BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025N15

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGV54749.1|  ubiquitin 11                                            437   5e-152   Phaseolus vulgaris [French bean]
emb|CBI22349.3|  unnamed protein product                                437   1e-151   Vitis vinifera
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             435   2e-151   Brachypodium distachyon [annual false brome]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             437   2e-151   
gb|AEZ49160.1|  polyubiquitin                                           436   3e-151   Wolffia australiana
ref|XP_003626479.1|  Ubiquitin-like protein                             435   3e-151   
gb|AEW46688.1|  polyubiquitin                                           432   6e-151   Ulva linza
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             432   8e-151   Elaeis guineensis
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                432   8e-151   Erythranthe guttata [common monkey flower]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   432   8e-151   Camelina sativa [gold-of-pleasure]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    434   8e-151   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             433   9e-151   Brachypodium distachyon [annual false brome]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                436   1e-150   
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             433   1e-150   
gb|AAO43307.1|  putative polyubiquitin                                  433   1e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             432   1e-150   
ref|XP_002317213.1|  polyubiquitin family protein                       432   1e-150   Populus trichocarpa [western balsam poplar]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             432   1e-150   
dbj|BAC57955.1|  polyubiquitin                                          432   1e-150   Tripolium pannonicum [sea starwort]
gb|AET06143.1|  ubiquitin                                               432   1e-150   Papaver somniferum
emb|CAH59739.1|  polyubiquitin                                          432   1e-150   Plantago major [cart-track plant]
ref|NP_567286.1|  ubiquitin 11                                          432   1e-150   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85618.1|  unknown                                                 432   2e-150   Medicago truncatula
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   432   2e-150   Citrus sinensis [apfelsine]
ref|XP_007512209.1|  polyubiquitin                                      437   2e-150   Bathycoccus prasinos
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      432   2e-150   Setaria italica
gb|KJB36627.1|  hypothetical protein B456_006G167800                    431   2e-150   Gossypium raimondii
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             432   2e-150   Citrus clementina [clementine]
gb|AAP31578.1|  ubiquitin                                               431   2e-150   Hevea brasiliensis [jebe]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    440   2e-150   
gb|AFK41706.1|  unknown                                                 432   2e-150   Medicago truncatula
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   431   2e-150   Citrus sinensis [apfelsine]
emb|CDP08567.1|  unnamed protein product                                437   2e-150   Coffea canephora [robusta coffee]
ref|XP_003590494.1|  Ubiquitin                                          434   2e-150   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             434   2e-150   
gb|AIY27743.1|  polyubiquitin Ubi10                                     435   3e-150   Betula luminifera [liang ye hua]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             439   3e-150   Phaseolus vulgaris [French bean]
gb|AGV54228.1|  polyubiquitin-like protein                              437   3e-150   Phaseolus vulgaris [French bean]
gb|ABY60454.1|  putative polyubiquitin                                  433   3e-150   Adonis aestivalis var. palaestina
gb|AES89865.2|  polyubiquitin 3                                         433   3e-150   Medicago truncatula
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      434   3e-150   
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             434   4e-150   
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                434   4e-150   Erythranthe guttata [common monkey flower]
ref|XP_007014924.1|  Polyubiquitin 3                                    434   4e-150   Theobroma cacao [chocolate]
emb|CAA48140.1|  ubiquitin                                              433   4e-150   Antirrhinum majus [garden snapdragon]
gb|ABD96088.1|  polyubiquitin                                           432   4e-150   Malus domestica [apple tree]
prf||1604470A  poly-ubiquitin                                           432   4e-150
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         434   5e-150   Jatropha curcas
emb|CAA40323.1|  polyubiquitin protein                                  434   5e-150   Helianthus annuus
emb|CAH59740.1|  polyubiquitin                                          433   5e-150   Plantago major [cart-track plant]
ref|XP_003627152.1|  Ubiquitin                                          432   5e-150   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           433   5e-150   Brassica rapa
gb|KJB62484.1|  hypothetical protein B456_009G418900                    430   5e-150   Gossypium raimondii
gb|ACJ85643.1|  unknown                                                 430   5e-150   Medicago truncatula
gb|ABK94002.1|  unknown                                                 433   5e-150   Populus trichocarpa [western balsam poplar]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           433   6e-150   Fragaria vesca subsp. vesca
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          433   6e-150   Sorghum bicolor [broomcorn]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             433   6e-150   Citrus clementina [clementine]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         434   6e-150   
dbj|BAJ85978.1|  predicted protein                                      433   6e-150   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA54603.1|  pentameric polyubiquitin                               435   6e-150   Nicotiana tabacum [American tobacco]
gb|AES89866.2|  polyubiquitin 3                                         433   6e-150   Medicago truncatula
ref|NP_849292.1|  polyubiquitin 14                                      433   6e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851029.1|  polyubiquitin 3                                       433   6e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      434   6e-150   Brachypodium distachyon [annual false brome]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      433   6e-150   Brassica rapa
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           433   6e-150   Nelumbo nucifera [Indian lotus]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      433   6e-150   Citrus sinensis [apfelsine]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             433   6e-150   Citrus clementina [clementine]
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    440   6e-150   
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          430   7e-150   Sorghum bicolor [broomcorn]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             433   7e-150   Citrus clementina [clementine]
gb|AFK43392.1|  unknown                                                 430   7e-150   Medicago truncatula
gb|KJB81823.1|  hypothetical protein B456_013G163500                    433   7e-150   Gossypium raimondii
emb|CDP08569.1|  unnamed protein product                                433   7e-150   Coffea canephora [robusta coffee]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             433   7e-150   
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             433   7e-150   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             432   7e-150   
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             433   7e-150   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         433   7e-150   Jatropha curcas
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      433   8e-150   Oryza brachyantha
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      433   8e-150   Glycine max [soybeans]
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    430   9e-150   
gb|AAB95250.1|  ubiquitin                                               432   1e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CBY46745.1|  polyubiquitin 10 protein                               432   1e-149   Lepidium appelianum [hairy whitetop]
gb|EPS72031.1|  polyubiquitin                                           431   1e-149   Genlisea aurea
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             429   1e-149   Citrus clementina [clementine]
gb|AAM64530.1|  ubiquitin homolog                                       429   1e-149   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    434   1e-149   Gossypium raimondii
gb|AAC35858.1|  polyubiquitin                                           431   1e-149   Capsicum chinense [bonnet pepper]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            431   1e-149   Phaseolus vulgaris [French bean]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           436   2e-149   Eucalyptus grandis [rose gum]
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            432   2e-149   Phaseolus vulgaris [French bean]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             436   2e-149   
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    432   2e-149   Linum usitatissimum
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    432   2e-149   Phoenix dactylifera
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      432   2e-149   Camelina sativa [gold-of-pleasure]
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     429   2e-149   Rhodotorula toruloides
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  429   2e-149   Pisolithus microcarpus 441
gb|AFW66439.1|  putative ubiquitin family protein                       431   2e-149   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    432   2e-149   Gossypium raimondii
gb|AFY06654.1|  polyubiquitin                                           430   2e-149   Carica papaya [mamon]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             431   3e-149   Capsella rubella
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  428   3e-149   Piloderma croceum F 1598
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           431   3e-149   Elaeis guineensis
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 428   3e-149   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          428   3e-149   Yamadazyma tenuis ATCC 10573
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                434   3e-149   
emb|CEF99839.1|  Ubiquitin conserved site                               432   3e-149   Ostreococcus tauri
gb|AHC00631.1|  polyubiquitin                                           432   3e-149   Ganoderma lucidum
gb|KJB13592.1|  hypothetical protein B456_002G083000                    434   3e-149   Gossypium raimondii
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      431   4e-149   Camelina sativa [gold-of-pleasure]
ref|XP_002872109.1|  predicted protein                                  434   4e-149   
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  428   4e-149   Hypholoma sublateritium FD-334 SS-4
