPTLVFSSAEMAREIFKTRDIVFSGRPILYAAKKLSYGCSDIAFAPYSEYWR  137



>ref|XP_007020550.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12075.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=409

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  +  A PH+T+ ++  K+G ++ L++G VST+ + S + A E+ K HD++F+ R
Sbjct  51   VIGNLNQIASALPHKTVRDLAIKHGPLMHLQLGEVSTVIVSSPEVAKEVMKTHDINFSYR  110

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + V K+  Y   ++AFAPYG+YWR L
Sbjct  111  PALAVPKITTYVFTNIAFAPYGNYWRHL  138



>gb|KHG02344.1| Cytochrome P450 [Gossypium arboreum]
Length=512

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (63%), Gaps = 5/121 (4%)
 Frame = +1

Query  208  FLIPGLVFLLARKKS---SSSYRlppgppglpVIGNMLDLG--AFPHQTIAEMKNKYGSV  372
            FL+  L+ + + +KS   S ++RL PGP  LP+IGN+  L     PH+T+ ++  KYG+V
Sbjct  14   FLLVLLIAIRSVRKSKARSLTHRLIPGPRKLPLIGNLHQLAGSTLPHRTLRDLATKYGAV  73

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++G VST+ I SA+ A E+ K HD+ FA R ++   K+  Y    + F+PYG YWR 
Sbjct  74   MHLQLGQVSTVVISSAEMAEEIMKTHDIVFASRPLLLAAKIITYECTDIVFSPYGKYWRN  133

Query  553  L  555
            L
Sbjct  134  L  134



>gb|AJD25151.1| cytochrome P450 CYP71AH15 [Salvia miltiorrhiza]
Length=496

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 77/124 (62%), Gaps = 9/124 (7%)
 Frame = +1

Query  205  IFLIPGLVFLL--------ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            I LIP L F+          RK   ++ +LPPGP  LP+IGN+  LG  PH+++ ++   
Sbjct  5    IPLIPFLTFITLFFLILKKTRKPVINAAKLPPGPRQLPIIGNLHQLGKLPHRSLQKLSKT  64

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR-TVIDVMKVQGYYMGSLAFAPYG  537
            YG +++L++GSV T+ + SA  A ++FKNHD++F+ R + +  MK   Y +  ++ APYG
Sbjct  65   YGDLMFLQLGSVPTLVVSSADKARDIFKNHDLAFSGRPSSLYAMKKMCYNLSCVSAAPYG  124

Query  538  SYWR  549
             YWR
Sbjct  125  DYWR  128



>ref|XP_007213422.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
 gb|EMJ14621.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
Length=475

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G+ PHQ + ++  KYG ++ L++G VST+ + SA+ A E+ K HD+ FA R
Sbjct  47   VIGNLHQLAGSLPHQRLRDLAKKYGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASR  106

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +   ++  Y   S+ FAPYG YWR L
Sbjct  107  PHVLAPRILSYDFTSIVFAPYGEYWRKL  134



>ref|XP_010910705.1| PREDICTED: cytochrome P450 71B9-like, partial [Elaeis guineensis]
Length=141

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME+      +  IFLIP +  LL  K +  S RLPPGP   P IGN+  LG  PH+++  
Sbjct  1    MEFLLALFAYLCIFLIP-IAILLYVKATRLSLRLPPGPIRFPFIGNLHQLGELPHRSLRL  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +  KYG ++ L++G + T+ I S++ A+E+ K HD+ F  R  +   K   Y    +A +
Sbjct  60   LSEKYGPLMSLKLGCIPTIIISSSEMASEILKTHDLVFCTRPPLVAFKRYSYGGLDIALS  119

Query  529  PYGSYWRVL  555
            PY   WR L
Sbjct  120  PYNEQWRQL  128



>ref|XP_004506686.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=495

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +1

Query  184  KYLVWSAIFLIPGLVFL---LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEM  351
            ++L +++I  +   VF+   +  KKS S+  LPPGP  LP+IGN+ +L G+ PH  + E+
Sbjct  4    QFLYFASILTLFIFVFMSHKILTKKSKSTPNLPPGPWKLPIIGNIHNLVGSLPHHRLREL  63

