BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025O18

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  73.9    3e-13   Nicotiana sylvestris
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.8    7e-13   Solanum lycopersicum
ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.4    9e-13   Solanum tuberosum [potatoes]
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.9    4e-12   Nicotiana tomentosiformis
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    3e-10   Nelumbo nucifera [Indian lotus]
emb|CDO98567.1|  unnamed protein product                              65.1    4e-10   Coffea canephora [robusta coffee]
ref|XP_010246216.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  61.2    8e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     60.5    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g           60.8    1e-08   Phaseolus vulgaris [French bean]
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.8    1e-08   Sesamum indicum [beniseed]
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g           59.3    2e-08   
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.1    2e-08   Sesamum indicum [beniseed]
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  59.7    2e-08   Populus euphratica
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  59.3    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_008346897.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  59.3    5e-08   Malus domestica [apple tree]
ref|XP_006495422.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  56.2    8e-08   
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                58.5    8e-08   Morus notabilis
ref|XP_003549174.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.5    9e-08   Glycine max [soybeans]
emb|CBI35278.3|  unnamed protein product                              58.2    1e-07   Vitis vinifera
ref|XP_003534093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.2    1e-07   Glycine max [soybeans]
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  57.4    2e-07   Elaeis guineensis
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg           57.4    2e-07   Citrus clementina [clementine]
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                57.4    2e-07   Citrus sinensis [apfelsine]
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  57.4    2e-07   Cucumis sativus [cucumbers]
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  57.0    2e-07   Cucumis melo [Oriental melon]
ref|XP_008393509.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  56.6    3e-07   Malus domestica [apple tree]
ref|XP_007209333.1|  hypothetical protein PRUPE_ppa008345mg           56.6    4e-07   
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     56.2    4e-07   Sesamum indicum [beniseed]
gb|EYU29041.1|  hypothetical protein MIMGU_mgv1a026532mg              54.3    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  56.2    5e-07   Citrus sinensis [apfelsine]
gb|EYU17802.1|  hypothetical protein MIMGU_mgv1a008418mg              56.2    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  56.2    5e-07   Prunus mume [ume]
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  55.5    9e-07   Fragaria vesca subsp. vesca
emb|CAN79596.1|  hypothetical protein VITISV_042386                   54.7    2e-06   Vitis vinifera
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     54.3    2e-06   Vitis vinifera
gb|EPS73974.1|  hypothetical protein M569_00782                       53.1    4e-06   Genlisea aurea
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  53.1    5e-06   Phoenix dactylifera
emb|CDP18533.1|  unnamed protein product                              53.1    5e-06   Coffea canephora [robusta coffee]
gb|ACT21194.1|  zinc finger protein                                   52.8    6e-06   Carica papaya [mamon]
ref|XP_010069512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  52.0    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  51.2    3e-05   Solanum lycopersicum
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg              50.4    5e-05   Erythranthe guttata [common monkey flower]
gb|KFM59559.1|  hypothetical protein X975_00622                       47.8    5e-05   Stegodyphus mimosarum
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  48.9    1e-04   Phoenix dactylifera
ref|XP_006374275.1|  hypothetical protein POPTR_0015s05600g           48.9    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  48.9    2e-04   Elaeis guineensis
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  48.5    2e-04   Nicotiana sylvestris
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  48.1    3e-04   Cicer arietinum [garbanzo]
ref|XP_011047757.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  47.8    3e-04   Populus euphratica



>ref|XP_009792116.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009792117.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=398

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETA  59



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETA  55



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETA  55



>ref|XP_009630493.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=399

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETA  59



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFCY C RTV ITP P+S+LVCP+CNG FLEE E
Sbjct  17   PQQYFCYQCNRTVLITPSPSSDLVCPSCNGGFLEEYE  53



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETA  205
            PQ+YFCY C+RTVTI+P P+  SELVCPNC+G FLEE+E+A
Sbjct  21   PQNYFCYQCQRTVTISPSPSPTSELVCPNCHGGFLEESESA  61



>ref|XP_010246216.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=361

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            P+ YFCY C RTV ITP P S+LVCP+CNG FLEE E
Sbjct  17   PRPYFCYQCNRTVLITPSPTSDLVCPDCNGGFLEEYE  53