ref|XP_006381473.1|  polyubiquitin family protein                       431   4e-149   
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   428   4e-149   Piloderma croceum F 1598
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             428   5e-149   
gb|ACD31680.1|  ubiquitin                                               431   5e-149   Gossypium hirsutum [American cotton]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    434   5e-149   Gossypium raimondii
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   431   5e-149   Amanita muscaria Koide BX008
gb|ABU40645.1|  polyubiquitin                                           434   6e-149   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      434   6e-149   Tarenaya hassleriana [spider flower]
ref|XP_011110054.1|  hypothetical protein H072_4094                     427   6e-149   
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                434   6e-149   Erythranthe guttata [common monkey flower]
gb|ACS68205.1|  ubiquitin 10.2                                          434   6e-149   Brassica napus [oilseed rape]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             434   6e-149   Eutrema salsugineum [saltwater cress]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         434   6e-149   Elaeis guineensis
emb|CDP05795.1|  unnamed protein product                                434   6e-149   Coffea canephora [robusta coffee]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                434   6e-149   Erythranthe guttata [common monkey flower]
gb|AAB36545.1|  ubiquitin-like protein                                  434   6e-149   Phaseolus vulgaris [French bean]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      431   7e-149   Camelina sativa [gold-of-pleasure]
ref|XP_002508175.1|  ubiquitin                                          433   7e-149   Micromonas commoda
ref|XP_001420612.1|  predicted protein                                  433   7e-149   Ostreococcus lucimarinus CCE9901
emb|CAB81074.1|  polyubiquitin (ubq10)                                  436   7e-149   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    431   7e-149   Gossypium raimondii
gb|KDB11907.1|  ubiquitin                                               431   7e-149   Ustilaginoidea virens
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    433   7e-149   Nicotiana sylvestris
ref|NP_001174480.1|  Os05g0504766                                       433   7e-149   
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      433   7e-149   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        433   7e-149   
ref|NP_849300.4|  polyubiquitin 10                                      433   7e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CBY46746.1|  polyubiquitin 10 protein                               433   7e-149   Lepidium campestre [bastard cress]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             433   7e-149   
ref|NP_001148453.1|  LOC100282068                                       433   7e-149   Zea mays [maize]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    433   8e-149   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      433   8e-149   Nicotiana sylvestris
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                434   8e-149   Pyrus x bretschneideri [bai li]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         433   8e-149   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    433   8e-149   Camelina sativa [gold-of-pleasure]
ref|NP_568397.1|  ubiquitin 4                                           433   8e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             433   8e-149   
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    433   8e-149   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             433   8e-149   Capsella rubella
gb|AAB68045.1|  polyubiquitin                                           433   9e-149   Fragaria x ananassa
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         433   9e-149   Nicotiana tomentosiformis
gb|AAY86773.1|  polyubiquitin                                           433   9e-149   Noccaea caerulescens
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    433   9e-149   Oryza sativa Japonica Group [Japonica rice]
emb|CCL99875.1|  predicted protein                                      430   9e-149   Fibroporia radiculosa
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      433   9e-149   Nelumbo nucifera [Indian lotus]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      433   9e-149   Nicotiana tomentosiformis
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           430   1e-148   Nicotiana tomentosiformis
gb|AAX40652.1|  polyubiquitin                                           433   1e-148   Oryza sativa Japonica Group [Japonica rice]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     433   1e-148   Arabidopsis thaliana [mouse-ear cress]
gb|KIY45417.1|  ubiquitin                                               430   1e-148   Fistulina hepatica ATCC 64428
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  427   1e-148   Paxillus rubicundulus Ve08.2h10
dbj|GAK65396.1|  ubiquitin                                              431   1e-148   Moesziomyces antarcticus
gb|EMS65864.1|  Polyubiquitin                                           434   1e-148   Triticum urartu
gb|KIR63773.1|  polyubiquitin                                           430   1e-148   Cryptococcus gattii CA1873
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   430   1e-148   Sphaerobolus stellatus SS14
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                430   1e-148   Serpula lacrymans var. lacrymans S7.3
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      432   1e-148   Nicotiana tomentosiformis
ref|XP_003030030.1|  polyubiquitin                                      429   1e-148   Schizophyllum commune H4-8
ref|NP_001053957.1|  Os04g0628100                                       433   1e-148   
gb|AAK68824.1|  Unknown protein                                         427   1e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    429   1e-148   Populus euphratica
gb|EMS60894.1|  Polyubiquitin                                           435   2e-148   Triticum urartu
gb|AAO43308.1|  putative polyubiquitin                                  427   2e-148   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105376.1|  polyubiquitin                                      432   2e-148   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          436   2e-148   Arabidopsis thaliana [mouse-ear cress]
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 429   2e-148   Scleroderma citrinum Foug A
ref|XP_001755431.1|  predicted protein                                  426   2e-148   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    432   2e-148   Hebeloma cylindrosporum h7
ref|XP_007366816.1|  polyubiquitin                                      429   2e-148   Dichomitus squalens LYAD-421 SS1
gb|KIR29996.1|  polyubiquitin                                           430   2e-148   Cryptococcus gattii VGII LA55
ref|XP_007763327.1|  polyubiquitin                                      429   2e-148   Coniophora puteana RWD-64-598 SS2
ref|XP_001828882.1|  ubiquitin C                                        429   2e-148   Coprinopsis cinerea okayama7#130
ref|XP_001555417.1|  polyubiquitin                                      429   2e-148   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             429   2e-148   Exserohilum turcica Et28A
ref|XP_007339454.1|  ubiquitin                                          429   2e-148   
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  429   2e-148   Botryobasidium botryosum FD-172 SS1
dbj|BAL61087.1|  polyubiquitin                                          426   2e-148   Dianthus caryophyllus [carnation]
gb|AAQ07453.1|  ubiquitin                                               432   2e-148   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      434   2e-148   Camelina sativa [gold-of-pleasure]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             426   2e-148   Selaginella moellendorffii
gb|KJB62483.1|  hypothetical protein B456_009G418900                    432   2e-148   Gossypium raimondii
ref|XP_002953480.1|  polyubiquitin                                      429   2e-148   Volvox carteri f. nagariensis
gb|KEH31155.1|  polyubiquitin 3                                         432   3e-148   Medicago truncatula
gb|EWZ40370.1|  ubiquitin C                                             426   3e-148   Fusarium oxysporum Fo47
emb|CCT70325.1|  UBI4-Ubiquitin                                         428   3e-148   Fusarium fujikuroi IMI 58289
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  431   3e-148   Plicaturopsis crispa FD-325 SS-3
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    432   3e-148   Camelina sativa [gold-of-pleasure]
ref|XP_001783045.1|  predicted protein                                  426   4e-148   
gb|KIY53974.1|  polyubiquitin                                           428   4e-148   Fistulina hepatica ATCC 64428
gb|AAQ84316.1|  fiber polyubiquitin                                     426   4e-148   Gossypium barbadense [Egyptian cotton]
gb|KJB13590.1|  hypothetical protein B456_002G083000                    434   5e-148   Gossypium raimondii
gb|ADD52202.1|  ubiquitin                                               431   5e-148   Catharanthus roseus [chatas]
gb|AAB95252.1|  ubiquitin                                               431   5e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    431   5e-148   Setaria italica
ref|XP_001598085.1|  polyubiquitin                                      428   6e-148   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001764949.1|  predicted protein                                  429   6e-148   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              425   6e-148   Pseudocercospora fijiensis CIRAD86
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    434   6e-148   
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  425   7e-148   Naumovozyma dairenensis CBS 421
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      434   7e-148   Setaria italica
gb|EPX74297.1|  ubiquitin                                               425   7e-148   Schizosaccharomyces octosporus yFS286
dbj|BAK02501.1|  predicted protein                                      434   7e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             434   7e-148   Prunus persica
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                434   7e-148   Erythranthe guttata [common monkey flower]
gb|AAD03343.1|  ubiquitin                                               434   7e-148   Pisum sativum [garden pea]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     425   7e-148   Lachancea lanzarotensis
ref|XP_001931824.1|  ubiquitin                                          425   7e-148   Pyrenophora tritici-repentis Pt-1C-BFP
emb|CAA40324.1|  hexaubiquitin protein                                  434   7e-148   Helianthus annuus
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         433   8e-148   Jatropha curcas
ref|NP_001045980.1|  Os02g0161900                                       433   8e-148   
dbj|BAK03691.1|  predicted protein                                      433   8e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             433   8e-148   
ref|XP_002891806.1|  predicted protein                                  431   9e-148   
dbj|BAJ91912.1|  predicted protein                                      433   9e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          433   9e-148   Sorghum bicolor [broomcorn]