Query  352  KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP  531
              KYG ++ L++G +ST+ + SA+ A ++ K HD+ F+ R  I    +  Y    +AFAP
Sbjct  64   STKYGPLMHLKLGEISTIIVSSAECAKQVMKTHDLIFSSRPPIQASTIMSYNNVGIAFAP  123

Query  532  YGSYWRVL  555
            YG YWR L
Sbjct  124  YGDYWRQL  131



>ref|XP_003559997.1| PREDICTED: 4-hydroxyphenylacetaldehyde oxime monooxygenase-like 
[Brachypodium distachyon]
Length=543

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = +1

Query  181  WKYLVWSAIFLIPGLVFLLARKKSSS---SYRlppgppglpVIGNMLDLGAFPHQTIAEM  351
            W+ LV + + ++  L+    R++ S    +  LPPGP  +PV+GN+  LG+ PH+++ E+
Sbjct  16   WQLLVLAPLLIVSSLLITSIRRRRSPGQGALNLPPGPVRVPVLGNLHQLGSLPHRSLREL  75

Query  352  KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP  531
              ++G V+ L +G+V T+ I SA AA E+ K+ DVS   R          Y +  +AFAP
Sbjct  76   ARRHGPVMLLHLGTVRTVVISSASAAKEVMKDQDVSCCSRPSSPGPSRLSYGLRDVAFAP  135

Query  532  YGSYWR  549
            YG YWR
Sbjct  136  YGEYWR  141



>ref|XP_007020549.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY12074.1| Cytochrome P450 [Theobroma cacao]
Length=504

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G+ PH +++++  KYG ++ L++G VS + + S + AAE+ K HD+ FA+R
Sbjct  43   VIGNMHQLAGSLPHHSLSDLAKKYGPLMHLQLGEVSNIIVSSPETAAEVMKTHDILFANR  102

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              +    +  Y    +AF+PYG+YWR L
Sbjct  103  PYLLCANIVSYNATDIAFSPYGAYWRQL  130



>gb|ABF70064.1| cytochrome P450 family protein [Musa acuminata]
Length=506

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  316  LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV  495
            LG  P++++A +  K+G+V+ L++G V T+ + S +AAAE+ K  DVSFA R +I  +++
Sbjct  51   LGPLPYRSLAALSEKFGAVMLLKLGEVPTLVVSSPEAAAEIMKTQDVSFASRPMISSVRI  110

Query  496  QGYYMGSLAFAPYGSYWR  549
              Y   S AFAPYGSYWR
Sbjct  111  IAYGDKSPAFAPYGSYWR  128



>ref|XP_009388203.1| PREDICTED: premnaspirodiene oxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLD-LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+   LG  P++++A +  K+G+V+ L++G V T+ + S +AAAE+ K  DVSFA R
Sbjct  43   LIGNLHHVLGPLPYRSLAALSEKFGAVMLLKLGEVPTLVVSSPEAAAEIMKTQDVSFASR  102

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
             +I  +++  Y   S  FAPYGSYWR
Sbjct  103  PMISSVRIIAYGDKSPVFAPYGSYWR  128



>ref|XP_011005615.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=507

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L++  IFL+  L FL+  K  +    LPP P  LP+IGN+  LG  PH ++  +  KYG 
Sbjct  15   LLFVTIFLLVALKFLMKGKLKNRKLNLPPSPAKLPIIGNLHQLGNMPHISLRGLAKKYGP  74

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            +I+L++G + T+ I SA  A E+ K HD+  A R  +   K   Y    +AFAPYG+YWR
Sbjct  75   IIFLQLGEIPTVVISSAGLAKEVLKTHDLVLASRPQLFSAKHLFYGCTDIAFAPYGAYWR  134



>ref|XP_002310060.1| hypothetical protein POPTR_0007s07420g [Populus trichocarpa]
 gb|EEE90510.1| hypothetical protein POPTR_0007s07420g [Populus trichocarpa]
Length=504

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH  + ++  KYG V+ L+IG VST+ + S +AA E+ K H+++F +R
Sbjct  41   LIGNIHQLAGSLPHHCLTDLAKKYGPVMQLQIGEVSTVVVSSGEAAKEVMKTHEINFVER  100