>ref|XP_009357359.1| PREDICTED: E3 ubiquitin-protein ligase RING1, partial [Pyrus 
x bretschneideri]
Length=304

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMET  54



>ref|XP_007152550.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
 gb|ESW24544.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
Length=359

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            P+ YFC+ C RTV++TP P+S+L+CP+CN  FLEE E
Sbjct  13   PRQYFCHQCNRTVSVTPSPSSDLICPDCNSGFLEELE  49



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETA  205
            + YFCY CER VTITP P+  +ELVCPNC+G+FLEE+ETA
Sbjct  17   RQYFCYQCERHVTITPPPSPTAELVCPNCDGSFLEESETA  56



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFCY C+RTVTITP P S+L CPNC   FLEE E+
Sbjct  10   PQLYFCYQCDRTVTITPSPTSDLSCPNCQEGFLEECES  47



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAETA  205
            P+ YFCY CER VTI P   P +ELVCP+C G FLEE+ETA
Sbjct  19   PRQYFCYQCERQVTIAPPLSPTAELVCPDCQGGFLEESETA  59



>ref|XP_011003690.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=346

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFCY C+RTVTI P P S+L CPNC+  FLEE E+
Sbjct  10   PQLYFCYQCDRTVTINPSPTSDLSCPNCHEGFLEEYES  47



>ref|XP_009355932.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009355933.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=381

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMET  54



>ref|XP_008346897.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008346898.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=381

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET
Sbjct  17   PQLYFCHECDRTVSLTPSPTSDLVCPLCSGGFLEEMET  54



>ref|XP_006495422.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like, partial [Citrus 
sinensis]
Length=125

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELET  58



>ref|XP_010088395.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC35976.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=378

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFC+ C RTV+ITP P S+LVCP C G FLEE +
Sbjct  18   PQPYFCHQCNRTVSITPSPTSDLVCPVCGGGFLEEVQ  54



>ref|XP_003549174.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=369

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELE  53



>emb|CBI35278.3| unnamed protein product [Vitis vinifera]
Length=416

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E
Sbjct  66   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVE  102



>ref|XP_003534093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoformX2 [Glycine 
max]
 ref|XP_006587425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Glycine max]
 ref|XP_006587426.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Glycine max]
Length=376

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELE  53



>ref|XP_010935556.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=358

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            PQ YFC+ C+RTVT+TP P++E+ CP C+G FLEE
Sbjct  13   PQRYFCHQCDRTVTLTPSPDAEIACPICHGGFLEE  47



>ref|XP_006441411.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
 gb|ESR54651.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
Length=350

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELET  58



>gb|KDO48740.1| hypothetical protein CISIN_1g0186891mg [Citrus sinensis]
Length=352

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELET  58



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E+
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEMES  58



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEME  57



>ref|XP_008393509.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008393510.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=388

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFC+ C+RTV++TP P  +LVCP C+G FLEE ET
Sbjct  17   PQLYFCHRCDRTVSLTPSPTYDLVCPLCSGGFLEEMET  54



>ref|XP_007209333.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
 gb|EMJ10532.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
Length=336

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE E +
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMEAS  56



>ref|XP_011070454.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070455.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070456.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=330

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            PQ YFC+ CERTVTITP P  +++CP+CN  F+EE
Sbjct  30   PQMYFCHQCERTVTITPSPGGDILCPSCNSGFVEE  64



>gb|EYU29041.1| hypothetical protein MIMGU_mgv1a026532mg, partial [Erythranthe 
guttata]
Length=189

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            PQ YFC+ CERT TI P P  E++CP+CN  F+EE
Sbjct  14   PQMYFCHQCERTATIAPSPGGEILCPSCNSGFVEE  48



>ref|XP_006493415.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=352

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELET  58



>gb|EYU17802.1| hypothetical protein MIMGU_mgv1a008418mg [Erythranthe guttata]
Length=374

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETA  205
            P+ YFCY CER VTI P P+  +E+ CP+C+G FLEE++TA
Sbjct  18   PKQYFCYQCERNVTIGPPPSPTAEIFCPDCHGGFLEESDTA  58



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE ET
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMET  55