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      431   9e-148   Nelumbo nucifera [Indian lotus]
gb|AAB95251.1|  ubiquitin                                               433   9e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    433   9e-148   Camelina sativa [gold-of-pleasure]
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           433   9e-148   Nelumbo nucifera [Indian lotus]
gb|AAC16012.1|  polyubiquitin                                           433   9e-148   Elaeagnus umbellata [aki-gumi]
ref|XP_003052575.1|  predicted protein                                  427   1e-147   [Nectria] haematococca mpVI 77-13-4
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           433   1e-147   Camelina sativa [gold-of-pleasure]
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      433   1e-147   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    433   1e-147   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           433   1e-147   Nicotiana sylvestris
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   433   1e-147   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      433   1e-147   Sesamum indicum [beniseed]
ref|NP_849299.4|  polyubiquitin 10                                      433   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           433   1e-147   Sesamum indicum [beniseed]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           433   1e-147   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                430   1e-147   
ref|XP_007049060.1|  Polyubiquitin 10                                   433   1e-147   
ref|XP_719867.1|  hypothetical protein CaO19.6771                       424   1e-147   Candida albicans SC5314
gb|AIS40894.1|  polyubiquitin                                           434   1e-147   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             427   1e-147   
gb|ACN40936.1|  unknown                                                 433   1e-147   Picea sitchensis
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    424   1e-147   Parastagonospora nodorum SN15
gb|ACX46987.1|  ubiquitin                                               432   1e-147   Guzmania wittmackii x Guzmania lingulata
ref|XP_001755307.1|  predicted protein                                  427   1e-147   
gb|AFW70219.1|  polyubiquitin-like protein                              434   1e-147   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             429   1e-147   Phaseolus vulgaris [French bean]
ref|XP_001830230.1|  ubiquitin                                          427   1e-147   Coprinopsis cinerea okayama7#130
ref|XP_002888394.1|  hexaubiquitin protein                              434   1e-147   
ref|XP_006372519.1|  polyubiquitin family protein                       427   1e-147   Populus trichocarpa [western balsam poplar]
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                429   2e-147   Serpula lacrymans var. lacrymans S7.3
ref|XP_002888365.1|  polyubiquitin                                      433   2e-147   Arabidopsis lyrata subsp. lyrata
ref|XP_003196661.1|  ATP-dependent protein binding protein              430   2e-147   Cryptococcus gattii WM276
gb|AGT38457.1|  polyubiquitin                                           434   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      430   2e-147   Populus euphratica
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                433   2e-147   Prunus mume [ume]
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 430   2e-147   Pleurotus ostreatus PC15
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  430   2e-147   Galerina marginata CBS 339.88
ref|XP_001880135.1|  ubiquitin                                          430   2e-147   Laccaria bicolor S238N-H82
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  430   2e-147   Plicaturopsis crispa FD-325 SS-3
gb|EUC59758.1|  polyubiquitin                                           430   2e-147   Rhizoctonia solani AG-3 Rhs1AP
gb|KJB62486.1|  hypothetical protein B456_009G418900                    430   2e-147   Gossypium raimondii
gb|AFR98116.1|  polyubiquitin                                           430   2e-147   Cryptococcus neoformans var. grubii H99
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             429   2e-147   Serpula lacrymans var. lacrymans S7.9
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           432   2e-147   Nicotiana sylvestris
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  429   2e-147   Pisolithus microcarpus 441
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   424   2e-147   Brassica rapa
gb|EJU00136.1|  ubiquitin                                               429   2e-147   Dacryopinax primogenitus
ref|XP_001227036.1|  polyubiquitin                                      427   2e-147   Chaetomium globosum CBS 148.51
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  429   2e-147   Hydnomerulius pinastri MD-312
gb|AAO43309.1|  putative polyubiquitin                                  424   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002839703.1|  hypothetical protein                               426   2e-147   
ref|XP_007864655.1|  ubiquitin                                          429   3e-147   
ref|XP_001210780.1|  ubiquitin                                          426   3e-147   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    429   3e-147   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                432   3e-147   
gb|AAV65292.1|  polyubiquitin                                           426   3e-147   
gb|KIW56414.1|  polyubiquitin                                           426   3e-147   
emb|CCO30833.1|  Polyubiquitin                                          431   3e-147   
gb|EGA57707.1|  Ubi4p                                                   424   3e-147   
emb|CAA52290.1|  polyubiquitin                                          429   3e-147   
gb|KEZ40313.1|  Polyubiquitin                                           426   3e-147   
ref|XP_002551324.1|  ubiquitin                                          426   3e-147   
dbj|BAP70433.1|  Ubiquitin                                              426   3e-147   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         426   3e-147   
ref|XP_002494205.1|  Ubiquitin                                          426   3e-147   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     426   3e-147   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  426   4e-147   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    432   4e-147   
ref|XP_010756991.1|  polyubiquitin                                      426   4e-147   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      432   4e-147   
gb|EEQ88150.1|  ubiquitin                                               426   4e-147   
gb|EEH07231.1|  ubiquitin                                               426   4e-147   
gb|EEH20847.2|  polyubiquitin                                           426   4e-147   
gb|KIY97628.1|  ubiquitin C                                             426   5e-147   
emb|CCG34086.1|  Polyubiquitin                                          426   5e-147   
ref|XP_002419618.1|  ubiquitin, putative                                426   5e-147   
dbj|GAA27344.2|  polyubiquitin-A                                        425   5e-147   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      426   5e-147   
ref|XP_002791169.1|  ubiquitin                                          426   6e-147   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  422   6e-147   
gb|AFW66445.1|  ubiquitin2                                              434   6e-147   
ref|XP_008034069.1|  ubiquitin 10.1                                     431   7e-147   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   422   7e-147   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    422   7e-147   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    434   8e-147   
gb|AAA82978.1|  polyubiquitin                                           428   8e-147   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           434   8e-147   
ref|XP_659604.1|  hypothetical protein AN2000.2                         426   8e-147   
emb|CAA51679.1|  ubiquitin                                              434   8e-147   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           434   8e-147   
gb|AAO43306.1|  putative polyubiquitin                                  426   9e-147   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  425   9e-147   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           433   9e-147   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      433   1e-146   
ref|XP_003608276.1|  Ubiquitin                                          433   1e-146   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                433   1e-146   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          433   1e-146   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    433   1e-146   
gb|AAO43305.1|  putative polyubiquitin                                  426   1e-146   
gb|ABD32351.2|  Ubiquitin                                               434   1e-146   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    425   1e-146   
ref|XP_005644220.1|  polyubiquitin                                      425   1e-146   
emb|CCA16073.1|  polyubiquitin putative                                 433   1e-146   
ref|XP_003627151.1|  Ubiquitin                                          433   1e-146   
ref|XP_007808982.1|  ubiquitin                                          426   1e-146   
ref|XP_003607670.1|  Ubiquitin                                          433   1e-146   
gb|AFK47245.1|  unknown                                                 422   1e-146   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                433   1e-146   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      433   1e-146   
gb|AAL91103.1|  ubiquitin                                               423   1e-146   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              433   1e-146   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             427   1e-146   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    433   1e-146   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    422   1e-146   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           434   1e-146   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      433   1e-146   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    433   1e-146   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                433   1e-146   
gb|EMS24129.1|  ubiquitin C                                             422   1e-146   
gb|EZF98642.1|  polyubiquitin                                           422   1e-146   
gb|AAC67552.1|  polyubiquitin                                           427   1e-146   
tpd|FAA00317.1|  TPA: polyubiquitin                                     424   2e-146   
ref|XP_002842034.1|  hypothetical protein                               424   2e-146   
ref|XP_001538486.1|  polyubiquitin                                      424   2e-146   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     433   2e-146   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             427   2e-146   
gb|AAP80689.1|  polyubiquitin                                           422   2e-146   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    426   2e-146   
gb|AAY33920.2|  polyubiquitin                                           427   2e-146   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              422   2e-146   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    440   2e-146   
dbj|BAL61084.1|  polyubiqutin                                           427   2e-146   