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + V  +  Y   ++ FAPYG YWR +
Sbjct  101  PCLLVANIMFYNRKNIGFAPYGDYWRQM  128



>ref|XP_010910057.1| PREDICTED: cytochrome P450 71A9-like, partial [Elaeis guineensis]
Length=195

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME      V+S + LI   VFL A K +  S RLPPGP  LP+IGN+  LG  P++ +  
Sbjct  1    MECSVALFVYSCLLLISIAVFLHA-KATGPSLRLPPGPERLPIIGNLQQLGELPYRPLRL  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            + +KYG ++ L++GS+ T+ I ++  A E+ K  D++F  R  +   K   Y    + FA
Sbjct  60   LSDKYGPLMSLKLGSIPTLIISASDMAREILKTQDLNFCTRAPLVAFKRYSYGGLDMTFA  119

Query  529  PYGSYWR  549
            PYG  WR
Sbjct  120  PYGEQWR  126



>ref|XP_007160365.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
 gb|ESW32359.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
Length=517

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            L+R ++    R PPGPP  PVIGN+  LG  PH+T+  +  +YG ++ LR+G V  + + 
Sbjct  29   LSRNRTKHHQRHPPGPPPFPVIGNLHMLGKLPHRTLQALAQQYGPIMSLRLGQVPIVVVS  88

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            S++AA    K HD  FA R +++  K  GY    LAF+ YG YWR
Sbjct  89   SSEAAQHFLKPHDAVFASRPILEASKYFGYGSKGLAFSEYGPYWR  133



>gb|KJB61456.1| hypothetical protein B456_009G359000 [Gossypium raimondii]
Length=508

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L     PH T+ +   KYG+++ L++G +ST+ + SA+ A E+ K HD+ FA+
Sbjct  47   LIGNLHQLAGPGLPHHTLRDFATKYGAIMHLQLGQISTVVVSSAEMAKEIMKTHDIVFAN  106

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF PYG+YWR L
Sbjct  107  RPVLASAKILTYGCTDIAFTPYGNYWRNL  135



>gb|KJB61457.1| hypothetical protein B456_009G359000 [Gossypium raimondii]
Length=482

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L     PH T+ +   KYG+++ L++G +ST+ + SA+ A E+ K HD+ FA+
Sbjct  21   LIGNLHQLAGPGLPHHTLRDFATKYGAIMHLQLGQISTVVVSSAEMAKEIMKTHDIVFAN  80

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R V+   K+  Y    +AF PYG+YWR L
Sbjct  81   RPVLASAKILTYGCTDIAFTPYGNYWRNL  109



>ref|XP_007210941.1| hypothetical protein PRUPE_ppa024670mg [Prunus persica]
 gb|EMJ12140.1| hypothetical protein PRUPE_ppa024670mg [Prunus persica]
Length=511

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +1

Query  241  RKKSSSSY--RlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAI  411
            RKKSS+S   RLPPGP  LP+IGN+  L    PH  +  +  +YG +++L++GS+ST+ +
Sbjct  26   RKKSSASQERRLPPGPRRLPLIGNLHKLSNGLPHHVLEHLALQYGPLMFLKLGSISTLVV  85

Query  412  LSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
             SA  A E+FK HD+ F+ R V+ V K   Y   +L+FAPYG YWR
Sbjct  86   SSAHMAREIFKTHDLVFSGRPVLYVAKKLSYGCVNLSFAPYGEYWR  131



>ref|XP_011002269.1| PREDICTED: cytochrome P450 71D9-like [Populus euphratica]
Length=504

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH  + ++  KYG V+ L+IG VST+ + S +AA E+ K H+++F +R
Sbjct  41   LIGNIHQLAGSLPHHCLTDLAKKYGPVMQLQIGEVSTVVVSSGEAAREVMKTHEINFVER  100

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + V  +  Y   ++ FAPYG YWR +
Sbjct  101  PCLLVANIMFYNRKNIGFAPYGDYWRQM  128



>gb|KJB61458.1| hypothetical protein B456_009G359100 [Gossypium raimondii]
Length=507