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA  205
            YFC+ C+RTVT+ P P S+L CP C+G FLEE E++
Sbjct  20   YFCHQCDRTVTLNPSPTSDLACPVCSGGFLEEMESS  55



>emb|CAN79596.1| hypothetical protein VITISV_042386 [Vitis vinifera]
Length=371

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E
Sbjct  24   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVE  60



>ref|XP_003634328.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
 ref|XP_010663919.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=369

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E
Sbjct  22   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVE  58



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            PQ YFC+ CERTV I+P P  +++CP+CN  F+EE
Sbjct  13   PQMYFCHQCERTVAISPSPGGDILCPSCNSGFVEE  47



>ref|XP_008803049.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=364

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            PQ YFC+ C+RTVT+TP P +E+ CP C+  F+EE
Sbjct  13   PQRYFCHQCDRTVTLTPSPGAEIACPICHDGFIEE  47



>emb|CDP18533.1| unnamed protein product [Coffea canephora]
Length=319

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            PQ YFC+ C RTVTI P P S+L+CP C+  F+EE E
Sbjct  13   PQLYFCHQCNRTVTIIPSPTSDLICPTCHSGFVEEFE  49



>gb|ACT21194.1| zinc finger protein [Carica papaya]
Length=340

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLP--NSELVCPNCNGNFLEEAE  199
            Q YFCY C RTV I+P P  +S+L+CP CNG FLEE E
Sbjct  6    QPYFCYQCNRTVRISPSPCPSSDLLCPTCNGGFLEELE  43



>ref|XP_010069512.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW57890.1| hypothetical protein EUGRSUZ_H00641 [Eucalyptus grandis]
Length=394

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  89   PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            PQ Y+C+ C  TV+I   P ++LVCP+CNG FLEE+E+
Sbjct  18   PQLYYCHQCRSTVSINRSPTADLVCPDCNGEFLEESES  55



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 3/34 (9%)
 Frame = +2

Query  95   DYFCYHCERTVTITPLPNSELVCPNCNGNFLEEA  196
            +Y+CY C+ TV   PLPNSEL CPNCNG F+EE+
Sbjct  19   NYYCYGCQSTV---PLPNSELSCPNCNGTFVEES  49



>gb|EYU22293.1| hypothetical protein MIMGU_mgv1a006235mg [Erythranthe guttata]
Length=451

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +2

Query  92   QDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAET  202
              YFCY C+R V+I P   P +E+VCPNC G FLEE+++
Sbjct  87   HQYFCYQCDRHVSIVPPTSPTAEIVCPNCQGGFLEESDS  125



>gb|KFM59559.1| hypothetical protein X975_00622, partial [Stegodyphus mimosarum]
Length=105

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            YFC+ C R VT++P+  +EL CP C+G FLEE
Sbjct  14   YFCHGCSREVTVSPIHTTELTCPECSGEFLEE  45



>ref|XP_008811090.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811098.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811103.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811112.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811119.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=362

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            Q YFC+ C+RTVT+T  P +E+ CP C+G F+EE +
Sbjct  14   QRYFCHQCDRTVTLTVSPGAEIACPICHGGFVEELD  49



>ref|XP_006374275.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
 gb|ABK95038.1| unknown [Populus trichocarpa]
 gb|ERP52072.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
Length=345

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++
Sbjct  10   QLYFCYQCNRTVTITP-PTTALSCPNCHEGFLEELDS  45



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  193
            Q YFC+ C+RTVT+T  P +E+ CP C+G FLEE
Sbjct  14   QLYFCHQCDRTVTLTLSPGAEIACPICHGGFLEE  47



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  199
            YFC+ C  TVTITP P  +L+CP CN +F+EE +
Sbjct  16   YFCHKCSNTVTITPSPTGDLLCPTCNSDFVEEYD  49



>ref|XP_004515274.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004515275.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
 ref|XP_004515276.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Cicer arietinum]
Length=349

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  98   YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            YFC+ CERT  I+   +++L+CPNCNG FLEE ET
Sbjct  20   YFCHQCERTAFIS-TSSTDLICPNCNGTFLEELET  53



>ref|XP_011047757.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=345

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  92   QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  202
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++
Sbjct  10   QLYFCYKCNRTVTITP-PATALSCPNCHEGFLEELDS  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552217968300