ref|XP_001777816.1|  predicted protein                                  427   2e-146   
gb|AFW66442.1|  putative ubiquitin family protein                       421   2e-146   
dbj|BAK61744.1|  ubiquitin                                              421   2e-146   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     421   2e-146   
tpd|FAA00319.1|  TPA: polyubiquitin                                     430   2e-146   
ref|XP_011388891.1|  putative ubiquitin                                 430   2e-146   
ref|XP_007307433.1|  polyubiquitin                                      430   2e-146   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            422   2e-146   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          421   2e-146   
ref|XP_007861169.1|  polyubiquitin                                      430   2e-146   
emb|CDI53149.1|  probable Polyubiquitin protein                         424   3e-146   
ref|XP_567862.1|  ATP-dependent protein binding protein                 429   3e-146   
gb|ELR08709.1|  polyubiquitin                                           427   3e-146   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    427   3e-146   
ref|XP_453980.1|  hypothetical protein                                  427   3e-146   
ref|NP_013061.1|  ubiquitin                                             427   3e-146   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   430   3e-146   
gb|KDR10312.1|  Ubiquitin                                               421   3e-146   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                427   3e-146   
ref|XP_004341200.1|  polyubiquitin, putative                            421   3e-146   
ref|XP_001246797.1|  polyubiquitin                                      424   3e-146   
tpd|FAA00316.1|  TPA: polyubiquitin                                     426   3e-146   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   421   3e-146   
gb|ETN78467.1|  ubiquitin family protein                                421   3e-146   
gb|AAO43310.1|  putative polyubiquitin                                  421   3e-146   
ref|XP_002171731.1|  ubiquitin                                          426   3e-146   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          421   4e-146   
ref|XP_011275993.1|  ubiquitin C                                        426   4e-146   
ref|NP_983342.1|  ACL062Cp                                              426   4e-146   
dbj|GAA87419.1|  polyubiquitin                                          423   4e-146   
dbj|BAO38900.1|  ubiquitin                                              426   4e-146   
gb|KFY77115.1|  hypothetical protein V499_03430                         426   4e-146   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             426   4e-146   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  426   4e-146   
ref|NP_595409.1|  ubiquitin                                             426   5e-146   
ref|XP_002627625.1|  ubiquitin                                          426   5e-146   
dbj|GAA55031.1|  ubiquitin C                                            420   5e-146   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           432   5e-146   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       426   5e-146   
ref|XP_958803.1|  ubiquitin                                             423   5e-146   
gb|AEH41483.1|  ubiquitin                                               423   6e-146   
gb|KIZ01427.1|  ubiquitin C                                             426   7e-146   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        420   7e-146   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      434   8e-146   
gb|KFY10578.1|  hypothetical protein V492_04946                         427   8e-146   
ref|XP_005831810.1|  ubiquitin                                          420   8e-146   
ref|XP_002553736.1|  KLTH0E05852p                                       426   8e-146   
dbj|BAK61751.1|  ubiquitin                                              419   9e-146   
ref|XP_003331105.1|  polyubiquitin-A                                    433   1e-145   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      433   1e-145   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         433   1e-145   
gb|KHN45015.1|  Polyubiquitin-A                                         433   1e-145   
gb|AAO43303.1|  putative polyubiquitin                                  423   1e-145   
gb|AAO43304.1|  putative polyubiquitin                                  423   1e-145   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             427   1e-145   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         423   2e-145   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    431   2e-145   
gb|ADD24466.1|  Ubiquitin                                               419   2e-145   
gb|AGZ15412.1|  fiber polyubiquitin                                     419   2e-145   
ref|XP_001774326.1|  predicted protein                                  427   2e-145   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         422   2e-145   
gb|AAL91109.1|  ubiquitin                                               422   2e-145   
gb|EMS54972.1|  Polyubiquitin-A                                         434   2e-145   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              420   2e-145   
emb|CAJ41447.1|  polyubiquitin                                          421   2e-145   
gb|EJD76734.1|  polyubiquitin, variant 2                                422   3e-145   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       419   3e-145   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   431   3e-145   
gb|AAC13691.1|  poly-ubiquitin                                          424   3e-145   
ref|XP_004365491.1|  polyubiquitin 5                                    418   3e-145   
ref|XP_001766873.1|  predicted protein                                  422   3e-145   
ref|XP_460488.1|  DEHA2F02816p                                          427   3e-145   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             420   3e-145   
ref|XP_008510526.1|  PREDICTED: polyubiquitin-B                         422   4e-145   
dbj|BAH71115.1|  ACYPI006410                                            418   4e-145   
ref|XP_001486573.1|  ubiquitin                                          427   4e-145   
gb|KHN74847.1|  Polyubiquitin-A                                         425   4e-145   
gb|ELU42015.1|  polyubiquitin                                           434   4e-145   
ref|XP_003290908.1|  ubiquitin                                          418   4e-145   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           421   4e-145
tpg|DAA34473.1|  TPA: ubiquitin                                         418   4e-145   
ref|XP_002498336.1|  ZYRO0G07854p                                       426   5e-145   
gb|EFN76024.1|  Ubiquitin                                               418   5e-145   
gb|ABI53721.1|  polyubiquitin                                           426   5e-145   
gb|ABV22331.1|  ubiquitin                                               421   5e-145   
ref|XP_008816966.1|  polyubiquitin                                      421   5e-145   
gb|AFD53810.1|  ubiquitin                                               419   6e-145   
ref|XP_001897032.1|  polyubiquitin precursor                            424   6e-145   
emb|CDP08561.1|  unnamed protein product                                432   6e-145   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         417   6e-145   
ref|NP_176714.4|  ubiquitin 13                                          421   6e-145   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         417   7e-145   
emb|CDP91931.1|  Protein Bm3564, isoform e                              423   8e-145   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              417   8e-145   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 419   8e-145   
emb|CAA30815.1|  unnamed protein product                                417   8e-145   
gb|ABF66639.1|  ubiquitin                                               420   9e-145   
gb|AAA30719.1|  polyubiquitin                                           417   9e-145   
ref|XP_005650632.1|  hexaubiquitin protein                              426   9e-145   
dbj|BAE40351.1|  unnamed protein product                                419   9e-145   
ref|XP_001947010.1|  PREDICTED: polyubiquitin-G                         423   9e-145   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              418   1e-144   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             426   1e-144   
ref|XP_004946720.1|  PREDICTED: polyubiquitin-C-like isoform X2         422   1e-144   
emb|CCF74470.1|  unnamed protein product                                419   1e-144   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        433   1e-144   
ref|NP_061828.1|  polyubiquitin-B precursor                             417   1e-144   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    418   1e-144   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         417   1e-144   
ref|XP_667472.1|  ubiquitin B                                           417   1e-144   
ref|XP_001610925.1|  polyubiquitin                                      417   1e-144   
ref|XP_010197723.1|  PREDICTED: polyubiquitin-B isoform X2              419   1e-144   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              417   1e-144   
emb|CAJ32646.1|  ubiquitin                                              417   1e-144   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          417   1e-144   
gb|AAX43350.1|  ubiquitin B                                             417   1e-144   
ref|XP_002099886.1|  GE16472                                            417   1e-144   
ref|XP_007462722.1|  PREDICTED: polyubiquitin-C isoform X2              419   1e-144   
emb|CAB55973.1|  hypothetical protein                                   417   1e-144   
gb|AAA28997.1|  ubiquitin                                               417   1e-144   
ref|XP_010298599.1|  PREDICTED: polyubiquitin-B isoform X1              419   1e-144   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              417   1e-144   
emb|CAX79692.1|  ubiquitin C                                            417   1e-144   
ref|XP_002964737.1|  hypothetical protein SELMODRAFT_270468             428   1e-144   
ref|XP_005770636.1|  hypothetical protein EMIHUDRAFT_349903             419   1e-144   
ref|NP_001133175.1|  polyubiquitin                                      417   1e-144   
emb|CAX72421.1|  ubiquitin C                                            417   1e-144   
ref|XP_005764959.1|  hypothetical protein EMIHUDRAFT_374268             419   1e-144   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         416   1e-144   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         416   1e-144   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         416   2e-144   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              416   2e-144   
gb|ACL98140.1|  ubiquitin C variant                                     417   2e-144   
gb|AAA31133.1|  poly-ubiquitin precursor                                417   2e-144   
ref|XP_004205544.1|  PREDICTED: polyubiquitin-B-like isoform 2          419   2e-144   
ref|XP_010876509.1|  PREDICTED: polyubiquitin-B                         416   2e-144   
ref|XP_008924875.1|  PREDICTED: polyubiquitin-B isoform X2              418   2e-144   
ref|XP_002674746.1|  polyubiquitin                                      416   2e-144   
ref|XP_011298607.1|  PREDICTED: polyubiquitin isoform X1                422   2e-144   