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L A   PH+T+ ++  K+G  + L++G VST+ + S + A E+ K HD+ FA+
Sbjct  46   LIGNLHQLAASGLPHRTLRDLATKHGDFMHLQLGQVSTVVVSSPEMAKEIMKTHDIVFAN  105

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R  + V K+  Y    +AFAPYG+YWR L
Sbjct  106  RPFLVVAKMTTYECTDIAFAPYGTYWRNL  134



>gb|KHG28615.1| Cytochrome P450 [Gossypium arboreum]
Length=408

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGA--FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+  L A   PH+T+ ++  K+G  + L++G VST+ + S + A E+ K HD+ FA+
Sbjct  27   LIGNLHQLAASGLPHRTLRDLATKHGDFMHLQLGQVSTVVVSSPEMAKEIMKTHDIVFAN  86

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R  + V K+  Y    + FAPYG+YWR L
Sbjct  87   RPFLVVAKITTYECTDIVFAPYGTYWRNL  115



>gb|KHG16719.1| Cytochrome P450 [Gossypium arboreum]
Length=489

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +1

Query  184  KYLVWSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            K L+ S I L   L++L LA++K+     LPP PP LP+IGN+  LG  PH+++ ++  K
Sbjct  12   KPLLLSMILLFSLLIWLKLAKRKT---LNLPPSPPRLPIIGNIHQLGKLPHRSLRDLSRK  68

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YGS++ L++G   T+ + SA   +E+ KNHD+ F++R     + +  Y    +AFAPYG 
Sbjct  69   YGSLLLLQLGYNPTVVVSSADIVSEIVKNHDIVFSNRPRTTAVDILFYGCKDMAFAPYGE  128

Query  541  YWR  549
            YWR
Sbjct  129  YWR  131



>ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=505

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARK--KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            L W+ + LI    FL A    + +++ +LPPGP G P+ G++  LG +PH+ +  +  KY
Sbjct  11   LTWATLALIALACFLQALLWLRKTNNKKLPPGPRGFPIFGSLHLLGKYPHRELHRLAQKY  70

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G ++ LR+G VST+ + S +AA    K HD++FA R      K   Y   +L+FAPYGSY
Sbjct  71   GPIMHLRLGLVSTIVVSSPQAAESFLKTHDLAFASRPPHQAAKFISYEQKNLSFAPYGSY  130

Query  544  WR  549
            WR
Sbjct  131  WR  132



>gb|KCW80419.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=354

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P  LP+IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             +GS+ T+ I S   A E+FK+HD +F+ R +    K   Y    + F+ YG  W+ L
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGRPIFYAGKKLAYNQSDITFSTYGESWKEL  130



>ref|XP_011034037.1| PREDICTED: cytochrome P450 71B10-like [Populus euphratica]
Length=507

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVI  480
            GN+  LG+ PHQ++ ++  KYG V+ +R+G + T+ I SA+AA E+ K HD++F  R ++
Sbjct  47   GNLHQLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDLAFCSRPLL  106

Query  481  DVMKVQGYYMGSLAFAPYGSYWR  549
            D  +   Y    +AF+PY  YWR
Sbjct  107  DGTRRLTYNYLDIAFSPYSDYWR  129



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            KK+ S++ LP GP  LP+IGN+ +L  + PH+ ++++  KYG ++ L++G VST+ I SA
Sbjct  29   KKTDSTFNLPKGPRKLPIIGNIHNLLSSQPHRKLSDLAKKYGPLMHLQLGEVSTIVISSA  88

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            + A E+ K HD+ FA R  +  + +  Y   S++F+PYG YWR
Sbjct  89   EFAKEVMKTHDIHFATRPKVLAIDIMSYNSTSISFSPYGDYWR  131



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = +1

Query  211  LIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            +I  L ++L R K  S  +LPPGP  LP++GN+LDLG  PH+++A++   +G ++ L++G
Sbjct  17   VIQSLDYILRRSKRKSG-KLPPGPSRLPIVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLG  75

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             V+T+ + SA  A E+ + HD++F +RTV+D ++   ++   +A+ P  + WR L
Sbjct  76   QVTTIVVSSATMAKEVLQKHDLTFCNRTVVDAVRALDHHEAGIAWLPVATRWRNL  130



>ref|XP_010102942.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB94460.1| Cytochrome P450 71A1 [Morus notabilis]
Length=311

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
              IFL+  L F + +KK +   + LPP PP LP+IGN+  LG  PH +   +  KYG + 
Sbjct  12   PTIFLLVLLKFFIFKKKPTKPEFNLPPSPPKLPIIGNLHQLGNNPHISFHHLAQKYGPIF  71

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ +G + T+ I SA+ A E  K HD++FA R  +   K   Y    + F+PYG+YWR
Sbjct  72   YMELGQIPTVIISSARLAKEALKTHDLAFASRPKLIAAKYLFYNCTDMGFSPYGAYWR  129



>ref|XP_007034575.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY05501.1| Cytochrome P450, putative [Theobroma cacao]
Length=551

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+LDLG  PH+++AE+   +G ++ L++GS++T+ + SA  A E+ +NHD++F++RT
Sbjct  98   ILGNLLDLGDKPHKSLAELAKTHGPLMSLKLGSLTTIVVSSAAMAKEVLQNHDLTFSNRT  157

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + D ++V  +    L + P    WR L
Sbjct  158  IGDALRVNQHDEVGLPWMPVSPLWRTL  184



>ref|XP_006387000.1| hypothetical protein POPTR_2285s00200g, partial [Populus trichocarpa]
 gb|ERP45914.1| hypothetical protein POPTR_2285s00200g, partial [Populus trichocarpa]
Length=224

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 66/116 (57%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             IFL+  L FL+  K       LPP P  LP+IGN+  LG  PH ++  +  KYG +I+L
Sbjct  19   TIFLVVVLKFLMKDKLKKRKLNLPPSPAKLPIIGNLHQLGNMPHISLRGLAKKYGPIIFL  78

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++G + T+ I SA  A E+ K HD+  + R  +   K   Y    +AFAPYG+YWR
Sbjct  79   QLGEIPTVVISSAGLAKEVLKTHDLVLSSRPQLFSAKHLLYGCTDIAFAPYGAYWR  134



>gb|KCW83246.1| hypothetical protein EUGRSUZ_B00186 [Eucalyptus grandis]
Length=469

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LV L+  +KK  +S  LPPGP  LP+IGN+  LG+ PH+++A++  +YG +++L++GS+ 
Sbjct  20   LVLLIDTKKKRKASRNLPPGPRKLPIIGNLHQLGSLPHRSLAQLSKRYGQIMFLQLGSIP  79

Query  400  TMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            T+ I S + A E+FK HD +F+ R     +K   Y    ++F  YG  WR L
Sbjct  80   TLVISSEEVAREVFKAHDRAFSGRPTFYAVKKLTYNCSDVSFGTYGDSWREL  131



>ref|XP_002321645.1| hypothetical protein POPTR_0015s09760g [Populus trichocarpa]
 gb|EEF05772.1| hypothetical protein POPTR_0015s09760g [Populus trichocarpa]
Length=507

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L++  IFL+  L FL+  K  +S   LPP P  LP+IGN+  LG  PH ++  +  KYG 
Sbjct  15   LLFVTIFLLVALKFLVKGKLKNSKLNLPPSPAKLPIIGNLHQLGNMPHISLRWLAKKYGP  74

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            +I+L++G + T+ I S + A E+ K HD+  + R  +   K   Y    +AFAPYG+YWR
Sbjct  75   IIFLQLGEIPTVVISSVRLAKEVLKTHDLVLSSRPQLFSAKHLFYGCTDIAFAPYGAYWR  134



>gb|EMT31346.1| Cytochrome P450 71D7 [Aegilops tauschii]
Length=511

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++G++L + GAFPH+TIAE+  ++G ++ LR+G V+TM + SA+ AA + K +D++FADR
Sbjct  41   IVGSLLHVVGAFPHRTIAELSRRHGPLMHLRLGEVATMVVSSAEVAALVLKTNDLTFADR  100

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWR  549
                   + G     +AFAPYG+ WR
Sbjct  101  PRTVTQNIFGSGGKDIAFAPYGAAWR  126



>gb|KJB51118.1| hypothetical protein B456_008G202400 [Gossypium raimondii]
Length=539