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   437 bits (1124),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 225/245 (92%), Positives = 228/245 (93%), Gaps = 4/245 (2%)
 Frame = +1

Query  19   CSLNL----FYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPD  186
            C+ NL    +    HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  187  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  366
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  139

Query  367  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  140  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  199

Query  547  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTL  726
            LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTL
Sbjct  200  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  259

Query  727  HLXLQ  741
            HL L+
Sbjct  260  HLVLR  264


 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  106  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  220

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   437 bits (1124),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 226/240 (94%), Gaps = 1/240 (0%)
 Frame = +1

Query  25   LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  132  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  191

Query  562  ITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  192  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  251


 Score =   367 bits (943),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 193/205 (94%), Gaps = 5/205 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  92   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  146

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  147  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  206

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  207  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  266

Query  559  TITLEVESSDTIDNVKAKIQDKEGI  633
            TITLEVESSDTIDNVKAKIQDKEG+
Sbjct  267  TITLEVESSDTIDNVKAKIQDKEGM  291



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 225/242 (93%), Gaps = 5/242 (2%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQR  195
            +C L  F   R       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  12   MCDLEDFLECRKM-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  66

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  67   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  126

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  127  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  186

Query  556  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLX  735
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL 
Sbjct  187  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  246

Query  736  LQ  741
            L+
Sbjct  247  LR  248


 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   437 bits (1123),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   365 bits (938),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 191/203 (94%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKE  627
            TITLEVESSDTIDNVKAKIQDK+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKK  262



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   436 bits (1120),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/231 (96%), Positives = 223/231 (97%), Gaps = 2/231 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDG  228
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  588
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  134  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193

Query  589  TIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            TIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  244


 Score =   360 bits (924),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 189/202 (94%), Gaps = 5/202 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEVESSDTIDNVKAKIQDK  624
            TITLEV SSDTIDNVKAKIQDK
Sbjct  260  TITLEVASSDTIDNVKAKIQDK  281



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   435 bits (1119),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLAD  243
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  604  KAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  227  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  272


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   432 bits (1112),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 155/167 (93%), Gaps = 5/167 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  519
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   432 bits (1112),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   432 bits (1112),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   432 bits (1112),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   434 bits (1115),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   352 bits (902),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 184/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGK  239

Query  559  TITLEVESSDTIDNVKAK  612
            TITLE ESSDTIDNVKAK
Sbjct  240  TITLEXESSDTIDNVKAK  257



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   433 bits (1113),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   436 bits (1122),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 227/242 (94%), Gaps = 4/242 (2%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQR  195
            +  + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  21   VGRVELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  76

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  77   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  136

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  137  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  196

Query  556  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLX  735
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL 
Sbjct  197  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  256

Query  736  LQ  741
            L+
Sbjct  257  LR  258


 Score =   434 bits (1117),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  274  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  333

Query  739  Q  741
            +
Sbjct  334  R  334


 Score =   301 bits (772),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   433 bits (1114),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 182/194 (94%), Gaps = 5/194 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDN  600
            TITLEVESSDTIDN
Sbjct  240  TITLEVESSDTIDN  253



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  184  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  243

Query  739  Q  741
            +
Sbjct  244  R  244


 Score =   327 bits (838),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            NVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  168


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   432 bits (1111),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   432 bits (1111),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   432 bits (1111),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   432 bits (1111),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   432 bits (1110),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   432 bits (1110),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 159/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   432 bits (1110),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   432 bits (1110),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   432 bits (1110),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   437 bits (1123),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  231  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  290

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  291  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  350

Query  739  Q  741
            +
Sbjct  351  R  351


 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 216/275 (79%), Gaps = 51/275 (19%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVE-----------------------------------SSDTIDN  144
            MQIFVKTLTGKTITLEVE                                   S+ TI++
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  145  VKA---------KIQDKE*-------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
              A         + ++KE        IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  636
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240

Query  637  PDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            PDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  241  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  275


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  192  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  246

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  247  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  306

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   432 bits (1110),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   431 bits (1109),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   432 bits (1110),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   431 bits (1109),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   440 bits (1131),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/237 (95%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            EVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  387  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  443


 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   432 bits (1110),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   431 bits (1109),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   437 bits (1123),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 226/242 (93%), Gaps = 0/242 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQR  195
            +    L  +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  36   LTHWQLRSYLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  95

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  96   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  155

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  156  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  215

Query  556  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLX  735
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL 
Sbjct  216  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  275

Query  736  LQ  741
            L+
Sbjct  276  LR  277


 Score =   417 bits (1071),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 216/230 (94%), Gaps = 5/230 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  233  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  292

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNI  708
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNI
Sbjct  293  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   434 bits (1117),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   434 bits (1117),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   435 bits (1118),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 227/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  63   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  117

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK
Sbjct  118  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  178  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  237

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  238  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  297

Query  739  Q  741
            +
Sbjct  298  R  298


 Score =   404 bits (1037),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 208/224 (93%), Positives = 212/224 (95%), Gaps = 2/224 (1%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVK L  KTITLEV+    IDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKA
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  179  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  222


 Score =   352 bits (904),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 185/197 (94%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQRL
Sbjct  139  STLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  193

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  194  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  253

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  254  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  313

Query  559  TITLEVESSDTIDNVKA  609
            TITLEVESSDTIDNVKA
Sbjct  314  TITLEVESSDTIDNVKA  330



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   439 bits (1128),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 228/243 (94%), Gaps = 1/243 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQ  192
              +L    H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQ
Sbjct  30   FIALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  89

Query  193  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  90   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  149

Query  373  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  552
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  150  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  209

Query  553  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHL  732
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL
Sbjct  210  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  269

Query  733  XLQ  741
             L+
Sbjct  270  VLR  272


 Score =   433 bits (1113),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  228  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  287

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  288  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  347

Query  739  Q  741
            +
Sbjct  348  R  348


 Score =   433 bits (1113),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  189  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  303

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  304  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  363

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  364  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  423

Query  739  Q  741
            +
Sbjct  424  R  424


 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  265  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  379

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  380  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   437 bits (1123),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 222/233 (95%), Positives = 225/233 (97%), Gaps = 2/233 (1%)
 Frame = +1

Query  49   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLE  222
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  223  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  402
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  263

Query  403  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  582
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323

Query  583  SDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            SDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  324  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  376


 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 224/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1099),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   433 bits (1113),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 226/240 (94%), Gaps = 5/240 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  116  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  175

Query  562  ITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  176  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  235


 Score =   380 bits (976),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/210 (93%), Positives = 198/210 (94%), Gaps = 5/210 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQ  648
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  251  TITLEVESSDTIDNVKAKIQDKEGIPPDQQ  280


 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 123/135 (91%), Gaps = 5/135 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQR  423
            AKIQDKEGIPPDQQR
Sbjct  267  AKIQDKEGIPPDQQR  281



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   433 bits (1113),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   331 bits (848),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 173/184 (94%), Gaps = 5/184 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLE  573
            ITLE
Sbjct  241  ITLE  244



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   434 bits (1116),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 220/225 (98%), Positives = 221/225 (98%), Gaps = 0/225 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  607  AKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            AKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  306


 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 6/230 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLA---  240
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  241  ---DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  591
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  180

Query  592  IDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            IDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  230


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  147  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   434 bits (1115),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1111),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   434 bits (1115),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1111),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   434 bits (1115),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1111),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   433 bits (1114),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  171  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  230

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  231  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  290

Query  739  Q  741
            +
Sbjct  291  R  291


 Score =   414 bits (1065),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  636
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  637  PDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            PDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  215


 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  246

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   432 bits (1111),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264

Query  739  Q  741
            +
Sbjct  265  R  265


 Score =   370 bits (949),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQK  714
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  715  ESTLHLXLQ  741
            ESTLHL L+
Sbjct  181  ESTLHLVLR  189