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+  LG  PH+++ ++  KYGS++ L++G   T+ + SA    E+ KNHDV+F+DR  
Sbjct  78   IGNIHQLGKLPHRSLRDLSRKYGSLLLLQLGHNQTLVVSSADMVKEIVKNHDVAFSDRPS  137

Query  478  IDVMKVQGYYMGSLAFAPYGSYWR  549
                 +  Y    + FAPYG YWR
Sbjct  138  TTAANILFYGCTDVGFAPYGEYWR  161



>emb|CDP14652.1| unnamed protein product [Coffea canephora]
Length=510

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG FPH+++  +  KYG ++ L +GS   + + S+ AA+++ K HD+SFA R 
Sbjct  46   IIGNLHQLGQFPHRSLQSLSRKYGPLVLLELGSKPMLVVSSSDAASQILKTHDLSFASRP  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
               +     Y    +AFAPYG YWR L
Sbjct  106  KSSIPDKLFYGSKDIAFAPYGEYWRQL  132



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = +1

Query  232  LLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
            L A+K   S  RLPPGP  LP+IGN+  L    PH T++ +  KYG ++WL++G V T+ 
Sbjct  25   LKAQKAKKSFTRLPPGPWKLPLIGNLHQLVSTLPHHTLSNLAKKYGPLMWLKLGEVPTLV  84

Query  409  ILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + S + A E+ + HD++F  R  +    + GY    + F+PYG+YWR +
Sbjct  85   VSSPEMAKEVMRTHDITFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQM  133



>gb|KJB19523.1| hypothetical protein B456_003G107400 [Gossypium raimondii]
Length=508

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH ++  + NK+G +I+L++G + T+ + SA  A ++ K HD++ ++R 
Sbjct  49   IIGNLHQLGTMPHLSLRRLSNKFGPIIYLQLGQIPTVVVSSANLAKQVMKTHDLALSNRP  108

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             I   K+  Y    +AFAPYG+YWR
Sbjct  109  PIFSAKLLFYDCTDIAFAPYGAYWR  133



>ref|XP_011097779.1| PREDICTED: cytochrome P450 71D11-like [Sesamum indicum]
Length=510

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLGAF--PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            +IGN+     F  PH+TI+++ ++YG V+ L++G V+T+ + SA+AA ++ K HD++FA 
Sbjct  47   LIGNLYLFAGFRPPHRTISDLASRYGPVMHLKLGEVNTVVVSSAEAAKDVLKTHDLNFAY  106

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R  + V ++  Y    +AFAPYG YWR L
Sbjct  107  RPSLLVTEIICYGNTDIAFAPYGDYWRQL  135



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 82/135 (61%), Gaps = 6/135 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSA-IFLIPGLVFLLARK--KSSSSYRlppgppglpVIGNMLDL---GAFP  330
            ME+++ +L+ S+ IFLI  L  +  +K    +  ++LPPGP  LP+IGN+  L   G+ P
Sbjct  1    MEFKFSFLIISSFIFLILCLTKIYKQKIKVKNEVHKLPPGPWKLPLIGNLHQLALGGSLP  60

Query  331  HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYM  510
            H T+ ++ NKYG +++L++G +S + + S   A E+ K HD+SF  R  +   K+  Y  
Sbjct  61   HHTLRDLSNKYGPLMYLQLGEISAVVVSSPDLAKEIMKTHDLSFVQRPELLAPKILSYDS  120

Query  511  GSLAFAPYGSYWRVL  555
              + +APYG YWR +
Sbjct  121  TDIVYAPYGDYWRQM  135



>ref|XP_010027022.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
Length=527

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  202  AIFLIP-GLVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
             +  +P  LV L+  +KK  +S  LPPGP  LP+IGN+  LG+ PH+++A++  +YG ++
Sbjct  38   CVLAVPLSLVLLIDTKKKRKASRNLPPGPRKLPIIGNLHQLGSLPHRSLAQLSKRYGQIM  97

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            +L++GS+ T+ I S + A E+FK HD +F+ R     +K   Y    ++F  YG  WR L
Sbjct  98   FLQLGSIPTLVISSEEVAREVFKAHDRTFSGRPAFYAVKKLTYNCSDVSFGAYGDSWREL  157



>ref|XP_004173362.1| PREDICTED: cytochrome P450 71A2-like [Cucumis sativus]
Length=205

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG+ PHQ++A +  +YG ++ L++G    + I S K A ++ K HD+ F++R 
Sbjct  39   LIGNLHQLGSLPHQSLATLSQEYGPLMLLKLGQAPVLIISSVKIAEQVMKTHDLVFSNRP  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
                 K   Y    + FAPYG YWR
Sbjct  99   QTTAAKTLLYGCQDVGFAPYGEYWR  123



>sp|O48958.1|C71E1_SORBI RecName: Full=4-hydroxyphenylacetaldehyde oxime monooxygenase; 
AltName: Full=Cytochrome P450 71E1 [Sorghum bicolor]
 gb|AAC39318.1| cytochrome P450 CYP71E1 [Sorghum bicolor]
Length=531

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG  PH+ + E+  +YG V+ LR+G+V T+ + SA+AA E+ K HDV    R 
Sbjct  64   ILGNLHLLGPLPHKNLRELARRYGPVMQLRLGTVPTVVVSSAEAAREVLKVHDVDCCSRP  123

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
                 K   Y + ++ FAPYG YWR
Sbjct  124  ASPGPKRLSYDLKNVGFAPYGEYWR  148



>ref|XP_007027586.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY08088.1| Cytochrome P450 [Theobroma cacao]
Length=1008

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A++  ++G ++ L +GS+ST+ I S + A E+FKNHDV  A R 
Sbjct  43   VVGNIFQLGWAPHESFAKLARQHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            + + MK    + GSL  + YGS+WR+L
Sbjct  103  IYEAMKGDFGHEGSLITSQYGSHWRML  129


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +1

Query  295  VIGNMLDLG--AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            V GN+  L     PH +I ++  ++G +  L +GS+ T+ I S + A E+FKNHDV  A 
Sbjct  542  VAGNIFQLSWREPPHLSITKLACQHGPITTLWLGSMCTVVISSGEVAREMFKNHDVVLAG  601

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            R + + MK      GS+  + YGS+WR+L
Sbjct  602  RKIYESMKGNYGNEGSIITSQYGSHWRML  630



>ref|XP_007048751.1| 4-hydroxyphenylacetaldehyde oxime monooxygenase, putative [Theobroma 
cacao]
 gb|EOX92908.1| 4-hydroxyphenylacetaldehyde oxime monooxygenase, putative [Theobroma 
cacao]
Length=536

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = +1

Query  208  FLIPGLVFLLAR-KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            FL+  L  +L R K+ + S +LPPGPP LP+IGN+  LG  PH ++ ++  KYG +++L+
Sbjct  49   FLLQMLTMVLLRNKRGNQSAKLPPGPPRLPIIGNLHQLGNLPHHSLHKISQKYGPIMFLK  108

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            +GS  T+ I SAK A E+ K HD+    R +    K   Y    +AFAPY  YWR +
Sbjct  109  LGSTPTIIISSAKMAQEVMKTHDLDCCSRPLSPGPKRLSYNHLDVAFAPYSDYWREM  165



>ref|XP_004152574.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=507

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG+ PHQ++A +  KYG ++ L++G    + I SAK A ++ K HD+ F++R 
Sbjct  39   LIGNLHQLGSLPHQSLATLSQKYGPLMLLKLGQAPVLVISSAKMAEQVMKTHDLVFSNRP  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
                 K   Y    + FAPYG YWR
Sbjct  99   QTTAAKTLLYGCQDMGFAPYGEYWR  123



>ref|XP_008239596.1| PREDICTED: cytochrome P450 71A9-like [Prunus mume]
Length=560

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +1

Query  241  RKKSSSSY--RlppgppglpVIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAI  411
            RKKSS+S   RLPPGP  LP+IGN+  L    PH  +  +  +YG +++L++GS+ST+ +
Sbjct  26   RKKSSASQERRLPPGPRRLPLIGNLHKLSNGLPHHVLEHLALRYGPLMFLQLGSISTLVV  85