 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270



>prf||1604470A poly-ubiquitin
Length=272

 Score =   432 bits (1111),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  32   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  86

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  87   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  146

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  147  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  206

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  207  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  266

Query  739  Q  741
            +
Sbjct  267  R  267


 Score =   370 bits (949),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  3    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  62

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  63   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  122

Query  535  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQK  714
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQK
Sbjct  123  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  182

Query  715  ESTLHLXLQ  741
            ESTLHL L+
Sbjct  183  ESTLHLVLR  191


 Score =   300 bits (768),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  579
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  580  SSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            SSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  115



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   434 bits (1116),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1112),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   434 bits (1117),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   357 bits (916),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 187/199 (94%), Gaps = 5/199 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKI  615
            TITLEVESSDTIDNVKAKI
Sbjct  316  TITLEVESSDTIDNVKAKI  334



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   433 bits (1114),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1111),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  305



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   432 bits (1111),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   351 bits (900),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/241 (79%), Positives = 193/241 (80%), Gaps = 40/241 (17%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLE                                   DGRTLADYNIQKESTLHL L
Sbjct  240  TITLE-----------------------------------DGRTLADYNIQKESTLHLVL  264

Query  739  Q  741
            +
Sbjct  265  R  265


 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 81/135 (60%), Gaps = 46/135 (34%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQK----------------------------------------  258
            IFAGKQLEDGRTLADYNIQK                                        
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQ  255

Query  259  -ESTLHLVLRLRGGM  300
             ESTLHLVLRLRGG 
Sbjct  256  KESTLHLVLRLRGGF  270



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   433 bits (1114),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   430 bits (1106),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   430 bits (1106),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   433 bits (1114),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1109),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   434 bits (1117),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  132  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  191

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  192  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  251

Query  739  Q  741
            +
Sbjct  252  R  252


 Score =   434 bits (1117),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  207

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  208  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  267

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  268  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  327

Query  739  Q  741
            +
Sbjct  328  R  328


 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +1

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  612
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  613  IQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            IQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  176


 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  169  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  283

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  284  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   435 bits (1118),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   372 bits (955),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 194/206 (94%), Gaps = 5/206 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIP  636
            TITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIP  341



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   434 bits (1117),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 220/225 (98%), Positives = 221/225 (98%), Gaps = 0/225 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  607  AKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            AKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  260


 Score =   434 bits (1117),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  275

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  276  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  335

Query  739  Q  741
            +
Sbjct  336  R  336


 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  291

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  292  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   433 bits (1114),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   440 bits (1132),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 224/237 (95%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            EVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  387  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  443


 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 173/184 (94%), Gaps = 5/184 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  285  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  339

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  340  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  399

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  400  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  459

Query  562  ITLE  573
            ITLE
Sbjct  460  ITLE  463



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   430 bits (1106),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQK+STLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLR  224


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   430 bits (1106),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   432 bits (1112),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   422 bits (1086),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 217/234 (93%), Positives = 220/234 (94%), Gaps = 5/234 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKES  720
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKE+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEN  293



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1108),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   433 bits (1113),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   433 bits (1113),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   433 bits (1113),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1109),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   430 bits (1105),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   432 bits (1112),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1108),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   432 bits (1112),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  183  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  242

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  243  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  302

Query  739  Q  741
            +
Sbjct  303  R  303


 Score =   431 bits (1109),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  184  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  227


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  144  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  258

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  259  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  648
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  649  XLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
             LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLR  151



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   431 bits (1109),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  149  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  208

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  209  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  268

Query  739  Q  741
            +
Sbjct  269  R  269


 Score =   373 bits (958),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = +1

Query  163  DKE*IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  342
            DKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  523  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADY  702
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADY
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  180

Query  703  NIQKESTLHLXLQ  741
            NIQKESTLHL L+
Sbjct  181  NIQKESTLHLVLR  193


 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  110  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  164

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  165  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  224

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  225  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   429 bits (1104),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGR LADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   429 bits (1104),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   434 bits (1116),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264

Query  739  Q  741
            +
Sbjct  265  R  265


 Score =   434 bits (1116),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  281  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  340

Query  739  Q  741
            +
Sbjct  341  R  341


 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/224 (83%), Positives = 186/224 (83%), Gaps = 35/224 (16%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  146  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  189


 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  297  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   431 bits (1107),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  140  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  199

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  200  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  259

Query  739  Q  741
            +
Sbjct  260  R  260


 Score =   358 bits (918),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  369
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  549
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  550  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLH  729
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLH
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  180

Query  730  LXLQ  741
            L L+
Sbjct  181  LVLR  184


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   431 bits (1107),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   379 bits (973),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 198/210 (94%), Gaps = 5/210 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQ  648
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   436 bits (1122),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 229/242 (95%), Gaps = 0/242 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQR  195
            + +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQR
Sbjct  27   LGALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  86

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  87   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  146

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  147  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  206

Query  556  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLX  735
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL 
Sbjct  207  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  266

Query  736  LQ  741
            L+
Sbjct  267  LR  268


 Score =   433 bits (1114),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  224  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  283

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDT+DNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  284  TITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  343

Query  739  Q  741
            +
Sbjct  344  R  344


 Score =   433 bits (1114),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  185  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVK
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVK  299

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  300  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  359

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  360  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  419

Query  739  Q  741
            +
Sbjct  420  R  420


 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQRL
Sbjct  261  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  375

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  376  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   436 bits (1120),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 228/240 (95%), Gaps = 4/240 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  130  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  189

Query  562  ITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  190  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  249


 Score =   434 bits (1115),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  204

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  205  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  264

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  265  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  324

Query  739  Q  741
            +
Sbjct  325  R  325


 Score =   434 bits (1115),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  166  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  280

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  281  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  340

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  341  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  400

Query  739  Q  741
            +
Sbjct  401  R  401


 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  242  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  356

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  357  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264

Query  739  Q  741
            +
Sbjct  265  R  265


 Score =   369 bits (948),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQK  714
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  715  ESTLHLXLQ  741
            ESTLHL L+
Sbjct  181  ESTLHLVLR  189


 Score =   368 bits (944),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 193/205 (94%), Gaps = 5/205 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEVESSDTIDNVKAKIQDKEGI  633
            TITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  TITLEVESSDTIDNVKAKIQDKEGI  305



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1107),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1106),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   429 bits (1102),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/230 (94%), Positives = 221/230 (96%), Gaps = 0/230 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQAPRXNA  759
            KIQDKEGIPPDQQ LIFAGKQL DGRTL DYNIQKESTLHL L+    NA
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGGNA  230



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   429 bits (1104),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  62   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  122  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  181

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  182  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  241

Query  739  Q  741
            +
Sbjct  242  R  242


 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  604  KAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  166


 Score =   299 bits (766),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  138  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  197

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  198  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   431 bits (1109),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   410 bits (1055),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 215/241 (89%), Positives = 218/241 (90%), Gaps = 13/241 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSD        IQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSD--------IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  291

Query  739  Q  741
            +
Sbjct  292  R  292


 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 149/169 (88%), Gaps = 13/169 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD      
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD------  249

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  250  --IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   432 bits (1110),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   430 bits (1105),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  216  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  259


 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/172 (96%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +1

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  586  DTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            DTIDNVK KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  183


 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  155  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   431 bits (1109),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1106),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQ+KEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   428 bits (1101),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   431 bits (1109),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   431 bits (1108),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   428 bits (1101),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   428 bits (1101),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   434 bits (1116),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  182  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  241

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  242  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  301

Query  739  Q  741
            +
Sbjct  302  R  302


 Score =   434 bits (1116),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  257

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  258  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  317

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  318  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  377

Query  739  Q  741
            +
Sbjct  378  R  378


 Score =   434 bits (1115),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  604  KAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  226


 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  219  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  273

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  333

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  274  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  333

Query  739  Q  741
            +
Sbjct  334  R  334


 Score =   431 bits (1109),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  215  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  258


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   432 bits (1110),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/231 (95%), Positives = 223/231 (97%), Gaps = 2/231 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDG  228
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  127

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  588
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  128  PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  187

Query  589  TIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            TIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  188  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  238