Query  412  LSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
             SA  A E+F+ HD+ F+ R V+ V K   Y   +L+FAPYG YWR
Sbjct  86   SSAHMAREIFRTHDLVFSGRPVLYVAKKLSYGCVNLSFAPYGEYWR  131



>ref|XP_008382575.1| PREDICTED: cytochrome P450 71A3-like [Malus domestica]
Length=515

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+  LG +PH+++  +  ++GS++ L  GS+  + + SA+AA+E+ K HD++F+DR 
Sbjct  54   VIGNLHQLGLYPHRSLRALAQRHGSLMMLHFGSMPVLVVSSAEAASEVMKTHDITFSDRP  113

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             I   K   Y    +A APYG YWR
Sbjct  114  KITFFKKLLYDFKDVASAPYGEYWR  138



>gb|KCW80420.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
 gb|KCW80421.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=408

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P  LP+IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             +GS+ T+ I S   A E+FK+HD +F+ R +    K   Y    + F+ YG  W+ L
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGRPIFYAGKKLAYNQSDITFSTYGESWKEL  130



>ref|XP_002463548.1| hypothetical protein SORBIDRAFT_01g001780 [Sorghum bicolor]
 gb|EER90546.1| hypothetical protein SORBIDRAFT_01g001780 [Sorghum bicolor]
Length=528

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +1

Query  229  FLLARK----KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSV  396
            FLL  +    K   + RLPPGP  +PV+GN+  LG  PHQ + EM  ++G V+ LR+G+V
Sbjct  26   FLLTSRSRSAKDGGAPRLPPGPAQVPVLGNLHQLGWLPHQNLREMARRHGPVMLLRLGTV  85

Query  397  STMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
              + + SA+AA E+ K HDV    R +    K   Y +  + F PYG YWR +
Sbjct  86   PAVVVSSAEAAREMLKAHDVDCCSRPISPGSKRLSYDLKDVTFTPYGEYWREM  138



>ref|XP_003600316.1| Cytochrome P450, partial [Medicago truncatula]
Length=237

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PHQ++A++  +YG ++ +++G +S + + S   A E+ K HD++FA+R 
Sbjct  45   LIGNIHQLGTLPHQSLAKLAQEYGPLMHMQLGELSCIVVSSQDMAKEIMKTHDLNFANRP  104

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWR  549
             +   ++  Y    + F+P+GSYWR
Sbjct  105  PLLAAEIITYGYKGMTFSPHGSYWR  129



>gb|KEH15784.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            KK+ S++ LP GP  LP+IGN+ +L  + PH+ ++++  KYG V+ L++G +ST+ I S 
Sbjct  29   KKTDSTFNLPKGPRKLPIIGNIHNLLSSQPHRKLSDLAKKYGPVMHLQLGEISTIVISSP  88

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
              A E+ K HD++FA R  I  +++  Y   ++ FAPYG+YWR
Sbjct  89   DYAREVMKTHDINFATRPQILAVEIMTYNSTNIIFAPYGNYWR  131



>gb|KEH31755.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR--KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            L+ S+IFLI   +FLL +    S+ +   PP PP  P+IGN+  LG FPH+T+  +  +Y
Sbjct  3    LIISSIFLI---LFLLIKWYFNSTKTKNSPPSPPKFPIIGNLHQLGLFPHRTLQSLAKEY  59

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY  543
            G ++ L +GSV  + I S + A+E+ K HD  FA+R    +  +  Y    ++ APYG Y
Sbjct  60   GPLMQLHLGSVPVLVISSPEGASEIMKTHDRVFANRPQTKLYDILLYDCKDVSTAPYGEY  119

Query  544  WR  549
            WR
Sbjct  120  WR  121



>ref|XP_007159748.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31742.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=389

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++W +I L+  L +L  R+++S   +LPPGP GLP++G++  LGA PH+ + ++  KYG 
Sbjct  1    MIWISIILL-SLAYLWLRRRNSKGKKLPPGPRGLPILGSLHKLGANPHRDLHQLALKYGP  59

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V++LR+G V T+ + S +AA    K HD+ FA R   +  K   +   +L+FA YGSYWR
Sbjct  60   VMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPHEAAKYISWDQRNLSFAEYGSYWR  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800