 Score =   430 bits (1106),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  79   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  193

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  194  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  253

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  254  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  313

Query  739  Q  741
            +
Sbjct  314  R  314


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  155  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  269

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  270  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   434 bits (1116),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/250 (90%), Positives = 228/250 (91%), Gaps = 8/250 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  QAPRXNAXFR  768
               R    FR
Sbjct  376  ---RLRGGFR  382


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1111),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 159/172 (92%), Gaps = 5/172 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   431 bits (1108),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   434 bits (1116),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  120

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  180

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  181  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  240

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  241  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  300

Query  739  Q  741
            +
Sbjct  301  R  301


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  142  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  196

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  197  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  256

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  257  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  316

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEG+PPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  317  TITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  376

Query  739  Q  741
            +
Sbjct  377  R  377


 Score =   428 bits (1101),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  182  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  225


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  218  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  272

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  273  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  332

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEG+PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  AKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   428 bits (1101),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   431 bits (1108),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1097),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   428 bits (1101),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   428 bits (1100),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIP DQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   431 bits (1107),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   434 bits (1116),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 226/240 (94%), Gaps = 5/240 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  241  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  300


 Score =   431 bits (1109),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   424 bits (1090),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/235 (93%), Positives = 221/235 (94%), Gaps = 5/235 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  562  ITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTL  726
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKE+ L
Sbjct  317  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   431 bits (1107),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   427 bits (1099),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1106),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   430 bits (1106),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   434 bits (1117),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  91   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  145

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  146  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  205

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  206  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  265

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  266  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  325

Query  739  Q  741
            +
Sbjct  326  R  326


 Score =   434 bits (1117),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  167  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  222  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  281

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  282  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  341

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  342  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  401

Query  739  Q  741
            +
Sbjct  402  R  402


 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 1/181 (1%)
 Frame = +1

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
             FA KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  71   CFA-KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  129

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  130  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  189

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  190  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  249

Query  739  Q  741
            +
Sbjct  250  R  250


 Score =   302 bits (773),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  243  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  297

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  298  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  357

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+E IPPDQQR 
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRF  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  381



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   436 bits (1120),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 191/203 (94%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKE  627
            TITLEVESSDTIDNVKAKIQDKE
Sbjct  392  TITLEVESSDTIDNVKAKIQDKE  414



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   431 bits (1107),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK+KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  61   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  115

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  116  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  175

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  176  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  235

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  236  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  295

Query  739  Q  741
            +
Sbjct  296  R  296


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  137  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  191

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  192  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  251

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  252  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  311

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  312  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  371

Query  739  Q  741
            +
Sbjct  372  R  372


 Score =   423 bits (1087),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 215/220 (98%), Positives = 216/220 (98%), Gaps = 0/220 (0%)
 Frame = +1

Query  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYNIQKE  261
            VKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  262  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  441
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  442  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  621
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  180

Query  622  KEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  220


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  213  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  267

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  268  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  327

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  328  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1109),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            T+TLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1109),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   430 bits (1105),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   434 bits (1116),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  260  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  319

Query  739  Q  741
            +
Sbjct  320  R  320


 Score =   434 bits (1116),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  275

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  276  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  335

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  336  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  395

Query  739  Q  741
            +
Sbjct  396  R  396


 Score =   433 bits (1114),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/234 (95%), Positives = 224/234 (96%), Gaps = 3/234 (1%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQL  219
            +L  S S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQL
Sbjct  14   YLESSTS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  70

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  399
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  71   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  130

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  579
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  131  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  190

Query  580  SSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            SSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  191  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  244


 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  237  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  291

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  292  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  351

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  352  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   431 bits (1109),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1112),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1109),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1109),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1108),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1104),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   430 bits (1106),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  72   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  126

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  127  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  186

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  187  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  246

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  247  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  306

Query  739  Q  741
            +
Sbjct  307  R  307


 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/230 (94%), Positives = 222/230 (97%), Gaps = 0/230 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGR  231
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  591
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  122  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  181

Query  592  IDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            IDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  182  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  231


 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  148  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  262

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  263  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            T+TLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   430 bits (1106),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1102),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ L+FAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1104),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLSLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1107),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1101),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   427 bits (1097),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   431 bits (1108),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 227/242 (94%), Gaps = 6/242 (2%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQR  195
            +CS  LF  L+       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  18   LCSSALFPLLQ------AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  71

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  72   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  131

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  132  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  191

Query  556  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLX  735
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL 
Sbjct  192  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  251

Query  736  LQ  741
            L+
Sbjct  252  LR  253


 Score =   429 bits (1103),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  94   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  209  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  268

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  269  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  328

Query  739  Q  741
            +
Sbjct  329  R  329


 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  170  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  224

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  225  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  284

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  285  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   434 bits (1115),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1112),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 162/180 (90%), Gaps = 7/180 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKTLT  552
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+  +
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVRLFS  391



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1098),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1101),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   430 bits (1105),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/238 (92%), Positives = 224/238 (94%), Gaps = 5/238 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHL  732
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  297


 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 151/164 (92%), Gaps = 5/164 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  510
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   432 bits (1112),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   428 bits (1101),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K
Sbjct  120  IFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1097),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KA
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   429 bits (1104),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1101),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  251  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  310

Query  739  Q  741
            +
Sbjct  311  R  311


 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  267  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  326

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  327  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  386

Query  739  Q  741
            +
Sbjct  387  R  387


 Score =   432 bits (1111),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 220/230 (96%), Positives = 223/230 (97%), Gaps = 1/230 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGR  231
            SC + +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGR
Sbjct  7    SCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  65

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  66   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  591
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  126  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  185

Query  592  IDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            IDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  186  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  235


 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  228  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  282

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  283  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  342

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  343  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   427 bits (1097),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   429 bits (1104),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1101),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL +GRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EMS60894.1| Polyubiquitin [Triticum urartu]
Length=458

 Score =   435 bits (1119),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  409

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  410  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  453


 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  295  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  409

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  410  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  457


 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  283  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  462
            RL   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  225  RLEKTMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  284

Query  463  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  642
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  285  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  344

Query  643  QQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            QQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  345  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  377



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   427 bits (1099),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 224/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLA YNIQKESTLHL L
Sbjct  184  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVL  243

Query  739  Q  741
            +
Sbjct  244  R  244


 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            NVKAKIQDKE IPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  168


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   432 bits (1112),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL +
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVV  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1112),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   436 bits (1120),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   436 bits (1120),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   380 bits (976),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 195/209 (93%), Positives = 197/209 (94%), Gaps = 5/209 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQ  645
            TITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQ  420



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   424 bits (1091),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   426 bits (1096),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 154/168 (92%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 227/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1106),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   427 bits (1099),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   426 bits (1094),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   430 bits (1105),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1098),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   312 bits (800),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 164/176 (93%), Gaps = 5/176 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   429 bits (1104),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1101),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  305



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK+KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   426 bits (1096),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  229



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITL+VESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   434 bits (1115),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  188  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  242

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  243  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  302

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  303  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  362

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  363  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  422

Query  739  Q  741
            +
Sbjct  423  R  423


 Score =   432 bits (1112),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 220/226 (97%), Gaps = 0/226 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLAD  243
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  165

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  166  LIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  225

Query  604  KAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  226  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  271


 Score =   432 bits (1110),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  112  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  166

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  167  IFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  226

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  227  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  286

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  287  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  346

Query  739  Q  741
            +
Sbjct  347  R  347


 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  264  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  318

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  319  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   426 bits (1095),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   432 bits (1110),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1107),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   429 bits (1103),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTI+NVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   427 bits (1099),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   426 bits (1095),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   428 bits (1100),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 218/241 (90%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  41   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  95

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  96   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  155

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  156  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  215

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK+KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  216  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  275

Query  739  Q  741
            +
Sbjct  276  R  276


 Score =   370 bits (949),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/224 (86%), Positives = 197/224 (88%), Gaps = 24/224 (11%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  200


 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  117  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  171

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  172  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  231

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  232  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   431 bits (1107),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 220/238 (92%), Positives = 225/238 (95%), Gaps = 3/238 (1%)
 Frame = +1

Query  28   NLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFA  207
            N F    H+ S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFA
Sbjct  33   NPFKPTLHTPS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  89

Query  208  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  387
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  90   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  149

Query  388  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  567
            QDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  150  QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  209

Query  568  LEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            LEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  210  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  267


 Score =   430 bits (1106),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  282

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  283  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  342

Query  739  Q  741
            +
Sbjct  343  R  343


 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  184  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  239  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  298

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  299  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKE+TLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1109),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   426 bits (1094),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 155/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   428 bits (1101),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   427 bits (1099),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 219/241 (91%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL+DY+IQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   426 bits (1094),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTL L L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLR  224


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>gb|KJB13590.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
 gb|KJB13591.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=461

 Score =   434 bits (1116),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 226/250 (90%), Positives = 228/250 (91%), Gaps = 8/250 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  QAPRXNAXFR  768
               R    FR
Sbjct  452  ---RLRGGFR  458


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 159/172 (92%), Gaps = 5/172 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  459



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   431 bits (1108),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI AGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   428 bits (1101),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 224/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   425 bits (1092),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   431 bits (1108),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADY+IQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1107),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQ L
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   431 bits (1108),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1108),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   430 bits (1105),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   428 bits (1100),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTL DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   428 bits (1100),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   429 bits (1102),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 217/224 (97%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   428 bits (1101),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 220/241 (91%), Positives = 223/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 163/183 (89%), Gaps = 5/183 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASK  315

Query  559  TIT  567
             IT
Sbjct  316  IIT  318



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   425 bits (1093),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   434 bits (1115),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  145  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  199

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  200  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  259

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  260  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  319

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  320  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  379

Query  739  Q  741
            +
Sbjct  380  R  380


 Score =   434 bits (1115),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  221  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  275

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  276  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  335

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  336  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  395

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  396  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  455

Query  739  Q  741
            +
Sbjct  456  R  456


 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  81   IQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  200

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  201  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  260

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  261  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  304


 Score =   398 bits (1023),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+E IP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  184

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  185  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  228


 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  297  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  351

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  352  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  411

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  412  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  460



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   425 bits (1092),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>ref|XP_004953565.1| PREDICTED: polyubiquitin-like [Setaria italica]
Length=459

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   425 bits (1092),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>dbj|BAK02501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKA+IQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAEIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|EYU33607.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=457

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  457



>gb|AAD03343.1| ubiquitin [Pisum sativum]
Length=457

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  457



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   425 bits (1092),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   425 bits (1092),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>emb|CAA40324.1| hexaubiquitin protein [Helianthus annuus]
 emb|CAA40325.1| hexaubiquitin protein [Helianthus annuus]
Length=457

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPVQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPP QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPVQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|NP_001045980.1| Os02g0161900 [Oryza sativa Japonica Group]
 ref|NP_001058378.1| Os06g0681400 [Oryza sativa Japonica Group]
 ref|XP_006646911.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 gb|AAF01315.1|AF184279_1 polyubiquitin [Oryza sativa Indica Group]
 gb|AAF01316.1|AF184280_1 polyubiquitin [Oryza sativa Indica Group]
 emb|CAA53665.1| polyubiquitin [Oryza sativa Indica Group]
 gb|AAC49806.1| polyubiquitin [Oryza sativa Indica Group]
 dbj|BAD25213.1| polyubiquitin 6 [Oryza sativa Japonica Group]
 dbj|BAF07894.1| Os02g0161900 [Oryza sativa Japonica Group]
 dbj|BAF20292.1| Os06g0681400 [Oryza sativa Japonica Group]
 dbj|BAG95117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72542.1| hypothetical protein OsI_05955 [Oryza sativa Indica Group]
 gb|EEE56356.1| hypothetical protein OsJ_05481 [Oryza sativa Japonica Group]
 gb|ADB84621.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|ADM86852.1| polyubiquitin [Oryza sativa Japonica Group]
 dbj|BAK06683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEE65380.1| ubiquitin 2 [Panicum virgatum]
 gb|AFW66449.1| ubiquitin2 [Zea mays]
Length=457

 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>dbj|BAK03691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AK+QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            K+QDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KVQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_006428817.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 ref|XP_006480630.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42057.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|KDO51105.1| hypothetical protein CISIN_1g012714mg [Citrus sinensis]
 gb|KDO51106.1| hypothetical protein CISIN_1g012714mg [Citrus sinensis]
Length=458

 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_002891806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   431 bits (1107),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNLK  257

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  258  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  317

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  318  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  377

Query  739  Q  741
            +
Sbjct  378  R  378


 Score =   429 bits (1102),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/224 (96%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K 
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNLKT  258

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  259  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  302


 Score =   404 bits (1037),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQI+ KTLT KTITL+VESSDTI+NVKAKIQD E IP DQQRLIF+GK L+DGRTLADY+
Sbjct  3    MQIYAKTLTEKTITLDVESSDTINNVKAKIQDIEGIPLDQQRLIFSGKLLDDGRTLADYS  62

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKES LHL LRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESILHLALRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  182

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  183  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  226


 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDN+K KIQDKE IPPDQQRL
Sbjct  219  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNLKTKIQDKEGIPPDQQRL  273

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  333

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>dbj|BAJ91912.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_002452705.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
 gb|EES05681.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
Length=459

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_010275241.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=383

 Score =   431 bits (1107),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKILDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1107),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1104),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KI DKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KILDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  381



>gb|AAB95251.1| ubiquitin [Arabidopsis thaliana]
Length=456

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFV TLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_010262389.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=461

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|AAC16012.1| polyubiquitin [Elaeagnus umbellata]
Length=458

 Score =   433 bits (1114),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   429 bits (1103),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVES DTIDNVKA+IQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESLDTIDNVKAQIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1103),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            A+IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AQIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKA+IQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESLDTIDNVKAQIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   427 bits (1099),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/241 (90%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVK+KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   426 bits (1096),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/224 (96%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTL+DYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  224


 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_010423744.1| PREDICTED: polyubiquitin [Camelina sativa]
Length=458

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_008345409.1| PREDICTED: polyubiquitin-like [Malus domestica]
Length=458

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   431 bits (1108),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLH  L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHXVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   422 bits (1084),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 218/241 (90%), Positives = 221/241 (92%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH VLR  GGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHXVLRXXGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQ  DG TLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQXEDGXTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 150/169 (89%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLH VLR  GGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHXVLRXXGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQ EDG TLADYNIQKESTLHLVLR  GG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQXEDGXTLADYNIQKESTLHLVLRXXGG  456



>gb|KJB81827.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=457

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_009784905.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784906.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
Length=457

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_003542730.1| PREDICTED: polyubiquitin 10-like [Glycine max]
 gb|KHN09976.1| Polyubiquitin 10 [Glycine soja]
Length=457

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_011094250.1| PREDICTED: polyubiquitin-like [Sesamum indicum]
Length=458

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_011094650.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CH04.1|UBI1P_PETCR RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Petroselinum crispum]
 sp|P0CH05.1|UBI2P_PETCR RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Petroselinum crispum]
 emb|CAA45621.1| polyubiquitin [Petroselinum crispum]
 emb|CAA45622.1| polyubiquitin [Petroselinum crispum]
Length=458

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   432 bits (1110),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/224 (98%), Positives = 220/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_008350368.1| PREDICTED: polyubiquitin [Malus domestica]
Length=458

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  451

Query  739  Q  741
            +
Sbjct  452  R  452


 Score =   431 bits (1108),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   431 bits (1108),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGXTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   430 bits (1106),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299

Query  739  Q  741
            +
Sbjct  300  R  300


 Score =   430 bits (1106),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 225/241 (93%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IP DQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXL  738
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQL DGRTLADYNIQKESTLHL L
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375

Query  739  Q  741
            +
Sbjct  376  R  376


 Score =   429 bits (1102),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 218/224 (97%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  KIQDKEGIPPDQQXLIFAGKQLXDGRTLADYNIQKESTLHLXLQ  741
            KIQDKEGIP DQQ LIFAGKQL DGRTLADYNIQKESTLHL L+
Sbjct  181  KIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  224


 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_007049060.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOX93217.1| Polyubiquitin 10 [Theobroma cacao]
Length=457

 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 226/241 (94%), Gaps = 5/241 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE*IPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIF