BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025K09

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        220   3e-65   Ipomoea nil [qian niu]
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                194   8e-56   Erythranthe guttata [common monkey flower]
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               194   1e-55   Solanum lycopersicum
emb|CDP22261.1|  unnamed protein product                                184   7e-55   Coffea canephora [robusta coffee]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               189   1e-53   Nicotiana tomentosiformis
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               188   2e-53   
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               187   5e-53   
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               186   9e-53   Nicotiana tomentosiformis
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               187   1e-52   Solanum tuberosum [potatoes]
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               186   1e-52   Nicotiana sylvestris
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               186   2e-52   Nicotiana sylvestris
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               186   2e-52   Nicotiana tomentosiformis
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               184   5e-52   Sesamum indicum [beniseed]
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               184   1e-51   Nicotiana sylvestris
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               183   2e-51   Solanum lycopersicum
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               181   8e-51   Solanum tuberosum [potatoes]
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               176   6e-49   
gb|EPS60789.1|  hypothetical protein M569_14012                         176   8e-49   Genlisea aurea
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                176   9e-49   Erythranthe guttata [common monkey flower]
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               176   1e-48   Nicotiana tomentosiformis
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               175   1e-48   Nicotiana tomentosiformis
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                173   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               170   2e-46   Nicotiana tomentosiformis
gb|EPS65366.1|  hypothetical protein M569_09411                         169   4e-46   Genlisea aurea
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               167   1e-45   Solanum lycopersicum
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               166   2e-45   Solanum tuberosum [potatoes]
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               165   7e-45   Solanum tuberosum [potatoes]
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               164   2e-44   
gb|AJD25225.1|  cytochrome P450 CYP96A85                                163   4e-44   Salvia miltiorrhiza [Chinese salvia]
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                161   3e-43   Erythranthe guttata [common monkey flower]
gb|AEI59774.1|  cytochrome P450                                         156   1e-41   Helianthus annuus
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                155   4e-41   Erythranthe guttata [common monkey flower]
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               148   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               146   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               146   7e-38   Nicotiana sylvestris
gb|EPS60696.1|  hypothetical protein M569_14105                         145   1e-37   Genlisea aurea
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               145   1e-37   Nicotiana tomentosiformis
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             145   2e-37   
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    144   2e-37   Arabis alpina [alpine rockcress]
ref|XP_010680694.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    140   8e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010027332.1|  PREDICTED: cytochrome P450 86B1-like               138   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006374652.1|  cytochrome P450 family protein                     141   3e-36   
ref|XP_002878665.1|  CYP96A1                                            141   4e-36   
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               141   4e-36   Sesamum indicum [beniseed]
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                140   7e-36   Erythranthe guttata [common monkey flower]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    140   8e-36   Brassica rapa
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    140   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    140   1e-35   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY46088.1|  BnaA09g42120D                                          140   1e-35   Brassica napus [oilseed rape]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               140   1e-35   Nicotiana tomentosiformis
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    139   2e-35   Vitis vinifera
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               138   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             139   4e-35   Citrus clementina [clementine]
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               138   4e-35   Eucalyptus grandis [rose gum]
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             138   4e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    138   5e-35   
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    138   5e-35   
gb|EPS73452.1|  hypothetical protein M569_01304                         130   6e-35   Genlisea aurea
emb|CDX76867.1|  BnaC08g34530D                                          138   6e-35   
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               137   1e-34   Nicotiana tomentosiformis
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    137   1e-34   Arabis alpina [alpine rockcress]
emb|CDY53179.1|  BnaA06g40580D                                          137   1e-34   Brassica napus [oilseed rape]
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               137   1e-34   Nicotiana sylvestris
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               137   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010419318.1|  PREDICTED: cytochrome P450 86B1-like               135   2e-34   
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               137   2e-34   
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               136   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    137   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866853.1|  CYP96A10                                           137   2e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    137   2e-34   Brassica rapa
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         136   2e-34   
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                136   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               136   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               136   3e-34   
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               136   3e-34   Camelina sativa [gold-of-pleasure]
emb|CDP04331.1|  unnamed protein product                                135   3e-34   Coffea canephora [robusta coffee]
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   135   4e-34   Citrus sinensis [apfelsine]
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               135   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             135   5e-34   Capsella rubella
gb|KDO55118.1|  hypothetical protein CISIN_1g036278mg                   133   5e-34   Citrus sinensis [apfelsine]
emb|CDY53181.1|  BnaA06g40600D                                          135   6e-34   Brassica napus [oilseed rape]
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    135   6e-34   Brassica rapa
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               135   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             134   9e-34   Capsella rubella
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               134   9e-34   Camelina sativa [gold-of-pleasure]
emb|CDX72695.1|  BnaC07g47170D                                          134   1e-33   
ref|XP_010472325.1|  PREDICTED: cytochrome P450 86B1-like               131   1e-33   
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-33   Nicotiana sylvestris
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-33   Camelina sativa [gold-of-pleasure]
emb|CDX72698.1|  BnaC07g47200D                                          133   2e-33   
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    134   2e-33   Vitis vinifera
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             133   2e-33   Capsella rubella
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               133   3e-33   Camelina sativa [gold-of-pleasure]
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    133   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                133   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               132   4e-33   Brassica rapa
emb|CDY53182.1|  BnaA06g40610D                                          132   4e-33   Brassica napus [oilseed rape]
emb|CDY44658.1|  BnaA08g06820D                                          132   5e-33   Brassica napus [oilseed rape]
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               132   6e-33   Populus euphratica
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             132   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               131   8e-33   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         131   1e-32   Jatropha curcas
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                131   1e-32   Erythranthe guttata [common monkey flower]
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    131   1e-32   Arabis alpina [alpine rockcress]
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         131   1e-32   Jatropha curcas
ref|XP_002521474.1|  cytochrome P450, putative                          131   2e-32   Ricinus communis
ref|XP_007048137.1|  Cytochrome P450                                    131   2e-32   
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-32   Eucalyptus grandis [rose gum]
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-32   Solanum lycopersicum
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                130   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-32   Phoenix dactylifera
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                130   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_002878579.1|  CYP96A5                                            130   3e-32   Arabidopsis lyrata subsp. lyrata
emb|CDP12889.1|  unnamed protein product                                130   3e-32   Coffea canephora [robusta coffee]
emb|CDY32582.1|  BnaC03g15500D                                          130   3e-32   Brassica napus [oilseed rape]
ref|XP_010474420.1|  PREDICTED: cytochrome P450 86A4-like               129   4e-32   
emb|CAB44684.1|  cytochrome P450-like protein                           129   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               130   5e-32   Sesamum indicum [beniseed]
ref|XP_010027235.1|  PREDICTED: cytochrome P450 86B1-like               126   5e-32   Eucalyptus grandis [rose gum]
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               129   5e-32   Populus euphratica
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               129   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               129   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               129   5e-32   
gb|KCW62188.1|  hypothetical protein EUGRSUZ_H04845                     129   6e-32   Eucalyptus grandis [rose gum]
gb|KDO37445.1|  hypothetical protein CISIN_1g036716mg                   125   6e-32   Citrus sinensis [apfelsine]
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             129   9e-32   Eutrema salsugineum [saltwater cress]
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               129   9e-32   Arabis alpina [alpine rockcress]
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    129   9e-32   Solanum lycopersicum
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     129   9e-32   Eucalyptus grandis [rose gum]
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             129   9e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             129   9e-32   Eutrema salsugineum [saltwater cress]
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         129   1e-31   Jatropha curcas
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             129   1e-31   
gb|KJB71270.1|  hypothetical protein B456_011G113900                    129   1e-31   Gossypium raimondii
gb|EYU41727.1|  hypothetical protein MIMGU_mgv1a023193mg                127   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               128   2e-31   Eucalyptus grandis [rose gum]
ref|XP_002529227.1|  cytochrome P450, putative                          128   2e-31   Ricinus communis
gb|EAY88475.1|  hypothetical protein OsI_09946                          128   2e-31   Oryza sativa Indica Group [Indian rice]
gb|ABF93892.1|  Cytochrome P450 family protein                          128   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         128   2e-31   Jatropha curcas
emb|CDY38915.1|  BnaA03g12640D                                          124   2e-31   Brassica napus [oilseed rape]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               127   3e-31   Populus euphratica
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    127   3e-31   Arabis alpina [alpine rockcress]
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    127   4e-31   Brassica rapa
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    127   4e-31   Arabis alpina [alpine rockcress]
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               127   4e-31   Solanum tuberosum [potatoes]
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               127   5e-31   Brassica rapa
emb|CDY39927.1|  BnaA09g15090D                                          127   5e-31   Brassica napus [oilseed rape]
emb|CDP12888.1|  unnamed protein product                                126   7e-31   Coffea canephora [robusta coffee]
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               126   7e-31   Eucalyptus grandis [rose gum]
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               126   8e-31   
ref|XP_009605621.1|  PREDICTED: cytochrome P450 86B1                    120   8e-31   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             126   9e-31   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               126   1e-30   Brassica rapa
emb|CDY27160.1|  BnaA08g07980D                                          126   1e-30   Brassica napus [oilseed rape]
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    126   1e-30   Brassica rapa
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               126   1e-30   Nicotiana sylvestris
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               125   1e-30   Brassica rapa
emb|CDY53177.1|  BnaA06g40560D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             125   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             125   2e-30   Capsella rubella
emb|CDY39926.1|  BnaA09g15080D                                          125   2e-30   Brassica napus [oilseed rape]
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   Brassica rapa
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       125   2e-30   Cucumis sativus [cucumbers]
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
gb|KDP35256.1|  hypothetical protein JCGZ_09415                         121   2e-30   Jatropha curcas
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
emb|CDX72690.1|  BnaC07g47120D                                          125   2e-30   
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               124   2e-30   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    124   3e-30   Arabis alpina [alpine rockcress]
emb|CDX76962.1|  BnaC08g35480D                                          124   3e-30   
ref|NP_001117509.1|  alkane hydroxylase CYP96A15                        124   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                124   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               124   3e-30   
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               124   4e-30   Sesamum indicum [beniseed]
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             124   4e-30   
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     124   4e-30   Eucalyptus grandis [rose gum]
emb|CDY12435.1|  BnaC08g09240D                                          124   4e-30   Brassica napus [oilseed rape]
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               124   4e-30   Arabis alpina [alpine rockcress]
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           124   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    124   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             124   4e-30   Capsella rubella
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    124   5e-30   
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       124   5e-30   Cucumis sativus [cucumbers]
gb|ACR38435.1|  unknown                                                 124   5e-30   Zea mays [maize]
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             124   6e-30   
emb|CDX83711.1|  BnaC07g24510D                                          120   6e-30   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                124   6e-30   Erythranthe guttata [common monkey flower]
ref|XP_006392373.1|  hypothetical protein EUTSA_v10023421mg             123   7e-30   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             123   7e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               124   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             123   8e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             123   8e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          123   9e-30   
gb|KEH22137.1|  cytochrome P450 family protein                          123   1e-29   Medicago truncatula
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    123   1e-29   
gb|KEH22136.1|  cytochrome P450 family protein                          123   1e-29   Medicago truncatula
ref|XP_010444891.1|  PREDICTED: cytochrome P450 86B1-like               119   1e-29   
emb|CDY13727.1|  BnaA06g31960D                                          122   1e-29   Brassica napus [oilseed rape]
emb|CDY58383.1|  BnaC09g51620D                                          122   1e-29   Brassica napus [oilseed rape]
gb|KJB44331.1|  hypothetical protein B456_007G246400                    122   1e-29   Gossypium raimondii
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               122   2e-29   Brassica rapa
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             122   2e-29   Phaseolus vulgaris [French bean]
emb|CDX84084.1|  BnaC08g07610D                                          121   2e-29   
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   Nelumbo nucifera [Indian lotus]
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    122   2e-29   Arabis alpina [alpine rockcress]
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   Oryza brachyantha
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       122   2e-29   Cucumis sativus [cucumbers]
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    122   2e-29   
emb|CDX72691.1|  BnaC07g47130D                                          119   2e-29   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             122   2e-29   Eutrema salsugineum [saltwater cress]
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    122   2e-29   Arabis alpina [alpine rockcress]
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             122   2e-29   Capsella rubella
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA99522.1|  putative cytochrome P450                               122   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               122   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             122   3e-29   Phaseolus vulgaris [French bean]
emb|CDY70656.1|  BnaAnng34510D                                          120   3e-29   Brassica napus [oilseed rape]
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               121   4e-29   Vitis vinifera
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               121   4e-29   Glycine max [soybeans]
dbj|BAD94304.1|  cytochrome p450 - like protein                         121   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14219.1|  Cytochrome P450 86A2                                    121   4e-29   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             124   4e-29   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               121   4e-29   Brachypodium distachyon [annual false brome]
emb|CAN80536.1|  hypothetical protein VITISV_035975                     121   4e-29   Vitis vinifera
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               121   4e-29   Sesamum indicum [beniseed]
emb|CDY29171.1|  BnaC09g15680D                                          121   4e-29   Brassica napus [oilseed rape]
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               121   6e-29   Cucumis melo [Oriental melon]
emb|CDY39928.1|  BnaA09g15100D                                          121   6e-29   Brassica napus [oilseed rape]
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             121   6e-29   
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             120   7e-29   Phaseolus vulgaris [French bean]
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               120   9e-29   Tarenaya hassleriana [spider flower]
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    120   1e-28   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    120   1e-28   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    120   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               120   1e-28   Glycine max [soybeans]
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               120   1e-28   Populus euphratica
emb|CDY39931.1|  BnaA09g15130D                                          120   1e-28   Brassica napus [oilseed rape]
gb|EMS62655.1|  Cytochrome P450 86B1                                    120   1e-28   Triticum urartu
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               120   1e-28   Glycine max [soybeans]
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               120   1e-28   Oryza brachyantha
gb|KJB44293.1|  hypothetical protein B456_007G244800                    120   1e-28   Gossypium raimondii
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    120   2e-28   Brassica rapa
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    119   2e-28   Glycine max [soybeans]
emb|CDY42628.1|  BnaC01g00400D                                          120   2e-28   Brassica napus [oilseed rape]
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             119   2e-28   
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    119   2e-28   
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               119   3e-28   Brassica rapa
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               119   3e-28   Populus euphratica
gb|EEC74485.1|  hypothetical protein OsI_09945                          119   3e-28   Oryza sativa Indica Group [Indian rice]
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         119   3e-28   Jatropha curcas
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               119   3e-28   Glycine max [soybeans]
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               119   3e-28   Setaria italica
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               119   4e-28   Brassica rapa
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             119   4e-28   Eutrema salsugineum [saltwater cress]
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    119   4e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18605.1|  unnamed protein product                                118   4e-28   Coffea canephora [robusta coffee]
dbj|BAC42841.1|  putative cytochrome P450                               118   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             119   5e-28   Capsella rubella
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               119   5e-28   Cucumis sativus [cucumbers]
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               119   5e-28   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               118   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002894062.1|  CYP96A8                                            118   6e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_002866852.1|  CYP96A9                                            118   6e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_002869292.1|  CYP96A2                                            118   6e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               118   6e-28   Nicotiana sylvestris
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               118   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               118   8e-28   Tarenaya hassleriana [spider flower]
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               118   8e-28   Nicotiana sylvestris
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               117   9e-28   Setaria italica
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             117   1e-27   
ref|XP_010109842.1|  Cytochrome P450                                    113   1e-27   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             117   1e-27   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             117   1e-27   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
ref|XP_002457225.1|  hypothetical protein SORBIDRAFT_03g003600          117   1e-27   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
emb|CDY39035.1|  BnaA02g17240D                                          117   1e-27   
ref|XP_007019556.1|  Cytochrome P450                                    117   1e-27   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               117   2e-27   
ref|XP_010501864.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    112   2e-27   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like               117   2e-27   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    117   2e-27
dbj|BAK07250.1|  predicted protein                                      117   2e-27   
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               116   2e-27   
gb|EPS57870.1|  hypothetical protein M569_16947                         117   2e-27   
ref|XP_002526301.1|  heme binding protein, putative                     116   2e-27   
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg             117   2e-27   
ref|XP_002521476.1|  cytochrome P450, putative                          116   2e-27   
gb|EMT13313.1|  Cytochrome P450 86A1                                    117   2e-27   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               116   3e-27   
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    118   3e-27   
gb|KHN27469.1|  Cytochrome P450 86B1                                    116   3e-27   
gb|AIE57505.1|  MAH1                                                    116   3e-27   
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             116   3e-27   
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               116   4e-27   
dbj|BAJ86572.1|  predicted protein                                      116   4e-27   
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    116   4e-27   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         116   4e-27   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    116   4e-27   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               115   4e-27   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             115   5e-27   
gb|EEE54005.1|  hypothetical protein OsJ_00650                          115   5e-27   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               115   5e-27   
emb|CBI33551.3|  unnamed protein product                                115   5e-27   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    115   5e-27   
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             115   6e-27   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               115   6e-27   
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          115   6e-27   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         115   6e-27   
ref|NP_001042228.1|  Os01g0183600                                       115   7e-27   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               115   8e-27   
gb|KHN27468.1|  Cytochrome P450 86B1                                    114   8e-27   
gb|KEH41380.1|  cytochrome P450 family protein                          115   8e-27   
gb|ABF93891.1|  Cytochrome P450 family protein                          115   8e-27   
gb|EAY72807.1|  hypothetical protein OsI_00673                          115   9e-27   
gb|AJD25224.1|  cytochrome P450 CYP96A84                                114   9e-27   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    115   9e-27   
ref|XP_010242506.1|  PREDICTED: cytochrome P450 86B1-like               115   9e-27   
gb|EPS72790.1|  hypothetical protein M569_01963                         114   1e-26   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             114   1e-26   
ref|XP_010263872.1|  PREDICTED: cytochrome P450 86A7                    110   1e-26   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               114   1e-26   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               114   2e-26   
ref|XP_010418988.1|  PREDICTED: cytochrome P450 86B1-like               114   2e-26   
emb|CDX72693.1|  BnaC07g47150D                                          114   2e-26   
gb|KHN19680.1|  Cytochrome P450 86B1                                    115   2e-26   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   114   2e-26   
gb|AGV40485.1|  hypothetical protein                                    115   2e-26   
ref|XP_002894061.1|  CYP96A8                                            114   2e-26   
gb|EAY88476.1|  hypothetical protein OsI_09947                          114   3e-26   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               113   3e-26   
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               113   3e-26   
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               113   3e-26   
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    113   3e-26   
ref|NP_001048917.1|  Os03g0140100                                       113   3e-26   
ref|XP_007042364.1|  Cytochrome P450-like protein                       113   4e-26   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               113   4e-26   
gb|KJB33823.1|  hypothetical protein B456_006G032600                    113   4e-26   
gb|KEH40821.1|  cytochrome P450 family protein                          113   5e-26   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               113   5e-26   
ref|XP_010274134.1|  PREDICTED: cytochrome P450 86B1-like               113   5e-26   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             112   5e-26   
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             112   6e-26   
gb|EPS67771.1|  hypothetical protein M569_06997                         112   7e-26   
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               112   7e-26   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               112   7e-26   
gb|KDP46409.1|  hypothetical protein JCGZ_10249                         112   7e-26   
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like               112   8e-26   
ref|NP_001048908.1|  Os03g0138200                                       112   1e-25   
gb|EAZ25511.1|  hypothetical protein OsJ_09335                          112   1e-25   
dbj|BAK03685.1|  predicted protein                                      112   1e-25   
ref|XP_010681237.1|  PREDICTED: cytochrome P450 86B1-like               109   1e-25   
emb|CDX79038.1|  BnaA01g11050D                                          111   1e-25   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    112   1e-25   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    112   1e-25   
ref|XP_002868909.1|  CYP96A12                                           112   1e-25   
ref|XP_002865907.1|  CYP96A4                                            112   1e-25   
gb|EAY88464.1|  hypothetical protein OsI_09931                          112   1e-25   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               112   1e-25   
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             111   2e-25   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               111   2e-25   
gb|KJB33822.1|  hypothetical protein B456_006G032500                    110   2e-25   
ref|XP_006649370.1|  PREDICTED: cytochrome P450 86B1-like               111   2e-25   
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433             111   3e-25   
gb|KHN45347.1|  Cytochrome P450 86B1                                    110   3e-25   
gb|EMS66236.1|  Cytochrome P450 86B1                                    110   3e-25   
emb|CDY53178.1|  BnaA06g40570D                                          110   3e-25   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               111   3e-25   
ref|XP_003629932.1|  Cytochrome P450                                    110   3e-25   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            110   4e-25   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             110   4e-25   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               110   4e-25   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             110   5e-25   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             110   5e-25   
gb|KEH40839.1|  cytochrome P450 family protein                          110   5e-25   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               110   5e-25   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               110   5e-25   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             110   5e-25   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    109   5e-25   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          110   5e-25   
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    110   6e-25   
emb|CDY68678.1|  BnaCnng60030D                                          109   7e-25   
gb|AAM65207.1|  putative cytochrome P450                                110   7e-25   
ref|XP_006282405.1|  hypothetical protein CARUB_v100285720mg            105   7e-25   
gb|EMT07503.1|  Cytochrome P450 86A2                                    110   7e-25   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               110   8e-25   
ref|XP_002886391.1|  predicted protein                                  110   9e-25   
emb|CDY66735.1|  BnaC03g60620D                                          109   1e-24   
emb|CDY20374.1|  BnaC02g24420D                                          108   1e-24   
ref|XP_010436206.1|  PREDICTED: cytochrome P450 86B1-like               107   1e-24   
dbj|BAJ87689.1|  predicted protein                                      109   1e-24   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    108   1e-24   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               109   1e-24   
ref|XP_002322212.1|  hypothetical protein POPTR_0015s09850g             108   1e-24   
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               109   2e-24   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               108   2e-24   
emb|CDX90336.1|  BnaA08g16480D                                          108   2e-24   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             108   2e-24   
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    108   2e-24   
gb|AIU99467.1|  P450                                                    108   2e-24   
gb|KDO76250.1|  hypothetical protein CISIN_1g037522mg                   108   2e-24   
ref|XP_006476545.1|  PREDICTED: cytochrome P450 86A8-like               108   2e-24   
ref|XP_006439526.1|  hypothetical protein CICLE_v10019616mg             108   2e-24   
ref|XP_004960856.1|  PREDICTED: cytochrome P450 86B1-like               108   2e-24   
emb|CDY29175.1|  BnaC09g15720D                                          108   3e-24   
gb|KHN19669.1|  Cytochrome P450 86B1                                    107   3e-24   
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               108   3e-24   
gb|KFK22185.1|  hypothetical protein AALP_AAs38949U000100               110   3e-24   
gb|KJB75060.1|  hypothetical protein B456_012G021500                    108   3e-24   
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               108   3e-24   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               107   4e-24   
ref|XP_002312417.2|  cytochrome P450 family protein                     107   5e-24   
ref|XP_006399311.1|  hypothetical protein EUTSA_v10013132mg             108   5e-24   
gb|KGN58549.1|  hypothetical protein Csa_3G681140                       106   5e-24   
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               107   6e-24   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             107   6e-24   
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    107   7e-24   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein            107   7e-24   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    106   7e-24   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like               107   9e-24   
ref|XP_006651022.1|  PREDICTED: cytochrome P450 86B1-like               107   1e-23   
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               106   1e-23   
ref|XP_007031595.1|  Cytochrome P450, putative                          106   1e-23   
gb|EMT29524.1|  Cytochrome P450 86A2                                    105   1e-23   
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               106   1e-23   
dbj|BAK06179.1|  predicted protein                                      106   1e-23   
emb|CDX90337.1|  BnaA08g16470D                                          106   1e-23   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         105   1e-23   
gb|KJB47429.1|  hypothetical protein B456_008G026100                    106   1e-23   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     107   1e-23   
emb|CAB41474.1|  cytochrome P450                                        106   1e-23   
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             106   2e-23   
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    105   2e-23   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             106   2e-23   
gb|KJB47427.1|  hypothetical protein B456_008G025900                    105   2e-23   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like               106   2e-23   
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like               106   2e-23   
gb|KJB77357.1|  hypothetical protein B456_012G133700                    106   2e-23   
ref|XP_010270999.1|  PREDICTED: cytochrome P450 86B1-like               105   2e-23   
ref|XP_002439386.1|  hypothetical protein SORBIDRAFT_09g005590          106   2e-23   
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like               105   3e-23   
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                    105   3e-23   
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               105   3e-23   
ref|XP_008461842.1|  PREDICTED: cytochrome P450 86B1-like               105   3e-23   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       105   3e-23   
gb|KJB75062.1|  hypothetical protein B456_012G021600                    105   3e-23   
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                    105   3e-23   
ref|XP_007019638.1|  Cytochrome P450                                    105   3e-23   
gb|EMS35652.1|  Cytochrome P450 86B1                                    105   3e-23   
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    105   3e-23   
ref|XP_002523775.1|  cytochrome P450, putative                          105   3e-23   
gb|KJB75061.1|  hypothetical protein B456_012G021600                    105   3e-23   
emb|CAE54308.1|  cytochrome P450-like protein                           105   3e-23   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               105   3e-23   
gb|KEH40842.1|  cytochrome P450 family protein                          105   3e-23   
gb|EEE58297.1|  hypothetical protein OsJ_09348                          104   4e-23   
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               104   4e-23   
ref|XP_010688690.1|  PREDICTED: cytochrome P450 86B1                    105   4e-23   
ref|XP_010452806.1|  PREDICTED: cytochrome P450 86B1 isoform X2         103   4e-23   
ref|XP_009400252.1|  PREDICTED: cytochrome P450 86A2-like               105   5e-23   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          105   5e-23   
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg             105   5e-23   
tpg|DAA49553.1|  TPA: putative cytochrome P450 superfamily protein      105   5e-23   
ref|NP_001141467.1|  uncharacterized protein LOC100273577               105   5e-23   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like               105   5e-23   
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein      105   5e-23   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like               105   6e-23   
gb|AAS58486.1|  phytochrome P450-like protein                           104   6e-23   
gb|KEH40818.1|  cytochrome P450 family protein                          104   6e-23   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               104   6e-23   
gb|KEH24777.1|  cytochrome P450 family protein                          104   6e-23   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               104   6e-23   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               104   6e-23   
ref|XP_010242505.1|  PREDICTED: cytochrome P450 86B1-like               104   7e-23   
ref|XP_009402078.1|  PREDICTED: cytochrome P450 86A8-like               104   7e-23   
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like               104   7e-23   
gb|EAY88477.1|  hypothetical protein OsI_09948                          104   7e-23   
gb|KJB75063.1|  hypothetical protein B456_012G021700                    104   7e-23   
gb|AJD25208.1|  cytochrome P450 CYP86A92                                104   7e-23   
emb|CDY71055.1|  BnaAnng35920D                                        98.6    7e-23   
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like               104   8e-23   
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                    104   8e-23   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like               104   8e-23   
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like               104   8e-23   
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               103   8e-23   
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                    104   9e-23   
ref|XP_006583288.1|  PREDICTED: cytochrome P450 86A8-like               104   9e-23   
gb|KFK27637.1|  hypothetical protein AALP_AA8G409300                    104   1e-22   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+I   LGC+  +K++  SS    +PR W +VGM+P LL NAHR+H+F TD+LK SGGTF
Sbjct  14   FIIVLSLGCYMILKLRCRSSDDKVVPRNWPLVGMMPALLKNAHRVHEFATDVLKHSGGTF  73

Query  282  EFKGPV-LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            EFKGP    NL ML T DPANIHH+LS+NFSNYPKGP+FR+IFD+LGDGIFNVDSQLWE 
Sbjct  74   EFKGPAAFANLSMLATSDPANIHHVLSKNFSNYPKGPEFRKIFDILGDGIFNVDSQLWEL  133

Query  459  HRKTTLSFFNHAHFHSLLETNVWH  530
            HRKTTLSF NHA F++LL+TNVWH
Sbjct  134  HRKTTLSFLNHAQFYTLLQTNVWH  157



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = +3

Query  108  IFSFL--GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            IF FL      ++  + ++  ++++P  W +VGMLPG+L N+HR+H + TDIL ESGGTF
Sbjct  9    IFLFLLPAMILFLVWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDYATDILSESGGTF  68

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            +FK P + N+DML+TCDPANIHHI SRNFSNYPKGP+FR+IF++LGDGIFN D +LWE H
Sbjct  69   QFKFPGVFNMDMLVTCDPANIHHIFSRNFSNYPKGPEFRKIFEILGDGIFNADFELWELH  128

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            R+TTL+F NH  F+SLLE++VW
Sbjct  129  RRTTLAFLNHTKFYSLLESSVW  150



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            ++I   + CF Y  +K    ++S+ P  W + GMLPGL++NAHR+H F TDIL E+   F
Sbjct  10   YVIPLIILCFTYWNLK-NKWAKSSKPTNWPIFGMLPGLVHNAHRIHSFFTDILLETTSNF  68

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  69   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  128

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RKTT+S  NH+ F +LL+ NVW
Sbjct  129  RKTTMSLMNHSKFQTLLQRNVW  150



>emb|CDP22261.1| unnamed protein product, partial [Coffea canephora]
Length=217

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +F F+  FCY          S++P  W V+GM+PGL+ N+HRL ++ T+ILKESGGTFE 
Sbjct  15   LFCFIFLFCYYYSFSRRWRNSSLPTNWPVIGMMPGLVRNSHRLQEYGTEILKESGGTFEA  74

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
             GP   N+ M++TCDPANIH+ILS+NFSNYPKGP+FR+IFD+LGDGIFN DSQLWE HR+
Sbjct  75   NGPWFANMHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRR  134

Query  468  TTLSFFNHAHFHSLLETNVW  527
             TLS  +H  F  LLE  VW
Sbjct  135  VTLSLMHHPSFLKLLEVTVW  154



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  132  CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNL  311
            CY++ +    ++++ P  W  VGMLP ++ N HR+H ++T +L E+GGTFEFKGP+   +
Sbjct  22   CYLRNRW---TKTSAPTYWPFVGMLPAIILNFHRIHDYITKVLIETGGTFEFKGPIFAYM  78

Query  312  DMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNH  491
            DMLITCDPANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRKTT+S  +H
Sbjct  79   DMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKTTMSIMSH  138

Query  492  AHFHSLLETNVWH  530
            A F +LLE N+W+
Sbjct  139  AKFQTLLERNMWN  151



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            ++I   + C  Y  +K    ++++ P  W ++GMLPG ++NAHR+H F TD+L E+   F
Sbjct  7    YVIPLIILCLTYWYLK-NKWTKTSKPIDWPIIGMLPGFVHNAHRIHSFFTDLLLETSSNF  65

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  66   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  125

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RKTT+   NHA F +LL+ NVW
Sbjct  126  RKTTMYLMNHAKFQTLLQRNVW  147



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S++P  W +VGMLPGL+ NAHR+H+FVTD L E+ GTFEF GPVL NL+ML+T DPANIH
Sbjct  19   SSVPTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGPVLANLNMLLTSDPANIH  78

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            HILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+S  NHA F +LLE N+W
Sbjct  79   HILSKNFSNYPKGVEFRKIFDMLGNGMFNVDYELWEMHRKTTMSLMNHAKFQTLLERNMW  138



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            S+S+ P  W + GMLPGL+ NAHR+H+F TDIL E+G  FEF+GPV+ N++ML T DPAN
Sbjct  27   SKSSAPTDWPLAGMLPGLIQNAHRIHEFFTDILLETGNNFEFRGPVISNMNMLFTSDPAN  86

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            IHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK T+S  +HA F  LL+ N
Sbjct  87   IHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKFQILLKKN  146

Query  522  VW  527
            VW
Sbjct  147  VW  148



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S++P  W +VGMLPGL+ NAHR+H+F TDIL E+ GTF+F GPVL NL+MLIT DPANIH
Sbjct  33   SSVPTNWPLVGMLPGLIQNAHRVHEFATDILVETKGTFKFHGPVLANLNMLITSDPANIH  92

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            +ILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+S  NHA F +LLE N+W
Sbjct  93   YILSKNFSNYPKGVEFRKIFDILGNGMFNVDYELWEMHRKTTMSLMNHAKFQTLLERNMW  152

Query  528  H  530
            +
Sbjct  153  N  153



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +   LG   +  + +   S+++ P  W +VGMLPGL+ NAHR+H F TDIL E+G  FEF
Sbjct  9    VLIILGFTYFTWLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILLETGNNFEF  68

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
             GP LGN++ML T DPANIHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK
Sbjct  69   YGPALGNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRK  128

Query  468  TTLSFFNHAHFHSLLETNVWH  530
             T+S  +HA F  LL+ NVW+
Sbjct  129  ITMSLMSHAKFQILLKKNVWN  149



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            ++++ P  W  VGMLP ++ N H +H ++T +L E+GGTFEFKGP+  N+DMLITCDPAN
Sbjct  29   TKTSAPIYWPFVGMLPAIILNFHHIHDYITKVLTETGGTFEFKGPIFANMDMLITCDPAN  88

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            IHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRK T+S  +HA F +LLE N
Sbjct  89   IHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKITMSIMSHAKFQTLLENN  148

Query  522  VW  527
            +W
Sbjct  149  MW  150



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            +S+ P  W + GMLPGL+ NAHR+H F T IL E+GGTFEF GPVL NL+ML+T DPANI
Sbjct  31   KSSTPTNWPLFGMLPGLIRNAHRIHDFATSILMETGGTFEFYGPVLTNLNMLVTSDPANI  90

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            HHILS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F +LLE N+
Sbjct  91   HHILSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  525  W  527
            W
Sbjct  151  W  151



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +3

Query  111  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  290
            F+F+       ++  S  +S+ P  W ++GMLP LL  + R+H   T ++ ESGGTFEFK
Sbjct  12   FTFIVILLPAVLRSRSWRKSSGPTNWPLLGMLPWLLRISRRIHSSATQLMNESGGTFEFK  71

Query  291  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  470
            GP   N+DMLITCDPANIHHI SRNFSNYPKGP+FR+IFDVLGDGIFN D +LWE HR+T
Sbjct  72   GPWFCNMDMLITCDPANIHHIFSRNFSNYPKGPEFRKIFDVLGDGIFNADFELWELHRRT  131

Query  471  TLSFFNHAHFHSLLETNVW  527
            TLSFF+HA FH+LL   VW
Sbjct  132  TLSFFSHARFHTLLGRAVW  150



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            +S++P  W +VGMLPGL+ NAHR+H F T IL E+GGTFEF GPVL N +ML T DPANI
Sbjct  31   KSSVPTNWPLVGMLPGLIRNAHRVHDFATSILVETGGTFEFYGPVLTNSNMLATSDPANI  90

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            HH+LS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F +LLE N+
Sbjct  91   HHVLSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  525  W  527
            W
Sbjct  151  W  151



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +3

Query  126  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            CF Y      S+     S+ P  W +VGMLPGL+ N HR+H+FVTD L ES GTFEF GP
Sbjct  16   CFTYSTRWYLSNIWWKSSSAPTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGP  75

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
            VL NL+ML+T DPANIHHILS+NFSNYPKG +FR+IFD++G+GIFNVD +LWE HRKTT+
Sbjct  76   VLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTM  135

Query  477  SFFNHAHFHSLLETNVW  527
            S  NH  F ++LE N+W
Sbjct  136  SLMNHPKFQTMLERNMW  152



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S++P  W +VGMLPGL+ N HR+H+F TD+L E+ GTFEF GPVL NL+ML T DPANIH
Sbjct  33   SSVPTNWPLVGMLPGLIRNVHRVHEFATDVLVETKGTFEFHGPVLANLNMLATSDPANIH  92

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            HILS+NFSNYPKG +FR+ FD+LG+GIFNVD +LWE HRKTT+S  +HA F + LE N+W
Sbjct  93   HILSKNFSNYPKGVEFRKFFDILGNGIFNVDYELWEIHRKTTMSLMSHAKFQTFLERNLW  152



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
              +S++P  W ++ M+P LL N  RLHQF T++L++SGGT+ FKGP   N DML TCDPA
Sbjct  17   KEKSSLPTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDPA  76

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            NIHH+ S+NFSNYPKGP+FR+IF++LGDGIFN D +LWE HR+TT+S   H+ FHS LE+
Sbjct  77   NIHHVFSKNFSNYPKGPEFRKIFEILGDGIFNADFELWEIHRRTTISLLTHSKFHSSLES  136

Query  519  NVW  527
             VW
Sbjct  137  TVW  139



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F+      K K      +A+P  W VVGM P  L N HR+H F+T++L E GGTFEFKGP
Sbjct  2    FIAFVILRKWKSSGKFATAVPTNWPVVGMWPAALRNCHRVHDFITEVLSECGGTFEFKGP  61

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
             L N+DML TCDPANIHH+ SRNF+NYPKGP+F +IFDVLG+GIFN D +LW+FHRKTT+
Sbjct  62   WLCNMDMLFTCDPANIHHVFSRNFANYPKGPEFMKIFDVLGNGIFNADFELWKFHRKTTM  121

Query  477  SFFNHAHFHSLLETNVWH  530
             F     F  L+E  VW 
Sbjct  122  GFMGSLEFSGLIEGIVWR  139



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  147  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  326
            + ++ +++++P  W +VGMLP +L N HR+  + T+IL ESGGTF+ K P + N+DML+T
Sbjct  26   RTKTPAKTSLPTNWPLVGMLPAILQNCHRIQPYFTEILTESGGTFQLKFPRVFNMDMLLT  85

Query  327  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
              PANIHHI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLSF NH+ F+ 
Sbjct  86   SHPANIHHIFSRNFSNYPKGPEFRKVFEILGDGIFNADFELWELHRRTTLSFLNHSEFYG  145

Query  507  LLETNVWH  530
            LLE++VW 
Sbjct  146  LLESSVWE  153



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHEYMTEVLIDVGGTY  69

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RKTTLS  +HA F +LLE N+W
Sbjct  130  RKTTLSIMSHAKFQTLLERNLW  151



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHKYMTEVLIDVGGTY  69

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RKTTLS  +HA F +LLE N+W
Sbjct  130  RKTTLSIMSHAKFQTLLERNLW  151



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S+ P  W +VGMLP ++ N HR+H + T +L E GGTFEFKGP   ++DM++T DPANIH
Sbjct  35   SSKPTNWPLVGMLPAVVQNLHRIHDYATTVLTECGGTFEFKGPWFCHVDMVVTSDPANIH  94

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            HI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLS   H  F   LE NVW
Sbjct  95   HIFSRNFSNYPKGPEFRKMFEILGDGIFNADFELWELHRRTTLSMLTHPEFPDFLEVNVW  154

Query  528  H  530
            H
Sbjct  155  H  155



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
            S +   P  W ++GMLPGLL N HRLH+FVT+IL E+ G FEFKGPV  NL+ML + DPA
Sbjct  36   SKKPVTPTNWPLIGMLPGLLRNTHRLHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPA  95

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            N+HH+LS+NF+NYPKG +++++FD++GDGIFNVD++LWE  RK T+S  +H  F S LE 
Sbjct  96   NLHHMLSKNFNNYPKGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLER  155

Query  519  NVW  527
            NVW
Sbjct  156  NVW  158



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F++ S +    ++ ++      +AIP  + +VGMLP LL N+HR+H F+TDIL E GGTF
Sbjct  6    FLLLSSIAAALFLLLRRNLKKPTAIPTNFPIVGMLPALLLNSHRVHDFITDILSEVGGTF  65

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            EFKGP   NLDM++T DP+N+HH+ SR+F  YPKGP FR++F VLGDGIFN D  +WE H
Sbjct  66   EFKGPTFSNLDMVLTSDPSNVHHVFSRSFLKYPKGPDFRKMFGVLGDGIFNTDFAVWEVH  125

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RK TL F     F+ L+E  VW
Sbjct  126  RKATLGFVGDREFNGLVEGVVW  147



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            ++++ P  W ++  LPG++ N HR H ++T++L E GGT++FKGP+  N+DM  TCDPAN
Sbjct  28   TKTSAPTNWPILRELPGVIGNLHRGHAYMTEVLIEYGGTYDFKGPIFTNVDMFFTCDPAN  87

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE HR+TT+S  +HA F  LLE  
Sbjct  88   IHYIFSKNFSNYPKGPEFRKIFDMLGNGIFNVDHELWELHRRTTMSIMSHAKFQMLLEKT  147

Query  522  VW  527
            +W
Sbjct  148  MW  149



>ref|XP_006339338.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=465

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPG ++N HR+H F TDIL E+   FEF+GP+  N+DML   DPANIHHILSRNFSNYP
Sbjct  1    MLPGFVHNMHRVHSFFTDILLETNSNFEFRGPIFANMDMLFPSDPANIHHILSRNFSNYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            KGP+F +IFD+LG+ IFNVDS+LWE HRKTT+S  NHA F +LL+ NVW
Sbjct  61   KGPEFHEIFDILGNEIFNVDSELWEIHRKTTMSLMNHAKFQTLLQRNVW  109



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  105  MIFSFLGCFCY-MKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            ++F  + CF Y +   +   ++++ P  W ++  LP ++ N HR H ++T++L E G T+
Sbjct  8    ILFLLIFCFTYSIWFIIYRRTKTSAPTNWPILRELPAVIGNIHRGHAYMTEVLIEYGSTY  67

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
            +FKGP+  N+DML TCDP +IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  68   KFKGPIFTNMDMLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWELH  127

Query  462  RKTTLSFFNHAHFHSLLETNVW  527
            RKTT+S  +HA F  LLE  +W
Sbjct  128  RKTTMSIMSHAKFQILLEKTLW  149



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S++P  W +VGMLP L+ N HR+H+  T++L ES GTFEF GPV  N +ML T DP NIH
Sbjct  19   SSLPTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGTSDPENIH  78

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVW  527
            +ILS+NFSNYPKG +FR+ FD+ G+GIF+VD +LWE HRKTT+    HA FH+LLE N+W
Sbjct  79   YILSKNFSNYPKGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHTLLERNIW  138

Query  528  H  530
             
Sbjct  139  E  139



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W ++GMLP ++ N HR+H ++T +L   GGT+ F+GP   N+DML T DPANIHH+ 
Sbjct  32   PTDWPLIGMLPRVILNFHRVHDYITSVLTVCGGTYMFRGPCFFNIDMLFTSDPANIHHVF  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVWH  530
            SRNFSNYPKGP+FR+IFD+LGDGIF  D +LWE HRKTTL+   HA F++ LE  VWH
Sbjct  92   SRNFSNYPKGPEFRKIFDILGDGIFGADFELWEIHRKTTLAQLTHADFNAQLERAVWH  149



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  147  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  326
            K E+  + + P  W VVGMLPGL+ NAHR+H ++T+IL+E+G TF FKGP+  N+DM+ T
Sbjct  23   KFENRRKGSTPTNWPVVGMLPGLVGNAHRIHDYITEILRENGATFVFKGPLFTNMDMVFT  82

Query  327  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            CDP NI+HI ++ FSNYPKGP+F++IF+++GDGIF  D ++WE  R+ TLS  N   F++
Sbjct  83   CDPININHIFNKRFSNYPKGPEFQKIFEIMGDGIFRSDFEMWELQRRLTLSIVNQVGFYT  142

Query  507  LLETNVW  527
             +E   W
Sbjct  143  SVEKTTW  149



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            R  IP  W ++GM+PG+L NAH+LH + T++L +S GTF  KGP L N+DML+T DP +I
Sbjct  30   RHVIPSNWPILGMIPGVLVNAHQLHDYTTELLIQSRGTFMLKGPWLANMDMLLTTDPLDI  89

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            HHILS+NFSNYPKG +F++IFD+LGDGI N D ++WE   K   S  NH  F S +ET +
Sbjct  90   HHILSKNFSNYPKGDKFQKIFDILGDGILNADGKIWEISHKVIFSVLNHVGFQSKMETII  149

Query  525  W  527
            W
Sbjct  150  W  150



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
             ++++P  W +VGMLP +  N HR+  ++T+IL ESGGTF+FK P   N+D LIT +P N
Sbjct  34   KKTSLPTNWPLVGMLPAIQRNRHRMQDYITEILIESGGTFQFKFPHFLNMDTLITSNPDN  93

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            I+HI ++NFSNYPKGP+F++IF+ LGD IF+VD++LWEF R+TT SF  H  F+SLLE  
Sbjct  94   INHIFTKNFSNYPKGPEFKKIFEELGDSIFSVDNELWEFQRRTTHSFMTHPEFNSLLEGV  153

Query  522  VWH  530
            VW 
Sbjct  154  VWQ  156



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 5/134 (4%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  308
            FCY        +++ +P  W +VGML  LL N  R+H ++T++L++S   F FKGP   N
Sbjct  17   FCY-----SFRNKNGVPTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFAN  71

Query  309  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  488
            ++M +T DPAN+H+I+S+NF NYPKG +F ++FDV GDGIFNVDS+LWE+HRK   +F  
Sbjct  72   MEMFVTLDPANVHYIMSKNFKNYPKGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIG  131

Query  489  HAHFHSLLETNVWH  530
            H  FH  L   VW 
Sbjct  132  HPKFHQFLHEKVWE  145



>ref|XP_010531420.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=514

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF    + +     +  PR W  +GMLPG+L   HR++ +  D+L+ S  TF FKGP   
Sbjct  17   CFLVFHILLNKKPHACFPRNWPFLGMLPGVLVVFHRVYDWAADVLEISDLTFTFKGPWFA  76

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +DML+T DP+NIHHI+S +FSNYPKGP+F+++FDVLGDGI NVDS LWE  RK+T S F
Sbjct  77   GIDMLVTVDPSNIHHIMSSHFSNYPKGPEFKEVFDVLGDGILNVDSDLWENLRKSTQSIF  136

Query  486  NHAHF  500
            NH  F
Sbjct  137  NHEGF  141



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
            +   LDML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   IFAKLDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADLDLWKIQRKTAR  130

Query  477  SFFNHAHFHSLL  512
            +   H  F+  L
Sbjct  131  ALITHQQFYKFL  142



>gb|EPS60696.1| hypothetical protein M569_14105, partial [Genlisea aurea]
Length=468

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            SR++    W +V MLPGL  N HR+H F+ ++L ESGGTF F+GPV GN DML+T DPAN
Sbjct  2    SRNSKIADWPIVAMLPGLARNVHRVHDFIAEVLAESGGTFVFRGPVFGNTDMLVTSDPAN  61

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            +H+ILS+NF N+ KGP F++IFD+LGDGIF  + + WE  R+   +   +  FH  +   
Sbjct  62   VHYILSKNFHNFGKGPDFKKIFDILGDGIFAAEFESWEKQRRAAKAAVGNLAFHQFVART  121

Query  522  VW  527
            VW
Sbjct  122  VW  123



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
            +   +DML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   LFAKMDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADMDLWKIQRKTAR  130

Query  477  SFFNHAHFHSLL  512
            +   H  F+  L
Sbjct  131  ALITHQQFYKFL  142



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C++ ++   S+ + IP+ + VVG LP LL N HR+H + T++L+++  TF FKGP
Sbjct  10   FLAIICFLILRYCFSNNNGIPKNFPVVGTLPHLLLNVHRIHDYSTEVLEKTQCTFLFKGP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D+L T DPAN+HHI+S NFSN+PKGP+F++IFD+LGDGIFN DS LW+  R+   
Sbjct  70   WFANMDILATVDPANVHHIMSSNFSNFPKGPEFKRIFDILGDGIFNSDSDLWKNQRRFAQ  129

Query  477  SFFNHAHFHSLL  512
            +  N   F+  L
Sbjct  130  ALMNRHSFYKFL  141



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA   LL + + F+ FS L  +  +  K   S     P  W  +GMLPGLL   HR++ +
Sbjct  1    MALIGLLEVSVSFLCFSVLFAYFLISKKPHPS----FPTNWPFLGMLPGLLVEIHRVYDY  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T++L+ S  T+ F+GP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   MTEVLEASNLTYPFRGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFH  503
            IFN DS+LW+  RK+  S  +H  F 
Sbjct  117  IFNADSELWKDLRKSAQSMMSHPEFQ  142



>ref|XP_010680694.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  468  TTLSFFNHAHFHSLLETNVW  527
               SFFNH  FH  L    W
Sbjct  121  VAHSFFNHPKFHQSLVDVTW  140



>ref|XP_010027332.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62196.1| hypothetical protein EUGRSUZ_H04854 [Eucalyptus grandis]
Length=272

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  +++ S S    PR W +VGMLP LL N    H + T +++ S G F  + P
Sbjct  10   FLAGICFAVLRLLSKSNDGFPRNWPLVGMLPALLLNPSHFHDWATGVVERSHGNFFVRFP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSMQRRVAQ  129

Query  477  SFFNHAHFHSLLETNV  524
             F     FH  L +  
Sbjct  130  VFMKDQRFHRFLSSTT  145



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F    C++ +       + +P+ W ++GMLPGLL+  HR H +VTD+L++S  TF+FKGP
Sbjct  10   FFAFICFLSLIFCLRKNNGLPKNWPLIGMLPGLLFQVHRFHDWVTDVLEQSKCTFQFKGP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
              G++D+L+T DPANIH+I S NFSN+ KG  F + FD+LGDGI N D  LW+  RK   
Sbjct  70   WFGDMDILVTADPANIHYITSSNFSNFEKGSDFNKRFDILGDGIINADRDLWKSQRKVAQ  129

Query  477  SFFNHAHFHSLLETNV  524
            +  NH  F+  L   +
Sbjct  130  ALVNHRLFYQRLVKTI  145



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 94/146 (64%), Gaps = 4/146 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA   LL + +  +  SFL  +C +  K   S  +     W  +GMLPGLL    R++ +
Sbjct  1    MALITLLEVSISLLFISFLYGYCLISKKPHRSFLT----NWPFLGMLPGLLVEIPRVYDY  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            VT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   VTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFH  503
            IFN DS+LW+  RK+  S   H  F 
Sbjct  117  IFNADSELWKDLRKSAQSMMTHQDFQ  142



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            I  +L   CY +  +    +S++P  W ++GM+P LL N  RLHQ  T++L++SGGT  F
Sbjct  13   IVLYLMLLCY-RYAVGRKEKSSLPTNWPILGMIPALLKNIGRLHQVTTEVLEQSGGTIWF  71

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP   N+DM++T D AN+H+IL++NF N+ KGP+F++IFD+ GDGIF  + + WE  R+
Sbjct  72   KGPWFANMDMMVTSDRANVHYILTKNFPNFSKGPEFKKIFDIFGDGIFAAEHESWESQRR  131

Query  468  TTLSFFNHAHFHSLLETNVWH  530
            +T +      F  L+ T  W+
Sbjct  132  STKALMMQPGFQELVATTSWN  152



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  147  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  326
            K + SS +  P  W + GMLPGLL N  R+H F+T++L+ SGGTF  KG    N+ MLIT
Sbjct  27   KDKKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFMTELLESSGGTFYLKGAWFANMSMLIT  86

Query  327  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             DPAN+H+IL++NF N+ KGPQF+++FDVLGDGIFN +S+ WE  ++T  S  ++  F  
Sbjct  87   SDPANVHYILAKNFPNFEKGPQFKKMFDVLGDGIFNAESESWEIQKRTAKSLMHNTSFPD  146

Query  507  LLETNVW  527
             +    W
Sbjct  147  FIARTSW  153



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = +3

Query  66   MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  242
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  19   MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  73

Query  243  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  422
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  74   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  133

Query  423  GIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            GIFN DS LW+  RK+  S  +   F    L TN+
Sbjct  134  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM  168



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPGLL    R++ FVT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F++IFDVLGDGIFN DS+LW+  RK+  S   H  F 
Sbjct  97   FANYPKGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQ  142



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  468  TTLSFFNHAHFHSLLETNVW  527
               SFFNH  FH  L    W
Sbjct  121  VAHSFFNHPKFHQSLVDVTW  140



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = +3

Query  66   MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  242
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  243  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  422
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  56   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  115

Query  423  GIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            GIFN DS LW+  RK+  S  +   F    L TN+
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM  150



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F+  FC+         RS +P  W  +GM PGLL++ +R+H+   ++   +GGTF  KGP
Sbjct  16   FVAIFCFFVF-CALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTGGTFLLKGP  74

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D+L T DPAN+H+I+S NF N+PKG +F++IFDVLGDGIFN D  LW+  RK T 
Sbjct  75   WFANIDILGTVDPANVHYIMSANFENFPKGEEFKKIFDVLGDGIFNSDLDLWKSQRKITR  134

Query  477  SFFNHAHFHSLLETNVW  527
            +   H  FH+ LE   W
Sbjct  135  TLITHQRFHNCLEKTSW  151



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 9/149 (6%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA  +   +L+  + F F+G FC         S+  +P  W +VGM  GLL++ HR+H  
Sbjct  1    MALVSYPEILVAVIFFLFIGGFC---------SKKGVPWNWPIVGMFAGLLFHVHRIHDE  51

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
              +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+PKG +FR++F+VLGDG
Sbjct  52   AAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFPKGTEFRKMFEVLGDG  111

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            IFN D + W   RK   S  N+  FH  L
Sbjct  112  IFNADGESWRNQRKLGQSMINNPRFHRFL  140



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            ++S  P  W +VGML  LL N +R+H +V++IL+ S  +F FKGP   N++ML+T DPAN
Sbjct  22   NKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQLSFLFKGPWFTNMEMLVTVDPAN  81

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            IHHI+++NFSNYPKG +F +IFDV+GDGIFNVD  LW++HR    +F  H  F   L   
Sbjct  82   IHHIMTKNFSNYPKGTKFNEIFDVMGDGIFNVDFDLWKYHRSMAHTFIAHPRFRHFLVVK  141

Query  522  V  524
            +
Sbjct  142  I  142



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPA  338
            SR+++ R   V+GMLPGLL N  RLH+F+T D+LK++ GTFEF GP    +D++IT DP 
Sbjct  29   SRNSLRRNRPVLGMLPGLLGNTWRLHEFLTHDVLKKNRGTFEFTGPWFAQMDLIITSDPM  88

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            N+H+I S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F S LE 
Sbjct  89   NVHYISSKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHNKFESALE-  147

Query  519  NVWH  530
            NV H
Sbjct  148  NVAH  151



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C   +++ S S   +PRKW +VGMLP LL N    H + T +++ S G F F+ P
Sbjct  10   FLAGICLGVLRLLSKSDDGLPRKWPLVGMLPTLLLNLSHFHDWATGVVERSHGNFFFRLP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  477  SFFNHAHFHSLLETNV  524
             F     FH  L +  
Sbjct  130  VFMKDQRFHRFLSSTT  145



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP    LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCIGPCFAGLDMLVTVDPANIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F 
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQ  141



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA   LL   + F+ FSF+  +  +  K   S  +     W +VGMLPGLL    R++ +
Sbjct  1    MALITLLEASIYFLFFSFISGYFLISKKPHRSFMT----DWPIVGMLPGLLVEIPRIYDY  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T++L+ S  T+ FKGP  G LDML+T DPANIH+I+S NF+NYPKG +FR++FDVLGDG
Sbjct  57   LTELLEASNLTYPFKGPCSGGLDMLVTIDPANIHYIMSSNFANYPKGSEFRKLFDVLGDG  116

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFH  503
            IFN DS+LW+  RK+     +H  F 
Sbjct  117  IFNADSELWKDLRKSAEGMMSHPDFQ  142



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W ++GMLPGLL    R++ F+TD+L+     F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITDVLEGGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F 
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQ  141



>gb|EPS73452.1| hypothetical protein M569_01304 [Genlisea aurea]
Length=134

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L CF +      +  ++A    W V+GMLP +L N HR+H F T+I+ +SGGTF  KGP
Sbjct  9    LLPCFAFALACYRTWRKAAA--DWPVIGMLPSVLRNLHRIHDFATEIVVDSGGTFLLKGP  66

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
             L  +DML+T DPAN+H+IL++NF N+ KG  FR+IFDV GDGIF V+S++WE  R+   
Sbjct  67   RLAEMDMLLTSDPANVHYILTKNFGNFGKGSDFREIFDVWGDGIFAVESEMWENQRRMAK  126

Query  477  SF  482
             F
Sbjct  127  LF  128



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 96/155 (62%), Gaps = 7/155 (5%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFL-GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  242
            MA  +LL + + F+ FSF  G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEITVSFLCFSFFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  243  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  422
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++F VLGD
Sbjct  56   YVTEFLEASNLTFPFKGPCFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFSVLGD  115

Query  423  GIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            GIFN DS LW+  RK+  S  +   F    L TN+
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM  150



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHQQFYKFL  141



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +3

Query  120  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            +  FC++   +      + P  W  +GMLPGLL    R++ FVT+ L+++   F FKGP 
Sbjct  11   IAFFCFLIFLISKKRHRSFPTNWPFLGMLPGLLVEIPRVYDFVTEFLEDANLNFLFKGPF  70

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
             G LDML+T DPANIHHI+S NF+NYPKG +F+++FD+LGDGIFN DS+LW   RK+  S
Sbjct  71   WGGLDMLVTVDPANIHHIMSSNFANYPKGTEFKKLFDILGDGIFNADSELWNDLRKSAQS  130

Query  480  FFNHAHFH  503
               +  F 
Sbjct  131  MMMNPKFQ  138



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +3

Query  111  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  290
             +FL  F +    +        P  W  +G++PGLL   HR++ F+T+IL+ +  T+  K
Sbjct  11   IAFLCFFLFRHFLINKKPHRLCPTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCK  70

Query  291  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  470
            GP    LDML+T DP+NIHHI+S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+
Sbjct  71   GPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKS  130

Query  471  TLSFFNHAHFH  503
              S   H  F 
Sbjct  131  AQSMMMHPEFQ  141



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHLQFYKFL  141



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            M S A + +    M+   L   C++ ++  S + S +P  W V+GMLP LL N H +H +
Sbjct  1    MTSMAFMGMGYFEMLLLSLAVVCFIYLRRLSRNDSPLP-DWPVLGMLPSLLRNIHHVHDW  59

Query  246  VTDILKESGG-TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  422
             T +L++S   TF F+GP L  +DM+ TCDPAN+H+I+S +FSN+PKGP+F+ IFDVLGD
Sbjct  60   TTKLLEQSRSYTFTFRGPWLAGMDMVWTCDPANVHYIMSTHFSNFPKGPEFKNIFDVLGD  119

Query  423  GIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            GIFN DS LW+  RK      +   F   LE
Sbjct  120  GIFNSDSDLWKTQRKVAHGLISRRRFCRFLE  150



>ref|XP_010419318.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=363

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+ 
Sbjct  32   PRNWPVLGMLPGILITLHRINDYVAEVLEVSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  92   SSNFSNYSKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVLLSHQGFQS  141



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
             ++ +P  W ++GMLP LL N HR+H F+ +I ++S  TF F GP   N+ +L+T DPAN
Sbjct  25   DKTGLPTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPAN  84

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            IHH++S+NF NYPKG +F ++FDVLGDGIFN D  +W++HRK    F  H  FH  L
Sbjct  85   IHHVMSKNFGNYPKGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFL  141



>ref|XP_010436205.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=450

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W ++GMLPGL+    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLVPELPRVYDFLTEVLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F 
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQ  141



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = +3

Query  129  FCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            FC++  +   +   +    P  W   GM+PGLL   HR++ F+T+IL+ +  T+   GP 
Sbjct  14   FCFLLFRHFLINKKTHRLCPTNWPFFGMIPGLLVEIHRVYDFITEILEVTNLTYPCTGPC  73

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
              NLDML+T DPANIHHI+S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S
Sbjct  74   FANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQS  133

Query  480  FFNHAHFH  503
               +  F 
Sbjct  134  MMMNPEFQ  141



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +GM+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFITEILEVTNLTYPCIGPCFANLDMLVTVDPANIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F 
Sbjct  93   SSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQ  141



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +G++PGLL   HR++ F+T+IL+ +  T+  KGP    LDML+T DP+NIHHI+
Sbjct  33   PTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   H  F 
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQ  141



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  S   +  F 
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQ  141



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F F+ CF          + + +P  W VVGMLP L  + HR+H    DILK +GGTF
Sbjct  16   FIFFLFVWCF---------RNINGLPWNWPVVGMLPSLFCHLHRVHHRCVDILKLAGGTF  66

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
              KGP   N D++IT DPANIH I+S NF+N+PKGP F++IFDVLGDGIFN DS  W   
Sbjct  67   HLKGPSFANSDIIITADPANIHFIMSSNFANFPKGPHFKEIFDVLGDGIFNADSDSWARQ  126

Query  462  RKTTLSFFNHAHFHSLL  512
            RK   +   H  F   L
Sbjct  127  RKQARALITHDSFRRFL  143



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            SRS IP  W VVGMLP LL N HRLH + TD+L+E+G +F F+GP    ++ L+TCDPAN
Sbjct  43   SRSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCDPAN  102

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +HH+   NFSNYPKG  F +IFD+LGDGIFN D Q W+  R    S  +   F + +
Sbjct  103  VHHVFGANFSNYPKGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFV  159



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGT  278
             +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GT
Sbjct  1    MIIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWHFHEFLAHDVLKKNRGT  60

Query  279  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            FEF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+ 
Sbjct  61   FEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKI  120

Query  459  HRKTTLSFFNHAHFHSLLE  515
             RK   S   H  F S LE
Sbjct  121  QRKIIHSVMKHNKFESALE  139



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W ++GMLPGLL    R++ ++T++L+ S  T+ FKGP  G LDML+T DPANIH+I+S N
Sbjct  37   WPILGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCFGGLDMLVTVDPANIHYIMSSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +FR++FDVLGDGIFN DS+LW+  RK+     +H  F 
Sbjct  97   FANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQ  142



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            M+P L  N HR   ++T+IL+ESGGTFEFKGP   N+DML+T DPAN++HILS++FSN+ 
Sbjct  1    MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVWH  530
            KGP+F ++FD+LG GIFN + + WE  RKT +   NH  F   +    W+
Sbjct  61   KGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITSWN  110



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGT  278
             +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GT
Sbjct  1    MIIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWYFHEFLAHDVLKKNRGT  60

Query  279  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            FEF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+ 
Sbjct  61   FEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKI  120

Query  459  HRKTTLSFFNHAHFHSLLE  515
             RK   S   H  F S LE
Sbjct  121  QRKIIHSVMKHNKFESALE  139



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W ++GMLPGLL    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITELLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK + S  +H  F 
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKFSQSMMSHPEFQ  141



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +GM+PGLL   HR++ FVT++L+ +  T+   GP    LDMLIT DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTEVLEVTNLTYPCVGPCFAGLDMLITVDPANIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NF+NYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F 
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQ  141



>gb|KDO55118.1| hypothetical protein CISIN_1g036278mg, partial [Citrus sinensis]
Length=316

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            R   V+GMLPGLL N  RLH+F+T D+LK+  GTFEF GP    +D++IT DP N+H+I 
Sbjct  2    RNRPVLGMLPGLLGNTWRLHEFLTHDVLKKKRGTFEFTGPWFAQMDLIITSDPMNVHYIS  61

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F S +E
Sbjct  62   SKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHKKFESAVE  114



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  480  FFNHAHFHS  506
               +  F S
Sbjct  134  MMMNPEFQS  142



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  480  FFNHAHFHS  506
               +  F S
Sbjct  134  MMMNPEFQS  142



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 83/127 (65%), Gaps = 0/127 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF      +   S   +   W ++GMLP L+    R++ +  D+L+ S  TF FKGP L 
Sbjct  70   CFLIFGFLLFKKSNRDVLTNWPILGMLPSLVVQIPRVYDWSVDVLEASNLTFLFKGPWLA  129

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +D+L+T DPANIHHI+S NF NYPKG +F++IFDVLGDGIFNVDS LW+  RK+  + F
Sbjct  130  GMDLLVTVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDGIFNVDSDLWKDLRKSAQTMF  189

Query  486  NHAHFHS  506
            NH  F +
Sbjct  190  NHQDFQT  196



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPGLL    R++ F+T++L+++   + FKGP LG +DML T DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLTQLPRVYDFLTEVLEDANLNYLFKGPFLGGIDMLFTVDPANIHHIMSSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F 
Sbjct  97   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQ  142



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             S NF+NY KGP+F++IFD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  91   FSSNFTNYDKGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQS  141



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            FC++  ++   S+   P     W  +GMLPGL+    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLILEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGAEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  480  FFNHAHFHS  506
               +  F S
Sbjct  134  MMMNPEFQS  142



>ref|XP_010472325.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=282

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S N
Sbjct  70   WLFLGMLPGFLMEIPRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSN  129

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  + 
Sbjct  130  FANYPKGSEFKKLFDVLGDGIFNADSELWKDLRKSAQSIMRNPEYQ  175



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F+  FC+         RS +P  W  +GM PGLL++ +R+H+   ++   +GGT+  KGP
Sbjct  16   FVAIFCFFVF-CALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSRTGGTYLLKGP  74

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D+L T DPAN+H+I+S  F N+PKG +F++IFDVLGDGIFN D  LW+  RK T 
Sbjct  75   WFANMDILGTVDPANVHYIMSAKFENFPKGEEFKKIFDVLGDGIFNSDLDLWKTQRKITR  134

Query  477  SFFNHAHFHSLLETNVW  527
            +   H  FH+ L    W
Sbjct  135  TLITHQRFHNCLVKTSW  151



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C++ +++ S S   IPR W +VGMLP LL N    H + T +++ S G F F+  
Sbjct  10   FLAGICFLVLRLLSKSDDGIPRNWPLVGMLPALLLNLSHFHDWATGVVERSQGNFFFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +++L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMEILLTADPANVHYIMSTNFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  477  SFFNHAHFHSLLETNV  524
             F     FH  L   +
Sbjct  130  VFMKDQRFHQFLSLTI  145



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W  +GM+PG+L   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGMLAEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  +   +  F 
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQNMMMNPEFQ  141



>emb|CDX72698.1| BnaC07g47200D [Brassica napus]
Length=449

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 91/142 (64%), Gaps = 7/142 (5%)
 Frame = +3

Query  105  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  263
            MI  FL  F        +  + +   +   +P  W+V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWSVLGMLPGLLLQVHRIYDWITELLE  62

Query  264  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  443
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  444  QLWEFHRKTTLSFFNHAHFHSL  509
             +WE  R ++ + F+   F  L
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRL  144



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L   C++ +   S+S + +P  W +VGMLP +  N  ++    T++L++S GTF  KGP
Sbjct  10   LLAVICFLLLHRLSNS-NMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFLLKGP  68

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+DMLIT DPAN+H+I+S NFSN+PKGP+F +IFDVLG+GIFN DS LW   RK   
Sbjct  69   WFANMDMLITSDPANVHYIMSTNFSNFPKGPEFLKIFDVLGEGIFNSDSDLWRKQRKLAQ  128

Query  477  SFFNHAHFHSLL  512
               N   F   L
Sbjct  129  VLINDRQFQQFL  140



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEVLEVSSLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK++L   +H  F S
Sbjct  91   FSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSSLVVLSHQGFQS  141



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             S NF+NY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  91   FSSNFTNYDKGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQS  141



>ref|NP_179782.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD20408.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07237.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            S    PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DP+N
Sbjct  27   SHQITPRNWPVLGMLPGVLVMLHRINDYVAEILEVSNLTFAFKGPWFSGMNMLITADPSN  86

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            I H+ S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  87   IQHVFSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQS  141



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPANIHHILSR  362
            W ++GMLPGLL N  R+H+  T++L++S  GTF F+GP   N+DML T DP NIH+I++ 
Sbjct  34   WPLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVDPENIHYIMTS  93

Query  363  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            NF N+PKGP+FR+IFDVLGDGIFN D   W+  R  + +   H  FH  L
Sbjct  94   NFRNFPKGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFL  143



>ref|XP_009107985.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=502

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F 
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQ  142



>emb|CDY53182.1| BnaA06g40610D [Brassica napus]
Length=465

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 90/142 (63%), Gaps = 7/142 (5%)
 Frame = +3

Query  105  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  263
            MI  FL  F        +  + +   +   +P  W V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWPVLGMLPGLLLQVHRIYDWITELLE  62

Query  264  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  443
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  444  QLWEFHRKTTLSFFNHAHFHSL  509
             +WE  R ++ + F+   F  L
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRL  144



>emb|CDY44658.1| BnaA08g06820D [Brassica napus]
Length=502

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F 
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQ  142



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = +3

Query  105  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  284
            + F+F+   C +   +  ++   +P  W +VGMLP LL + HR H  VTD+L++S  TF+
Sbjct  9    IFFAFICVLCSLIFCLRKNN--VLPMNWPLVGMLPSLLVHVHRFHDHVTDVLEQSKCTFQ  66

Query  285  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  464
            FKGP  G++D+L+T DPANIH+I+S NFSN+ KG  F + FD+LG GI N D  LW+  R
Sbjct  67   FKGPWFGDMDILVTADPANIHYIMSSNFSNFEKGSDFNKRFDILGHGILNADRDLWKNQR  126

Query  465  KTTLSFFNHAHFHSLLETNV  524
            K   +  NH  F+  L   +
Sbjct  127  KVAQALVNHRLFYQRLVKTI  146



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 0/139 (0%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +   L CF  ++   +     A  R W +VGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLRNNGGTSKF  68

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPKNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  468  TTLSFFNHAHFHSLLETNV  524
                F  +  +  L+E  +
Sbjct  129  MIQLFMKNNKYKELVEKTI  147



>ref|XP_010554710.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=457

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPG+L   HR++ +  +IL+ S  TF FKGP LG +DMLIT DPANIHHI+S NF NYP
Sbjct  1    MLPGVLVMFHRIYDWTVEILENSDMTFPFKGPWLGGIDMLITVDPANIHHIMSSNFGNYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHF  500
            KG +F+ +FDVLGDGI NVD +LWE  RK+T + F+H  F
Sbjct  61   KGTEFKDVFDVLGDGIINVDGELWESLRKSTRTIFSHDGF  100



>gb|KDP35253.1| hypothetical protein JCGZ_09412 [Jatropha curcas]
Length=498

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWSKALIERSGGTFLFKGP  68

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  477  SFFNHAHFHSLL  512
            +  NH  FHS L
Sbjct  129  ALINHDRFHSFL  140



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLP ++ N HR H  +T++L E G TF  +GP   + D+L T DPANI HI S+ FSNYP
Sbjct  1    MLPTIVRNLHRAHDKLTEVLIECGATFLLRGPWFFDTDILFTSDPANIQHIFSKRFSNYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVWH  530
            KG +FR  F++LGDG+F+ D +LWE  R+T LS  +HA FH+ LE NVW 
Sbjct  61   KGSEFRNKFEILGDGVFSSDFELWELQRRTILSIISHAKFHTSLERNVWE  110



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPGLL    R++ F T+IL+++   F FKGP LG LDMLIT DPANIHHI+S NF+NYP
Sbjct  1    MLPGLLVEIPRVYDFATEILEDANLNFPFKGPFLGGLDMLITVDPANIHHIMSSNFANYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            KG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  F +
Sbjct  61   KGTEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQN  102



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            +++  P  W V GMLP  LY+ HR+HQ  T++L+ +G T  +KGP   N+ +L T DP N
Sbjct  24   NKNGQPINWPVFGMLPDTLYHLHRIHQRTTEVLERAGSTLYYKGPWFSNVKILATVDPTN  83

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            IH+I+S NFSN+PKGP+F +IFD+LGDGIFN DS  W+  RK   +  N   FH  L
Sbjct  84   IHYIMSSNFSNFPKGPEFSKIFDILGDGIFNSDSNSWKNQRKLAHTLINRGCFHKFL  140



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNA-HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
            SR  +   W VVGM+PGLL+     +H F T +L+ SGGT  F+GP    ++ L+T DP 
Sbjct  23   SRGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWFSGMNFLMTSDPM  82

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            N+ +I+S+NF+NYPKGP FRQIF+VLGDGIFNVDS  W   R+   S      FH  +E 
Sbjct  83   NVQYIVSKNFANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAVER  142

Query  519  NVWH  530
             V H
Sbjct  143  TVEH  146



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKE-SGGTFEFKG  293
             L   C++ +    ++    P+ + +VGM+PGLL N HR+H + T+IL+     T+ F+G
Sbjct  10   LLAIICFLFLFCLRNNVHGTPKNFPLVGMMPGLLLNTHRIHDWCTEILERCQCSTYLFQG  69

Query  294  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  473
            P    ++ML+TCDPANIH+I+S NF N+PKG +F++IFD+LGDGIFN D  LW+  RK  
Sbjct  70   PWFAKMNMLVTCDPANIHYIMSSNFCNFPKGSEFKEIFDILGDGIFNADMDLWKKQRKAA  129

Query  474  LSFFNHAHFHSLL  512
              F  H  F+  L
Sbjct  130  QGFMRHQLFYLFL  142



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  + + S S    PR W +VGMLP L  N  R+H + T +++ S G F F+  
Sbjct  10   FLAGICFAVLCLLSKSDDGFPRNWPLVGMLPALFLNLSRVHDWATGLVERSHGNFFFRSL  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               ++DML+T DPAN H+I+S NF N+PKGP+F+++FD+LGDGI N DS LW   R+   
Sbjct  70   WFSSMDMLVTADPANFHYIMSANFGNFPKGPEFKRVFDILGDGIINSDSNLWSTQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F     FH  L
Sbjct  130  VFMKDQRFHRFL  141



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P+ W +VGMLP +L++   +H  +T I+  +GGTF  KGP+   +D+L T DP+N+H+I+
Sbjct  31   PKSWPIVGMLPSMLFHLKHIHDRLTVIMSVTGGTFVPKGPLFAEMDILATVDPSNVHYIM  90

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            S+NF N+PKG +F+++FDVLGDGIFN D  LW+  RKTT S   H  F+  L
Sbjct  91   SQNFMNFPKGKKFKELFDVLGDGIFNADMDLWKIQRKTTRSLVTHQQFYKFL  142



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 13/123 (11%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
             ++++P  W +VGMLP +L N HR+H + T+IL ESGGTF  +G   G +          
Sbjct  29   KKTSLPTNWPLVGMLPAILLNCHRIHAYFTEILIESGGTFIPRGFQHGYVGYF-------  81

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
                  RNFSNYPKGP+F+++F++LGDGIFN D +LWE HR+TTLSF NH  F+ LLE +
Sbjct  82   ------RNFSNYPKGPEFKKMFEILGDGIFNADFELWELHRRTTLSFLNHTKFYDLLERS  135

Query  522  VWH  530
            +W 
Sbjct  136  IWE  138



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  308
            +CY K   E +    IP  W  VGMLP LL + H+LH + T ILKE+G  F F GP    
Sbjct  31   YCYRKRMNEGT---GIPVNWPFVGMLPALLVHLHQLHDWGTMILKETGCNFFFHGPWYSG  87

Query  309  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  488
            +DMLITCDPAN++H+ S NF NYPKG  F +IFDVLGDGIFN D++ W   R    S  N
Sbjct  88   MDMLITCDPANVYHVFSANFHNYPKGDDFSEIFDVLGDGIFNSDAESWRRQRMKAHSLIN  147

Query  489  HAHFHSLL  512
               F + +
Sbjct  148  DRRFRAFV  155



>ref|XP_010526618.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=513

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR    +GMLPGLL    R +    D+L++S  TF FKGP    +D+L T DPANIHH++
Sbjct  32   PRNLPFLGMLPGLLVAFDRFYDLAVDVLEKSNMTFPFKGPWFMGMDVLATVDPANIHHVM  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHF  500
            S NF NYPKG  F++IFDV+GDGI NVD +LWE  RK+TL+ F+H  F
Sbjct  92   SSNFGNYPKGDDFKEIFDVIGDGIINVDGELWENLRKSTLAIFSHEGF  139



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 84/134 (63%), Gaps = 10/134 (7%)
 Frame = +3

Query  108  IFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  278
            IF  + CF   CY+       +R  IP  W  +GMLP +L + HR H    DIL+ +  +
Sbjct  10   IFLAVVCFFLICYL-------TRHGIPWNWPFLGMLPSILIHLHRTHHRCVDILQGNNCS  62

Query  279  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            F FKGP   N+D L+T DPANI HI+S NF+NYPKG +F +IFD+LG+GIFN D +LW+ 
Sbjct  63   FLFKGPWFANMDFLMTVDPANIQHIMSSNFTNYPKGEEFLKIFDILGNGIFNSDGELWKL  122

Query  459  HRKTTLSFFNHAHF  500
             RK T +  NH  F
Sbjct  123  QRKITRALINHRSF  136



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  308
             CY K+   +      P  W V+GMLPG L N  R H+++T++L+++GGTF  KGP   N
Sbjct  10   LCYGKI-FHARKEKRTPTNWPVLGMLPGALANIGRPHEYITEVLQQNGGTFYHKGPWFTN  68

Query  309  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  488
            L+++ TCDP N+H+I ++NFSN+ KGP+F+++FD++G+GI   +S+ WE  R++  S  N
Sbjct  69   LNIMFTCDPVNVHYIQAKNFSNFQKGPEFKKMFDIMGEGILTAESESWENQRRSAKSLIN  128

Query  489  HAHFHSLLETNV  524
            +  F   + T  
Sbjct  129  NTSFLEFVATTT  140



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W V+GMLPG+L+  H ++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLFMLHMINDYVAEILEVSNLTFAFKGPWFTGMNMLITADPANIQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
               NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  91   FCSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQS  141



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F IF  + CF Y++  + S  R A   K  ++G  P L+ N HR+H    ++L+++ GT+
Sbjct  9    FEIFLAIICFFYLR-NLRSFKRLAW--KLPILGTFPYLIMNIHRIHDKCAEVLEKTRGTY  65

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
              KGP   N+D+L T DPAN+H+I+S NF N+PKGP+F++IF+VLGDGIFN D  LW+  
Sbjct  66   HLKGPSFANMDILGTVDPANVHYIMSSNFVNFPKGPEFKKIFEVLGDGIFNSDLDLWKCQ  125

Query  462  RKTTLSFFNHAHFHSLLE  515
            RK   +  NH  FH  L+
Sbjct  126  RKLARALLNHQSFHKFLQ  143



>emb|CDY32582.1| BnaC03g15500D [Brassica napus]
Length=435

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 7/136 (5%)
 Frame = +3

Query  102  FMIFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  278
            F+ F  L C F +M+      +++  P  W V+GMLPGLL   HR+H ++T +L+ +  T
Sbjct  14   FIFFLVLYCLFLHMR------TQTPFPTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMT  67

Query  279  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            F  KGP     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE 
Sbjct  68   FRLKGPWGSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWEE  127

Query  459  HRKTTLSFFNHAHFHS  506
             R ++ + F+H  F S
Sbjct  128  MRNSSHAIFSHQDFRS  143



>ref|XP_010474420.1| PREDICTED: cytochrome P450 86A4-like [Camelina sativa]
Length=368

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W ++G LPGLL    R++ + T++L+ S  T+ FKGP  G LDML T DPANIH+I+S  
Sbjct  4    WPILGRLPGLLVEIPRIYDYATEVLEASNLTYLFKGPCFGGLDMLATVDPANIHYIMSSK  63

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            F+NYPKG +FR++FD+LGDGIFN DS+LW+  RK+     +H  F S
Sbjct  64   FANYPKGSEFRKLFDLLGDGIFNADSELWKDLRKSAEGMMSHPDFQS  110



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            M+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+S NF+NYP
Sbjct  1    MIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            KGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F 
Sbjct  61   KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQ  101



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = +3

Query  105  MIFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  275
            ++F+ L CF   C+       S+ + +P  W +VGMLP + ++ +++H    +I ++ GG
Sbjct  11   ILFALLCCFLVWCF-------SNINGMPWNWPLVGMLPSVFWHVNQIHDRCVNIFEQVGG  63

Query  276  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  455
            TF  KGP   N+D++ T DPAN+H I+S NF+N+PKG +F++IFDVLGDGIFN D+ LW 
Sbjct  64   TFLLKGPWFANMDIIATADPANVHFIMSANFANFPKGAEFKKIFDVLGDGIFNSDADLWR  123

Query  456  FHRKTTLSFFNHAHFHSLLETNVWH  530
              RK   +   H  F   L    W 
Sbjct  124  SQRKQARALITHERFRKFLIKTSWE  148



>ref|XP_010027235.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
Length=237

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+    +   S   +P+ W +VGMLP L  N  R H + T +L++S   F F+  
Sbjct  10   FLATICFAVFHLLGKSHDGLPKNWPLVGMLPALFLNLGRGHDWATGVLEQSRCNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +D+L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVTADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRMQRRVAQ  129

Query  477  SFFNHAHFHSLLETNV  524
             F N   F   L T  
Sbjct  130  VFMNDQRFCRFLATTT  145



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +   L CF  ++   +     A    W VVGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALRNNGGTSKF  68

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPRNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  468  TTLSFFNHAHFHSLLETNV  524
                F  +  +  L+E  +
Sbjct  129  MIQLFMKNNKYKGLVEKTI  147



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   FH  L
Sbjct  130  VFMNDQRFHRFL  141



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   FH  L
Sbjct  130  VFMNDQRFHRFL  141



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  +++ S     +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKRDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSRGNFFLRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML T DPAN+H+ILS NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLFTADPANVHYILSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F     FH  L
Sbjct  130  VFMKDLRFHRFL  141



>gb|KCW62188.1| hypothetical protein EUGRSUZ_H04845 [Eucalyptus grandis]
Length=415

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C++ + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFVVLCLLGKSDDGLPNNWPLVGMLPALCLNLSHVHDWATGILERSRCNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+P GP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPNGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   FH  L
Sbjct  130  VFMNDQRFHRFL  141



>gb|KDO37445.1| hypothetical protein CISIN_1g036716mg, partial [Citrus sinensis]
Length=208

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 81/141 (57%), Gaps = 13/141 (9%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +F F+GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFIFIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  468  TTLSFFNHAHFHSLLETNVWH  530
               S   H  F S LE  ++ 
Sbjct  113  MIHSVMKHNKFESALEKTIYQ  133



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA  +LL + + F+ FSFL  +  +  K   S     P KW ++GMLPGLL    R++ +
Sbjct  1    MALLSLLEVSVSFLCFSFLFGYFLISKKPHRS----FPTKWPLLGMLPGLLVEIPRVYDY  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T++L+ S  TF FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   ITEVLEASNLTFPFKGPSFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFH  503
            IFN DS LW+  RK+  S  +H  F 
Sbjct  117  IFNADSDLWKDLRKSAQSMMSHQEFQ  142



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F    CF   K      ++   P  W V+GMLP LL+   R++  +T++L+ +  TF
Sbjct  14   FIFFLVFQCFLLHK-----KTQRPFPTNWPVLGMLPALLHQVPRIYDCITEVLEAADMTF  68

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
             FKGP L   D+LIT DPANIH+ILS NF NYPKG +FR IF  LGD IFNVD +LWE  
Sbjct  69   HFKGPWLSRTDILITVDPANIHYILSSNFVNYPKGMEFRNIFKELGDSIFNVDWELWEDL  128

Query  462  RKTTLSFFNHAHFHSL  509
            R +  + F+H  F  +
Sbjct  129  RNSAHAIFSHQEFQKI  144



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S  P  + + GMLPGLLYN  ++H+  T  +K SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T S   H  F+  L
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFL  141



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  +++   S   +P+ W +VGMLP L  N  R+H +VT  L+ S G F F+  
Sbjct  10   FLAAICFAFLRLLGKSHDGLPKNWPLVGMLPALFLNLGRVHDWVTGFLERSHGNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDMWRMQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   F   L
Sbjct  130  VFMNDRRFCRFL  141



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F 
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQ  140



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F 
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQ  140



>gb|KDP35254.1| hypothetical protein JCGZ_09413 [Jatropha curcas]
Length=498

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWNKALIERSGGTFLFKGP  68

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  477  SFFNHAHFHSLL  512
            +  NH  F S L
Sbjct  129  ALINHDRFRSFL  140



>ref|XP_006405689.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
 gb|ESQ47142.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
Length=538

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R W V+GMLPGLL   H++++F   IL++S  TF FKGP    +DML T D ANIHHI+S
Sbjct  46   RNWPVLGMLPGLLVEFHQIYEFTVRILRKSNLTFTFKGPWCSGMDMLFTVDQANIHHIMS  105

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
             NFSNY KGP F+++FDVLGDGI   DS+LW+  RK +   F+H  + 
Sbjct  106  SNFSNYTKGPDFKEVFDVLGDGILTADSELWKNLRKASKVMFSHQGYQ  153



>gb|KJB71270.1| hypothetical protein B456_011G113900 [Gossypium raimondii]
Length=506

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 84/139 (60%), Gaps = 8/139 (6%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F FLGC          +S+   P  + +VGM+P LL N HR+H + T+IL+    T 
Sbjct  13   FICFLFLGCL--------KNSKDGQPINFPLVGMMPQLLLNVHRIHDWCTEILQMCHCTS  64

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
             F GP    ++ L+TCDPAN+H+++  NF N+PKG  F +IF++LGDGIFN D  LW++ 
Sbjct  65   LFMGPWFTQMNFLLTCDPANVHYVMISNFHNFPKGSDFMEIFEILGDGIFNADMDLWKYQ  124

Query  462  RKTTLSFFNHAHFHSLLET  518
            RK    F  H  FH LL T
Sbjct  125  RKVAQEFVRHQLFHRLLST  143



>gb|EYU41727.1| hypothetical protein MIMGU_mgv1a023193mg, partial [Erythranthe 
guttata]
Length=401

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  255  ILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFN  434
            IL E GGTF+ + P + N+DMLIT DP NI HI S+NF+NYPKG QFR+IFD+LGD IFN
Sbjct  42   ILSECGGTFQMRFPRIFNMDMLITSDPLNIDHIFSKNFANYPKGRQFREIFDILGDSIFN  101

Query  435  VDSQLWEFHRKTTLSFFNHAHFHSLLETNVWH  530
            VD +LWEF RKTT SF     F+SLLE+ VW 
Sbjct  102  VDDELWEFQRKTTHSFMTGPEFNSLLESVVWQ  133



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  +++ S S   +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKSDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSHGNFFLRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +D+L T DP N+H+ILS NF N+PKGP+F+++FDVLGDGIFN DS LW   R+   
Sbjct  70   WFSGMDILFTADPVNVHYILSANFGNFPKGPEFKRVFDVLGDGIFNSDSNLWSTQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F     FH  L
Sbjct  130  VFMKDLRFHRFL  141



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL    ++ ++   +++  +P  W VVGMLP  ++N HR+H+   ++L+++G TF + GP
Sbjct  10   FLAVISFVVLRYLLNTK-GMPINWPVVGMLPDTIFNFHRIHERFAEVLEQNGLTFLYAGP  68

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+ +L T DPANIH+++S NF+N+PKG +F +IF++LGDGIFN DS  W+  RKT  
Sbjct  69   WFSNVKILGTVDPANIHYVMSSNFANFPKGSEFSKIFNILGDGIFNSDSDSWKNQRKTAQ  128

Query  477  SFFNHAHFHSLL  512
            +  NH  FH  L
Sbjct  129  ALINHQRFHQFL  140



>gb|EAY88475.1| hypothetical protein OsI_09946 [Oryza sativa Indica Group]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  426  IFNVDSQLWEFHR  464
            IFNVD   W   R
Sbjct  117  IFNVDGDSWRRQR  129



>gb|ABF93892.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
 gb|EAZ25522.1| hypothetical protein OsJ_09346 [Oryza sativa Japonica Group]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  426  IFNVDSQLWEFHR  464
            IFNVD   W   R
Sbjct  117  IFNVDGDSWRRQR  129



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            +++ +P  W + GMLP  LY+ HRL++++T+ ++ +G TF +KGP   N+ +LIT DP N
Sbjct  24   NKNGLPINWPIFGMLPETLYHLHRLYEWLTEKIERAGLTFFYKGPWFSNVKILITVDPTN  83

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +H+++S NFSN+PKG +F +IFD+LGDGIFN DS  W+  RK   +  N   FH+ L
Sbjct  84   VHYVMSSNFSNFPKGSEFSKIFDILGDGIFNADSHSWKTQRKLVQTLINRGCFHNFL  140



>emb|CDY38915.1| BnaA03g12640D [Brassica napus]
Length=232

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 7/136 (5%)
 Frame = +3

Query  102  FMIFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  278
            F+ F  L C F +M+      +++     W V+GMLPGLL   HR+H ++T +L+ +  T
Sbjct  14   FIFFLVLYCLFLHMR------TQTPFLTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMT  67

Query  279  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  458
            F  KGP     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE 
Sbjct  68   FRLKGPWRSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWED  127

Query  459  HRKTTLSFFNHAHFHS  506
             R ++ + F++  F S
Sbjct  128  MRNSSHAIFSNKDFQS  143



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI ++N
Sbjct  33   WPVVGMLPGLLFQAQNVHEYATQLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTKN  92

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++
Sbjct  93   FVNYPKGPEYKKIFEPFGDGVLNSDFESWKSFRKLIHSMIKDNKFQVFLERSL  145



>gb|KFK32856.1| hypothetical protein AALP_AA6G295800 [Arabis alpina]
Length=509

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W ++GMLPG+L   HR++ +V + L+ S  TF FKGP    ++ML+T DPANI H+
Sbjct  31   LPRNWPILGMLPGVLVVFHRINDYVAEALEVSNMTFAFKGPWFSGMNMLVTADPANIQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             S NFS+Y KG +F++IFD LG+GIF  DS+LWE  RK+ L   +H  F S
Sbjct  91   FSSNFSSYDKGSEFKEIFDFLGEGIFTADSKLWEELRKSALVMLSHQGFQS  141



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 78/126 (62%), Gaps = 0/126 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF  +   +        PR W V+GMLPGLL + HRL+ +  +IL+ S  TF  KGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVLGMLPGLLVSLHRLYDYSVEILEISDLTFLLKGPRFF  74

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +DML+T DPANIHHI+S NFSNY KGP+F  +FDV GDGI   DS+LW   R++  +  
Sbjct  75   GMDMLVTVDPANIHHIMSSNFSNYIKGPEFHDVFDVFGDGILTADSELWRNLRRSYQAMV  134

Query  486  NHAHFH  503
            +H  F 
Sbjct  135  HHQGFQ  140



>gb|KFK30510.1| hypothetical protein AALP_AA7G271300 [Arabis alpina]
Length=501

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +3

Query  105  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  284
            ++ +FL    +        +R  +   W V+GMLPGLL N  R++  +T++L+ +G T+ 
Sbjct  8    ILIAFLFFLVFQGFLHHKKTRRHLATNWPVLGMLPGLLVNLPRIYDCITEVLEAAGMTYH  67

Query  285  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  464
            FKGP L   D+L+T DPANI ++LS NF NY KG +F++IF+ LGDGIFNVDS+LWE  R
Sbjct  68   FKGPWLSRTDILLTADPANIQYVLSSNFVNYHKGLEFQEIFEFLGDGIFNVDSELWEDMR  127

Query  465  KTTLSFFNHAHFHS  506
             ++ + F+H  F  
Sbjct  128  NSSHAMFSHQEFQK  141



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S  P  + + GMLPGLLYN  ++H+  T  ++ SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T +   H  F+  L
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFL  141



>ref|XP_009113344.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLEL  144



>emb|CDY39927.1| BnaA09g15090D [Brassica napus]
Length=496

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKNWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLEL  144



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLP L+  A+ LH   T++ + +GGTF FKGP   N+D L+T DPANIHHI+S NF N+P
Sbjct  1    MLPNLILYANWLHDNCTNVARLAGGTFLFKGPWFFNMDTLLTVDPANIHHIMSGNFPNFP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            KGP+F+++FDVLGDGIFN D  LW+  RKTT    NH  FH  L
Sbjct  61   KGPKFKEMFDVLGDGIFNADMDLWKSQRKTTRFLINHHRFHQFL  104



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C+  +++   S   +P+ W +VGMLP L  N   +H +VT  L+ S G F F+  
Sbjct  10   FLATICFAFLRLLGKSHDGLPQNWPLVGMLPALFLNLGSVHDWVTSFLERSRGNFLFRFH  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDVWRMQRRVAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   F   L
Sbjct  130  VFMNDQRFCQFL  141



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
            A+P  W +VGM P ++ + HR H  +T++++E G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIVGMTPSVVTHIHRSHDRITEVIQEVGSTFFFKGVWFSGMDFLLTADPSNIHH  93

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +   F   LE
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDEKFLQFLE  148



>ref|XP_009605621.1| PREDICTED: cytochrome P450 86B1 [Nicotiana tomentosiformis]
Length=150

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 83/132 (63%), Gaps = 2/132 (2%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F+  FC++ + +    R++    W  +GM P L+ + HR+H+   +IL  + GTF  KG 
Sbjct  16   FVAIFCFIVLALRG--RNSYGWNWPFLGMFPSLILHIHRIHERSVEILSITKGTFLIKGL  73

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+D+L T DPAN+H+I+S NF+N+PKG + ++IFDVLGDGIFN D+ LW+  RK   
Sbjct  74   WFTNMDILGTVDPANVHYIMSANFTNFPKGRELKKIFDVLGDGIFNSDTVLWKNQRKLAR  133

Query  477  SFFNHAHFHSLL  512
            +   H  FH  L
Sbjct  134  ALIIHEKFHKCL  145



>ref|XP_006405349.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
 gb|ESQ46802.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
Length=544

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 82/127 (65%), Gaps = 3/127 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  308
            FCY    +   +  + P  W V+GMLPG+L   HR + F  ++L+ S  TF+FKG     
Sbjct  52   FCY---SLIQKTLKSYPWNWPVLGMLPGVLVRLHRSYAFGVEVLESSNLTFQFKGLWFAG  108

Query  309  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  488
            +DML+T DPANI++IL+ NFSNY KGP+F++IF+  GDGI N DS+LW   RK   + FN
Sbjct  109  MDMLVTVDPANINYILTSNFSNYIKGPEFKEIFEAFGDGILNTDSELWRELRKVAQATFN  168

Query  489  HAHFHSL  509
            H  + +L
Sbjct  169  HQAYPNL  175



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F    L TN+
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNM  150



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F    L TN+
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNM  150



>ref|XP_009132532.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=498

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W V+GMLPGLL   HR+H ++T +L+ +  TF FKGP     D+L+T DP N+H+ILS +
Sbjct  37   WPVLGMLPGLLLQIHRIHDWLTQVLEAANMTFRFKGPWRSGTDILVTVDPVNVHYILSSH  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            F NYPKG +F++IF+ LGDGIFNVDS LWE  R ++ + F++  F S
Sbjct  97   FVNYPKGEEFQKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSNKDFQS  143



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            F+  F ++      ++++ +PR +  +GM P LL N HR+H+ +T++L ++GGTF  KGP
Sbjct  16   FIAIFFFLVFWAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKTGGTFLLKGP  75

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
               N+DML T DP N+H+I+S N SN+PKGP+F++IFD  GDGIFN D  LW+   K   
Sbjct  76   WFTNMDMLGTVDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDGIFNSDFDLWKKQSKYAK  135

Query  477  SFFNHAHFHSLL  512
                +  +H  L
Sbjct  136  ELVINQKYHKCL  147



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F 
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQ  157



>emb|CDY53177.1| BnaA06g40560D [Brassica napus]
Length=518

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F 
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQ  157



>ref|XP_006404644.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
 gb|ESQ46097.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
Length=513

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +PR W ++GMLPG++   HR++ ++ +IL+ S  TF FKGP    ++MLIT DPAN+ H+
Sbjct  31   LPRNWPLLGMLPGVVVMLHRINGYLAEILEVSNLTFVFKGPWFSGMNMLITADPANVQHV  90

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
             S NFSNY KG +F+++FD LG+GIF  DS+LWE  R+++L   +H  F S
Sbjct  91   FSSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSLVMLSHQGFQS  141



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 2/142 (1%)
 Frame = +3

Query  105  MIFSFLGCFCYMKMKMESSSR-SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            +I +FL  F +    +   SR S + + W ++GMLPGLL    R+     ++L+ S  TF
Sbjct  10   VIIAFLSFFVFQCFFLHKKSRESPLLKNWPILGMLPGLLVRIPRIFDCTAEVLEASNLTF  69

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
              KG  L   D+L+T DP NI+HILS NF NYPKGP+FR+IFD+LGDGI   DS+LWE  
Sbjct  70   AIKGAWLSGTDLLLTADPRNINHILSSNFRNYPKGPEFRKIFDILGDGILAADSELWEDL  129

Query  462  RKTTLSFFNHAHFHSL-LETNV  524
            RK+  + F+H     + L +NV
Sbjct  130  RKSGHTIFHHQDILEISLSSNV  151



>emb|CDY39926.1| BnaA09g15080D [Brassica napus]
Length=496

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKL  144



>ref|XP_009113345.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKL  144



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +3

Query  156  SSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDP  335
            S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T DP
Sbjct  31   SNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLTADP  90

Query  336  ANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            +N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH  LE
Sbjct  91   SNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHKFLE  150



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +3

Query  156  SSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDP  335
            S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T DP
Sbjct  31   SNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLTADP  90

Query  336  ANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            +N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH  LE
Sbjct  91   SNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHKFLE  150



>gb|KDP35256.1| hypothetical protein JCGZ_09415 [Jatropha curcas]
Length=216

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +3

Query  120  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            L   CY  +    S+R  +   W  VGMLP LL + H  H +  D ++ SGGTF FKGP 
Sbjct  11   LAAICY-SIGFWLSNRRELIWNWPFVGMLPSLLAHVHDFHVWSKDKIERSGGTFLFKGPW  69

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  473
            L N+DM+ TCDPAN+ HI+S  F  YPKG +FR++F++ GDG+FN DS LW+  RK  
Sbjct  70   LTNMDMIGTCDPANVKHIMSTKFHKYPKGHEFREMFEIFGDGLFNSDSDLWKHQRKIA  127



>ref|NP_195910.1| cytochrome P450, family 96, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
 emb|CAB86044.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED90533.1| cytochrome P450, family 96, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
Length=480

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W V+GMLPGLL   HR++ F  ++L+ S  TF FKGP    +DML T DP NIHHI+S N
Sbjct  26   WPVLGMLPGLLLEFHRIYDFSVEVLENSDLTFPFKGPWFTGMDMLFTVDPTNIHHIMSSN  85

Query  366  FSNYPKGPQFRQIFDVLGDGIFNV-DSQLWEFHRKTTLSFFNHAHFH  503
            FSNY KGP F+Q+FDV GDGI    DS+LW+  +K +L   NH  F 
Sbjct  86   FSNYTKGPDFKQVFDVFGDGILTTDDSELWKNLKKASLVMLNHQGFQ  132



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +3

Query  156  SSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDP  335
            S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T DP
Sbjct  31   SNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLTADP  90

Query  336  ANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            +N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH  LE
Sbjct  91   SNVNHILSIHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHKFLE  150



>emb|CDX72690.1| BnaC07g47120D [Brassica napus]
Length=507

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRVHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK++ +  +H  F 
Sbjct  110  SNFSNYIKGPGLQEIFDVYGDGIFTTDSEMWKNLRKSSQAMLHHQEFQ  157



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S NF+NYP
Sbjct  1    MLPGFLMEISRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSNFANYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            KG +F+++FDVLGDGIFN DS+LW+  R++  S  ++  + 
Sbjct  61   KGSEFKKLFDVLGDGIFNADSKLWKDLRQSAQSIMSNPEYQ  101



>gb|KFK40984.1| hypothetical protein AALP_AA2G070000 [Arabis alpina]
Length=493

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F    CF   K      +   +   W V+GMLPGL+    R++ ++T++L+ +  TF
Sbjct  3    FVFFIVFQCFLLHK-----KTHKPLVTNWPVLGMLPGLILQVPRIYDWITEVLEATDMTF  57

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
             FKGP L   D+L T DPANI +ILS NF NYPKG + ++IF+VLGD IFNVDS+LWE  
Sbjct  58   CFKGPWLSGTDILATVDPANIQYILSSNFVNYPKGIESKKIFEVLGDSIFNVDSELWEDM  117

Query  462  RKTTLSFFNHAHFHSL  509
            R ++ + F+H  F  +
Sbjct  118  RSSSHAIFSHQEFQKI  133



>emb|CDX76962.1| BnaC08g35480D [Brassica napus]
Length=510

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W ++GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DPAN+ H+ 
Sbjct  32   PRNWPILGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F S
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQS  141



>ref|NP_001117509.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 gb|AEE33459.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=436

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  468  TTLSFFNHAHFHS  506
            +     NHA FH+
Sbjct  130  S-----NHALFHN  137



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIF  407
            HR H+ +T +L E GGT+  +GP    +++L T DPANI HI S+ FSNYPKG +FR  F
Sbjct  2    HRAHEKITQVLNERGGTYLLRGPWFFRIEILFTSDPANIQHIFSKRFSNYPKGTEFRNKF  61

Query  408  DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNVWH  530
            ++LGDGIF+ D ++WE  R+T LS  +HA FH+ LE NVW 
Sbjct  62   EILGDGIFSSDFEMWELQRRTILSLISHAKFHTSLERNVWE  102



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  108  IFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  284
            +F  +GC +C+ +     SSR+          ML  L+ N H+LH+F T +LK+S GT E
Sbjct  15   LFILIGCLWCFKR-----SSRTR---------MLSTLVLNTHQLHEFATRVLKKSRGTLE  60

Query  285  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  464
            FKGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  R
Sbjct  61   FKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQR  120

Query  465  KTTLSFFNHAHFHSLLETNVWH  530
            K   S   H  F S LE  ++ 
Sbjct  121  KMIHSVMKHKKFESALEKTIYQ  142



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDIL-KESGGTFEFKGPVLGNLDMLITCDPANIH  347
            A+   W V+GMLP LL +  R+H   T+I+ K   GTF F+GP L ++DM+ T DP N+H
Sbjct  27   ALAWNWPVIGMLPTLLLHVSRIHDNCTEIMGKSRRGTFHFRGPWLADMDMMGTADPENVH  86

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +I+S NF N+PKGP+FR+IFDVLGDGIFN DS+ W   R+   +  +H  F   L
Sbjct  87   YIMSANFQNFPKGPKFREIFDVLGDGIFNADSESWRDQRRVARALISHHGFLRFL  141



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI + N
Sbjct  33   WPVVGMLPGLLFKAQNIHEYATRLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTTN  92

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++
Sbjct  93   FVNYPKGPEYKKIFEPYGDGVLNSDFESWKSFRKLIHSMIKDNKFQVSLERSL  145



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C++   +   S   +P+ W +V MLP L  N  R H + T +L++S   F F+ P
Sbjct  10   FLAAICFVVFHLLGKSHDGLPKNWPLVRMLPALFLNLGRAHDWGTSVLEQSRCNFFFRSP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                +D+L+  DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVAADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRAQRRDAQ  129

Query  477  SFFNHAHFHSLL  512
             F N   F   L
Sbjct  130  VFMNDQRFCRFL  141



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+     +   F    L TN+
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQCMMSRPEFQRFTLRTNM  150



>gb|KFK22353.1| hypothetical protein AALP_AAs42226U000100 [Arabis alpina]
Length=466

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W V+GMLPG+L    R++ ++ ++L+ +  T+ F+GP L  +D+L T DP NIH+ILS N
Sbjct  3    WPVLGMLPGMLIQLPRIYDWLAEVLQATDMTYPFRGPWLSVMDILFTVDPENIHYILSSN  62

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL-LETNV  524
            F NYPKG +F++IFD+LGD IFNVDS+LWE  R +  + F+H  F    ++T+V
Sbjct  63   FVNYPKGVEFKEIFDILGDAIFNVDSELWEDMRNSAHAIFSHQDFQKFSVDTSV  116



>ref|NP_176086.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 sp|Q9FVS9.1|C96AF_ARATH RecName: Full=Alkane hydroxylase MAH1; AltName: Full=Cytochrome 
P450 96A15; AltName: Full=Protein MID-CHAIN ALKANE HYDROXYLASE 
1 [Arabidopsis thaliana]
 gb|AAG50737.1|AC079733_5 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAL31942.1|AF419610_1 At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AAM13991.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64745.1| At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AEE33458.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=497

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  468  TTLSFFNHAHFHS  506
            +     NHA FH+
Sbjct  130  S-----NHALFHN  137



>ref|NP_176713.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAC27155.1| Similar to cytochrome P450 gb|X90458 from A. thaliana [Arabidopsis 
thaliana]
 gb|AEE34360.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=503

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPGLL    R++ ++T++L+ +  TF FKGP L  +D+L+T DP NIH+ILS N
Sbjct  37   WPALGMLPGLLLQVPRIYDWITEVLEATDMTFCFKGPCLSGMDILLTVDPVNIHYILSSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            F+NYPKG +F++IF+V+GD IFNVDS LWE  R ++ + F++  F 
Sbjct  97   FANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQDFQ  142



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 6/148 (4%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MAS +LL   +  +   F  CF + K K E+       R W V+GM+PG L   HR++ F
Sbjct  1    MASISLLDASIAIVCLVFFQCFFFKKPKNEAF------RNWPVLGMIPGFLLVLHRIYNF  54

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
              + L+ +  TF FKGP    +DML T DPANIH+ILS NFSNY KG  F+++FDV G+ 
Sbjct  55   GVETLEATDLTFFFKGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEM  114

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            IF+ DS+LW+  RK      NH  F  L
Sbjct  115  IFSSDSELWKNQRKAAQFMLNHQGFQKL  142



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
            A+P  W ++GM P ++ + +R H  +T++++E+G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWFSGMDFLLTVDPSNIHH  93

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +  +F   LE
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDENFLQFLE  148



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  171  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  350
             IP  W V+GM+P +++N +R+H  +T+IL+++  TF F G    N   L+T DP+NIHH
Sbjct  32   GIPWNWPVLGMIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHH  91

Query  351  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHF  500
            I+S NF NYPKGP+F+ IFDVLGDGIFN DS  W+  RK   S   H  F
Sbjct  92   IMSTNFQNYPKGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQSLIVHEKF  141



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +3

Query  120  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            L CF  +  ++  + R  +P  W VVG LP +  NA R+H++VT+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFRRL--NQRDGLPTNWPVVGALPAITVNAGRMHEWVTEFLRAAGLSYVMKGPW  78

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
               +D+++T DPAN+ H+ + NF NYPKG +F  +FDVLGDGIFN D + W F R+   +
Sbjct  79   GSPVDVIMTADPANVAHVFTSNFGNYPKGQEFAALFDVLGDGIFNADGESWAFQRRKAHA  138

Query  480  FFNHAHFHS  506
              + A F +
Sbjct  139  LLSDARFRA  147



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 80/141 (57%), Gaps = 13/141 (9%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            +F  +GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFILIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  468  TTLSFFNHAHFHSLLETNVWH  530
               S   H  F S LE  ++ 
Sbjct  113  MIHSVMKHNKFESALEKTIYQ  133



>emb|CDX83711.1| BnaC07g24510D [Brassica napus]
Length=222

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPGLL   HR++ F  ++L+ S  TF+FKGP+L  +DML+T DPANIH++LS NF NY 
Sbjct  1    MLPGLLMVLHRIYDFTVELLENSNLTFQFKGPLLSGMDMLVTVDPANIHYMLSSNFLNYN  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            KGP+F++IFDV  D IFNVD++LW   RK       H  F  L
Sbjct  61   KGPEFKEIFDVFKDVIFNVDAELWYNSRKAAEGILRHQGFARL  103



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPA  338
            ++  I   W ++GMLP LL++  R+H   T+IL+ +  GTF FKGP    +++L T +PA
Sbjct  20   NKKRIAWNWPLIGMLPALLHHVGRIHDGCTEILRRTRRGTFHFKGPWFSGMEILGTVNPA  79

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            N+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D+  W   R+    F +H  FH  L
Sbjct  80   NVHYIMSANFHNFPKGPKFREIFDVLGDGIFNSDADSWRHQRRAARGFLSHRRFHRFL  137



>ref|XP_006392373.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
 gb|ESQ29659.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
Length=444

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPG+L    R++ +  ++L+ +  TF FKGP     DML T DP NIHHIL+ N
Sbjct  37   WPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGTDMLFTADPKNIHHILNSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            F NYPKGP+F++IFDVLGDGI   DS+LWE  RK+  + F+H  F +L
Sbjct  97   FGNYPKGPEFKKIFDVLGDGILTADSELWEELRKSNNTIFHHQDFMNL  144



>ref|XP_006392374.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
 gb|ESQ29660.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
Length=497

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  186  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  365
            W  +GMLPG+L    R++ +  ++L+ +  TF FKGP     DML T DP NIHHIL+ N
Sbjct  37   WPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGTDMLFTADPKNIHHILNSN  96

Query  366  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            F NYPKGP+F++IFDVLGDGI   DS+LWE  RK+  + F+H  F +L
Sbjct  97   FGNYPKGPEFKKIFDVLGDGILTADSELWEELRKSNNTIFHHQDFMNL  144



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F + S L   C+    +   + +  P  W  +GMLP LL   H+++ +  D+L+ S  TF
Sbjct  25   FFLISLLAI-CFFFFFINKKTHAVFPTNWPFLGMLPALLQMLHQIYDYSADLLESSNMTF  83

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
              KGP    +DMLIT DPANIHHI+S NF NY KGP+F ++F+V G+ IFN DS LW+  
Sbjct  84   LLKGPWFAGIDMLITVDPANIHHIMSSNFLNYTKGPEFNEVFEVFGEAIFNTDSDLWKDK  143

Query  462  RKTTLSFFNHAHFH  503
            RK+     NH  F 
Sbjct  144  RKSAQVMLNHHGFQ  157



>ref|XP_002894690.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70949.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            I + W  +GMLPG+L    R++ +  ++L+ S  TF FKGP L   DML T DP NI+HI
Sbjct  35   ILKNWPFLGMLPGMLPQIPRIYDWTVEVLEASNLTFYFKGPWLSGTDMLFTADPKNINHI  94

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            LS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK+     NHA FH+
Sbjct  95   LSSNFGNYPKGPEFKKIFDVLGEGILTVDLELWEDLRKS-----NHAMFHN  140



>ref|XP_002322211.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
 gb|EEF06338.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
Length=508

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            +RS++   W VVGMLPGL  N+ R+H+FVT +L++ GGTF FKGP  G LD L+T +PAN
Sbjct  21   NRSSVIINWPVVGMLPGLFRNSSRVHEFVTYVLRQCGGTFVFKGPWFGGLDFLVTSNPAN  80

Query  342  IHHILSRNFSNYPKGPQFRQIF-DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            +HHIL +   NY KG +F++IF +  G+GIF  D   W+  R+T  SF  ++ F    E 
Sbjct  81   VHHILRKKAFNYHKGLEFKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAAER  140

Query  519  NV  524
            N+
Sbjct  141  NI  142



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +3

Query  120  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  299
            L CF  +  +++   R  +P  W VVG+LP +  NA R+H+++T+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFHRLKR--RDGLPTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLSYVIKGPW  78

Query  300  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  479
               +D+++T DPAN+ H+ + NF NYPKG +F ++FDVLGDGIFN D   W F R+   +
Sbjct  79   GSPVDVIVTADPANVAHVFTANFGNYPKGEEFAELFDVLGDGIFNADGDSWAFQRRKAHA  138

Query  480  FFNHAHFHS  506
              + A F +
Sbjct  139  LLSDARFRA  147



>gb|KEH22137.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L  F ++ +   S +R+    KW V+GMLPGLLYN   +H ++  +LK++GGTF F+GP
Sbjct  10   LLAVFLFLAIHYWSLNRNTPITKWPVLGMLPGLLYNMSNIHDYLNLVLKQNGGTFIFEGP  69

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
             L N+++L T DP N+ HI S  F NY KG  F +IF++LGDGIF  DS +W+++R    
Sbjct  70   WLTNMNILCTSDPMNVQHITSTKFENYGKGNDFSEIFEILGDGIFRSDSHIWKYNRTLLH  129

Query  477  SFFNHAHFHSLLETNV  524
            S F    F   +   +
Sbjct  130  SIFKKESFQVFIHKTI  145



>ref|XP_009117361.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
 emb|CDY63371.1| BnaA09g55910D [Brassica napus]
Length=510

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W V+GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DP N+ H+ 
Sbjct  32   PRNWPVLGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPENVQHVF  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F S
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQS  141



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            +R+    KW V+GMLPGLL+N   +H +V   LK++GGTF F+GP L N+++L T DP N
Sbjct  25   NRNTPMTKWPVLGMLPGLLHNVSNIHGYVDLTLKQNGGTFIFEGPWLTNMNILCTSDPMN  84

Query  342  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETN  521
            + HI S  F NY KG  FR+IF+VLG+GIF  DS +W+++RK   S F   +F   ++  
Sbjct  85   VQHITSTKFENYGKGNDFREIFEVLGEGIFRSDSHIWKYNRKLLHSIFKQGNFQVFIQKT  144

Query  522  V  524
            V
Sbjct  145  V  145



>ref|XP_010444891.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=214

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R W V+GM+PG L   HR++ F  +I + +  TF F GP    +DML T DPANIH+ILS
Sbjct  33   RSWPVLGMIPGFLLELHRIYDFGVEIFETADLTFLFTGPWFTGMDMLFTVDPANIHYILS  92

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQYMLNHQGFQKL  142



>emb|CDY13727.1| BnaA06g31960D [Brassica napus]
Length=463

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  347
            S I   W ++GMLPGL    HR++ F  ++L+ S  TF+FKGP L  +DML T DPANIH
Sbjct  25   SFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNLTFQFKGPWLSGMDMLATVDPANIH  84

Query  348  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHF  500
            ++LS NF NY KGP+F++IFDV  D IFNVD++LW   RK       H  F
Sbjct  85   YMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWYNSRKAAEGILRHQGF  135



>emb|CDY58383.1| BnaC09g51620D [Brassica napus]
Length=496

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    I + W V+GMLPG+L +  R+  +  ++L+ +  TF FKGP     DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFDWTFEVLEATNLTFFFKGPWFSGTDMLFTAD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKL  144



>gb|KJB44331.1| hypothetical protein B456_007G246400 [Gossypium raimondii]
Length=507

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 10/153 (7%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA  ++   +L  + F FL C       + + +RS  P+ + +VGMLP L+ N HR+H +
Sbjct  1    MALVSVFEAVLALICFLFLCC-------LRNKNRS--PKSFPIVGMLPELILNIHRIHDW  51

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
             T+  +    TF F GP    +++L TCDPAN+H+I+S NF+N+PKGP+F+Q+FDVLGDG
Sbjct  52   CTETFERCHYTFLFNGPWFAKMNILGTCDPANVHYIMSSNFNNFPKGPEFKQLFDVLGDG  111

Query  426  IFNVDSQLWEFHRKTTLSFF-NHAHFHSLLETN  521
            IFN D  LW   R     F  NH     LL T 
Sbjct  112  IFNTDMDLWRKQRIVAQEFMRNHLFLKFLLMTT  144



>ref|XP_010511352.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=500

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 8/127 (6%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF ++  K   S    I + W  +GMLPG+L    R++ +  ++L+ +  TF FKGP L 
Sbjct  23   CFFFLHQK---SQGHPILKNWPFLGMLPGMLPQIARIYDWTVEVLEATNLTFCFKGPWLS  79

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +DML T DP NI++ILS NF NYPKGP+F++IFD LGDGI +VD +LWE  RK+     
Sbjct  80   GMDMLFTADPRNINYILSSNFGNYPKGPEFKKIFDALGDGILSVDLELWEDLRKS-----  134

Query  486  NHAHFHS  506
            NHA FH+
Sbjct  135  NHAIFHN  141



>ref|XP_009151941.1| PREDICTED: cytochrome P450 86A7-like [Brassica rapa]
Length=518

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MIFSFLGCFCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  275
            M F  +   C++ +    ++  + S I   W ++GMLPGL    HR++ F  ++L+ S  
Sbjct  1    MAFICIPIVCFLILLHFFIKKPNMSFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNL  60

Query  276  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  455
            TF+FKGP L  +DML T DPANIH++LS NF NY KGP+F++IFDV  D IFNVD++LW 
Sbjct  61   TFQFKGPWLSGMDMLATVDPANIHYMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWY  120

Query  456  FHRKTTLSFFNHAHF  500
              RK       H  F
Sbjct  121  NSRKAAEGILRHQGF  135



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = +3

Query  129  FCYMKM-KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            FC M      +  R  I   + ++GMLP LL+N  R H F T++LK+ GGT EF GP   
Sbjct  16   FCIMYFFHRRACCRYPILTDYPILGMLPQLLFNLSRCHDFFTEVLKQKGGTGEFTGPWFT  75

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
            N++ L+T DP N+HHI+S++F NY KGP FR IF+  G+GIF  DS+ W+++R    S F
Sbjct  76   NMNYLVTSDPLNVHHIMSKSFHNYVKGPVFRDIFEAFGEGIFTADSETWKYNRDLFHSLF  135

Query  486  NHAHFHSLLETNV  524
                F   LE  +
Sbjct  136  KQKSFEMFLEKTI  148



>emb|CDX84084.1| BnaC08g07610D [Brassica napus]
Length=359

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            MLPGLL + +R++  + ++L+ S  TF FKGP L   D+LIT DPANI +ILS NF NYP
Sbjct  1    MLPGLLVHINRIYDAIAELLEASNMTFCFKGPWLSGTDILITVDPANIRYILSSNFDNYP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            KG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F 
Sbjct  61   KGTEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQ  101



>ref|XP_004151191.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=481

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLE  148



>ref|XP_010274128.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=525

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
             L   C++ ++     ++ I  +W ++ +LP LL NAHR+H +  +I  + G T E +GP
Sbjct  21   LLALVCFLSIRWYRKHKNEISLRWPILDVLPTLLLNAHRIHSWTVEIANKFGSTIEGRGP  80

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
            V G LD+L TCDP N+ ++L  NF+N+PKGP+  + F++LGDGIFNVD  LW   R+   
Sbjct  81   VFGRLDILFTCDPRNVEYMLKTNFANFPKGPELIEAFNILGDGIFNVDYDLWREQRRMAN  140

Query  477  SFFNHAHFHSLL  512
              F    F + +
Sbjct  141  VNFASKDFRNFV  152



>gb|KFK30522.1| hypothetical protein AALP_AA7G273500 [Arabis alpina]
Length=506

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF   +  +         R W V+GMLPG L   HR++ F  ++L+++  TF FKGP   
Sbjct  15   CFLIFRFLIFKKPHDRFLRNWPVLGMLPGFLMVLHRIYDFSVEVLEKTDLTFPFKGPWFT  74

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +D+L+T DPANIH+ILS NFSNY KG  F+++F+V G+ IFN D++LW+  RK      
Sbjct  75   GMDLLVTVDPANIHYILSSNFSNYTKGADFKEVFEVFGEMIFNSDAELWKNQRKAAQFML  134

Query  486  NHAHFHSL  509
            NH  F  L
Sbjct  135  NHQGFQKL  142



>ref|XP_006651021.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=506

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 83/149 (56%), Gaps = 4/149 (3%)
 Frame = +3

Query  66   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  245
            MA A  L L L F+ FS    F Y  M  +  SR AIP  W +VGMLP LL N HR+H +
Sbjct  1    MAFACTLHLALCFLCFSV---FYYHHMVSKRKSR-AIPLCWPLVGMLPELLANRHRIHGW  56

Query  246  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  425
            +T +L  S   F F GP   ++ + ITCDPAN+ H+ + NF NYPKGP F +IFD+ G G
Sbjct  57   ITSLLAVSKLNFRFTGPTSSSMRLFITCDPANVRHVFTSNFCNYPKGPDFAEIFDIFGGG  116

Query  426  IFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            IFNVD   W   R           F + +
Sbjct  117  IFNVDGDAWRRQRAKAQLLMCRPQFRAFV  145



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLE  148



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLE  148



>emb|CDX72691.1| BnaC07g47130D [Brassica napus]
Length=243

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF  +   +        PR W VVGMLP LL + H+L+ +  +IL+ S  TF FKGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVVGMLPRLLVSLHQLYDYGVEILEISDLTFLFKGPRFF  74

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +DML T DPANI HI+S NFSNY KG  F+ +FDV GDGI   DS+LW+  RK+  +  
Sbjct  75   GMDMLFTVDPANILHIMSSNFSNYIKGSDFQDVFDVFGDGIITTDSELWKNLRKSYQAMV  134

Query  486  NHAHFH  503
            +H  F 
Sbjct  135  HHQEFQ  140



>ref|XP_006392376.1| hypothetical protein EUTSA_v10023422mg [Eutrema salsugineum]
 gb|ESQ29662.1| hypothetical protein EUTSA_v10023422mg [Eutrema salsugineum]
Length=496

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S    + + W  +GMLPG+L    R++ +  ++L+ +  TF FKGP    +DML T D
Sbjct  24   KKSQGQPVLKNWPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGMDMLFTAD  83

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NI HIL+ NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F +L
Sbjct  84   PRNIQHILNSNFGNYPKGPEFKKIFDVLGDGILSVDLELWEELRKSNHAIFHHQDFLNL  142



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            RKW V+GMLP LL   HR++++  +I++ S  TF+FKGP    +DML T DPANIHHI+S
Sbjct  33   RKWPVLGMLPSLLMVLHRMYEYGIEIMEFSDLTFQFKGPWFVGMDMLFTVDPANIHHIMS  92

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
             NF NY KGP F+ +FDV GDGI   DS+LW+  RK+  +  +H  F 
Sbjct  93   SNFPNYIKGPDFQDVFDVFGDGIITTDSELWKDLRKSYQAMVHHQGFQ  140



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = +3

Query  129  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  308
            F Y+  K    +  + P  W V+GMLPG+L   HR++ F  ++L+ S  TF+FKGP    
Sbjct  28   FSYLLTK---KTLGSYPWNWPVLGMLPGILLRLHRIYDFSVEVLENSNLTFQFKGPWFVA  84

Query  309  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  488
            +D L T DPAN+HHI+S NFSNY KGP F +IF+  GDGI N DS+LW   R +    FN
Sbjct  85   MDALATVDPANVHHIMSSNFSNYIKGPIFHEIFEAYGDGIINSDSELWRNWRNSAQIIFN  144

Query  489  HAHFHS  506
            H  + +
Sbjct  145  HQRYQN  150



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            + SF+ CF +     +   RS +P  W V GMLPGLL    R++ +   +++E G TF F
Sbjct  14   LLSFV-CFVFCYYFCQIFRRSNVPVNWPVAGMLPGLLLRCRRIYDWGACLVREVGCTFVF  72

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            +GP L  ++ ++TCDPAN+ HI S  FSNYPKG +F +IFDVLGDGIFN D +LW+  R 
Sbjct  73   RGPWLLGMNYVLTCDPANLQHIFSAGFSNYPKGEEFSEIFDVLGDGIFNSDGELWKKQRM  132

Query  468  TTLSFFNHAHFHSLL  512
                  +   F S +
Sbjct  133  RAHGLISSRSFRSFV  147



>dbj|BAA99522.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 gb|EAZ10814.1| hypothetical protein OsJ_00649 [Oryza sativa Japonica Group]
Length=510

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  108  IFSFLGCFCYMKM--KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            IF  + CF +  +   +    +S +P  W V GMLP L+ N H +H  V D+L+E+G TF
Sbjct  14   IFLAIICFFWFSLFRPIRQRQKSNLPVNWPVFGMLPFLVQNLHYIHDKVADVLREAGCTF  73

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
               GP   N++ LITCDPA ++H  + NF NYPKG +F ++FD+LGDG+   DS+ WE+ 
Sbjct  74   MVSGPWFLNMNFLITCDPATVNHCFNANFKNYPKGSEFAEMFDILGDGLLVADSESWEYQ  133

Query  462  RKTTLSFFNHAHFHSLLETNV  524
            R+  +  F    F S   + +
Sbjct  134  RRMAMYIFAARTFRSFAMSTI  154



>ref|XP_010414809.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=495

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S +S + + W  +GM+PGL+   HR++ ++ + L+ S     FKG      D+L+T D
Sbjct  27   KKSHKSPLFKNWPFLGMIPGLVVEIHRIYDWMVEALEASDLNLVFKGAWFTGTDLLLTAD  86

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P NIHHILS NF NYPKGP+F++IFD+LGDGI   DS+LWE  RK+  + F+H  F  L
Sbjct  87   PRNIHHILSSNFQNYPKGPEFKKIFDILGDGIVAADSELWEDLRKSNHTLFHHKDFLEL  145



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  183  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  362
            ++  VGMLP +L N    H + T +LK+ GGT EF GP   N++ L+TCDP N+HH+LS+
Sbjct  34   EYPFVGMLPQVLCNLWHAHDYSTQVLKQHGGTAEFGGPWFTNMNYLVTCDPLNVHHMLSK  93

Query  363  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            NF NY KGP+FR IF   GDGIF  D + W++ R    S F H  F  LLE  +
Sbjct  94   NFHNYVKGPEFRDIFQAFGDGIFTADGEAWKYSRDLFHSLFKHKSFEVLLEKTI  147



>emb|CDY70656.1| BnaAnng34510D [Brassica napus]
Length=298

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F    CF   K     S   A+   W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFVCK----KSHNVALLENWPFLGMLPGILFNLPRIFDWLSEVHEANDMTF  68

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IF++LGDGI   D +LWE  
Sbjct  69   AFKGPWFSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFEILGDGIVAADMELWEDL  128

Query  462  RKTTLSFFNHAHFHSL  509
            RK+  + F+H +F  L
Sbjct  129  RKSGHALFHHQNFLKL  144



>ref|XP_010653011.1| PREDICTED: cytochrome P450 86B1-like [Vitis vinifera]
Length=478

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W +VGMLP +L + H +H+  T IL+ S GT   KG    N+DML T +P N+HH+L
Sbjct  3    PRNWPIVGMLPMILLHFHCMHEKYTKILELSKGTILIKGAWFANIDMLTTSNPDNVHHVL  62

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            S NFSNYPKGP+FR+IF++LG+G+FN D   W   R     F NH  FH  +
Sbjct  63   STNFSNYPKGPKFRRIFNILGNGLFNSDFDEWRKIRGLAQGFVNHKQFHRFM  114



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            +  I  ++ ++GMLP LL+N  R H + T +L+  GGT EF GP   N+D L+TCDP N+
Sbjct  26   KHPILTEYPIIGMLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINV  85

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLETNV  524
            HH+LS+NF NY KGP+FR IF   GDGIF  DS+ W++ R    S F    F   +   +
Sbjct  86   HHMLSKNFHNYVKGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTI  145



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W V+ MLP +L   HR++ +  +IL+ S  TF FKGP    +DML+T DPANIHHI+
Sbjct  32   PRNWPVLRMLPAMLKALHRIYDYSVEILETSDLTFPFKGPRFTGMDMLLTVDPANIHHIM  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  +   F 
Sbjct  92   SSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQ  140



>gb|EMT14219.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=512

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            +S +P  W V+GMLP L+ N +++H  VTD+L+E+G TF   GP   N+  L TCDPA +
Sbjct  35   KSDLPVNWPVIGMLPFLVRNLYQIHDSVTDMLREAGCTFRIIGPWFLNMSFLATCDPATV  94

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            +H  + NF+NYPKG +F ++FD+LGDG+   DS+ WE+ R+  +  F    F S
Sbjct  95   NHCFNTNFNNYPKGSEFAEMFDILGDGLLVADSESWEYQRRVAMQVFASRAFRS  148



>ref|XP_002868908.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45167.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
Length=994

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +3

Query  159  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
            ++   +PR W V+GMLP LL    R++ ++ +IL+ S  TF FKGP+   +DML+T DPA
Sbjct  511  TTHGRLPRNWPVLGMLPCLLAVLRRIYDYIVEILEISDLTFSFKGPLFAGMDMLLTVDPA  570

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            NIHHI++ NFSNY KG  F+++FDV GDGI   DS LW+  RK+  +  +H  F 
Sbjct  571  NIHHIMNSNFSNYIKGSDFKEVFDVFGDGIITTDSDLWKNLRKSYQAMLHHQAFQ  625


 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R W V+GM+ G L   HR++ F  + L+ S  TF FKGP    +DML T DPANIH+ILS
Sbjct  33   RNWPVIGMI-GFLMVLHRMYNFGVEALEISHLTFPFKGPWFAGMDMLFTVDPANIHYILS  91

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L
Sbjct  92   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHHEFQKL  141



>ref|XP_003564427.1| PREDICTED: cytochrome P450 86B1-like [Brachypodium distachyon]
Length=511

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +3

Query  117  FLGCFCYMKMKM----ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  284
            FL   C+  + +         SAIP  W VVGMLP L+ N + +H  V D+L+E+G TF 
Sbjct  15   FLAIICFFCLSLFRLIRQCQESAIPVNWPVVGMLPFLVRNLYNIHDKVADMLREAGCTFM  74

Query  285  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  464
              GP   N++ L TCDPA ++H  + NF NYPKG +F ++FD+LGDG+   DS+ WE+ R
Sbjct  75   IIGPWFLNMNFLSTCDPATVNHCFNTNFKNYPKGSEFAEMFDILGDGLLVADSESWEYQR  134

Query  465  KTTLSFFNHAHFHS  506
            +  +  F    F S
Sbjct  135  RVAMLVFASRAFRS  148



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  201  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  380
            M  GLL++ HR+H    +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+P
Sbjct  1    MFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFP  60

Query  381  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            KG +FR++F+VLGDGIFN D + W   RK   S  N+  FH  L
Sbjct  61   KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFL  104



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPA  338
            +R  I   W ++GMLP LL +  R+H   T+IL+ S  GTF F+GP   N+++L T +PA
Sbjct  26   NRRMIGWNWPLMGMLPTLLLHVDRIHDTCTEILRRSRRGTFRFQGPWFANMEILGTANPA  85

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            ++H+I+S NF N+PKGP FR++FDVLG+GIFN DS  W+  R+   +   H  FH  L
Sbjct  86   DVHYIMSSNFQNFPKGPVFREMFDVLGEGIFNADSDSWKHQRRAARALIGHQRFHRCL  143



>emb|CDY29171.1| BnaC09g15680D [Brassica napus]
Length=437

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = +3

Query  102  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  281
            F+ F    CF   K     S   A+ + W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFLCK----KSHNVALLKNWPFLGMLPGILFNIPRIFDWLSEVHEANDMTF  68

Query  282  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  461
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IFD+LGDGI   D +LWE  
Sbjct  69   AFKGPWYSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFDILGDGIAAADMELWEDL  128

Query  462  RKTTLSFFNHAHFHSL  509
            RK+  + F+H +F  L
Sbjct  129  RKSGHALFHHQNFLKL  144



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG      D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHHI  94

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLE  515
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H  F   LE
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKSQRKTAHHLVRHESFLQFLE  148



>emb|CDY39928.1| BnaA09g15100D [Brassica napus]
Length=496

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 80/133 (60%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  290
             SFL   C   +K   S    I + W   GMLPG+L +  R+  F  ++L+ +  TF FK
Sbjct  14   ISFLVFNCSFLLK--KSQSQPILKNWPFFGMLPGMLAHIPRIFDFSVEVLEATNLTFSFK  71

Query  291  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  470
            GP L   DML T DP NIHHILS NF NYPKGP+ ++IF+ LGDGI + D +LWE  RK+
Sbjct  72   GPWLSGTDMLFTADPWNIHHILSLNFGNYPKGPEAKKIFNALGDGILSADMELWENLRKS  131

Query  471  TLSFFNHAHFHSL  509
              + F+H  F  L
Sbjct  132  NHAIFHHPDFLKL  144



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 80/124 (65%), Gaps = 0/124 (0%)
 Frame = +3

Query  159  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
            + +  +PR W +VGMLP  + N HR ++ + ++++ SGG+F +K     + ++L T DPA
Sbjct  24   NKKKRLPRNWPLVGMLPDSIRNLHRPYERIAEVIQLSGGSFIYKSLWFFSPNVLNTVDPA  83

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            NIH+I+S NFSN+PKG  F +IFD+LGDGIFN DS LW+  RK      NH  F   L  
Sbjct  84   NIHYIMSSNFSNFPKGSMFSRIFDILGDGIFNADSHLWKNQRKLAHVLINHQQFQRFLVK  143

Query  519  NVWH  530
            + W+
Sbjct  144  SSWN  147



>ref|XP_007150920.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
 gb|ESW22914.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
Length=457

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  338
            S R  +   + ++GMLP +L N   +H F  ++LK  GGT EF GP   NL+ L+T DP 
Sbjct  26   SCRYPLYTDYPILGMLPEVLCNLWHIHDFSAEMLKSHGGTAEFIGPWFTNLNFLVTSDPL  85

Query  339  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            N+HH+LS+NF+NY KGP+FR+IF   GDGIF  D++ W+++R    S F H  F   +E 
Sbjct  86   NVHHVLSKNFNNYIKGPEFREIFQAFGDGIFTTDAEAWKYNRDLFHSLFKHRSFEVFMEK  145

Query  519  NV  524
             +
Sbjct  146  TI  147



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            PR W V+ MLP +L   HR++ +   IL+ S  TF FKGP    +DML+T DPANIHHI+
Sbjct  32   PRNWPVLRMLPAMLKALHRIYDYSVKILETSDLTFPFKGPRFTGMDMLLTVDPANIHHIM  91

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFH  503
            S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  +   F 
Sbjct  92   SSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQ  140



>ref|XP_010555325.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=516

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF             + PR W  +GMLPGL+    R++ +  ++L+ S  TF  KG    
Sbjct  15   CFLIFHFLTNKKPHESFPRNWPFLGMLPGLIAAVPRIYDWNAELLEYSNMTFISKGIWFA  74

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             +D+L+T DP NI HI+S NF NYPKGP+F+++FD LGDGIFNVDS+LWE  RK+  +  
Sbjct  75   GMDVLVTADPDNIRHIMSSNFRNYPKGPEFKEMFDALGDGIFNVDSELWEDLRKSFQAVL  134

Query  486  NHAHFH  503
            +H  F 
Sbjct  135  HHQGFQ  140



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +3

Query  174  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  353
            +P  W ++GM P +  + HR+H  VTDIL++SG TF  KGP   N+D+L+T DPAN+H+I
Sbjct  43   LPWNWPLLGMFPSVFLHLHRIHDRVTDILEKSGCTFLVKGPWFCNMDLLVTTDPANVHYI  102

Query  354  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLL  512
            +S +FSN+PKG +F +IFD LGDGIFN D++ W   RK      N+   +  L
Sbjct  103  MSSHFSNFPKGSEFSKIFDFLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFL  155



>ref|XP_009101869.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Brassica rapa]
Length=479

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W V+GMLPG+L   HR++    ++L+ S  TF+FKGP    +D+L+T  PANIH+IL
Sbjct  24   PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  83

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            S NFSNY KGP+F++IF+  GDGI N D +LW   RK +   F+H  + +
Sbjct  84   SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQN  133



>ref|NP_195661.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
 emb|CAB44686.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80614.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAL24225.1| AT4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AAO23590.1| At4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AEE87080.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
Length=508

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  180  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  359
            R W V+GMLPG L   HR++ F  + L+ S  TF FKGP    +DML T DPANIH+ILS
Sbjct  33   RNWPVIGMLPGFLMVLHRIYNFGVEALEMSHLTFLFKGPWFAEMDMLFTVDPANIHYILS  92

Query  360  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHQGFQKL  142



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +3

Query  108  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  287
            I + L CF Y+      S +  + R + ++GMLP +L+N  R+H F T++LK+ GGT EF
Sbjct  10   ITASLFCFLYL-FHRRRSCKHPLMRDYPILGMLPPILFNLWRIHDFCTEVLKKQGGTGEF  68

Query  288  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  467
            KGP    +  LITCD  N+ H+L ++F NY KGP+FR+IF+  GDG+   DS+ W++ R 
Sbjct  69   KGPWFTKMHYLITCDSLNVQHMLCKSFDNYIKGPEFREIFEPFGDGVVTADSETWKYFRT  128

Query  468  TTLSFFNHAHFHSLLETNV  524
               S      F + ++  V
Sbjct  129  VLHSLIKQRRFETFVDKTV  147



>ref|XP_011005604.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=508

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  162  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  341
            ++S++   W VVGMLPGL  N+ R+H+FVT +L++ GGTF FKGP  G LD L+T +PAN
Sbjct  21   NKSSVIINWPVVGMLPGLFRNSSRVHEFVTYLLQQRGGTFVFKGPWFGGLDFLVTSNPAN  80

Query  342  IHHILSRNFSNYPKGPQFRQIF-DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSLLET  518
            +HHIL +   NY KG + ++IF +  G+GIF  D   W+  R+T  SF  ++ F   +E 
Sbjct  81   VHHILRKKAFNYHKGLELKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAVER  140

Query  519  NV  524
            N+
Sbjct  141  NI  142



>emb|CDY39931.1| BnaA09g15130D [Brassica napus]
Length=485

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +3

Query  153  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  332
            + S   A+ + W  +GMLPG+L+N  R+  +++++ + +  TF FKGP     DML T D
Sbjct  26   KKSHNVALLKNWPFLGMLPGVLFNLPRIFDWLSEVHEANDMTFAFKGPWFSGTDMLFTVD  85

Query  333  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHSL  509
            P N++H+LS NF NYP+GP+FR+IFD+LGDGI   D +LWE  RK+  + F+H +F  L
Sbjct  86   PRNVNHMLSSNFPNYPRGPEFRKIFDILGDGIVAADMELWEDLRKSGHALFHHQNFLEL  144



>gb|EMS62655.1| Cytochrome P450 86B1 [Triticum urartu]
Length=546

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  344
            +S +P  W V+GMLP L+ N +++H  VTD+L+E+G TF   GP   N+  L TCDPA +
Sbjct  35   KSDLPVNWPVIGMLPFLVRNLYQIHDSVTDMLREAGCTFRIIGPWFLNMSFLATCDPATV  94

Query  345  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            +H  + NF+NYPKG +F ++FD+LGDG+   DS  WE+ R+  +  F    F S
Sbjct  95   NHCFNTNFNNYPKGSEFAEMFDILGDGLLVADSASWEYQRRVAMQVFASRAFRS  148



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = +3

Query  126  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  305
            CF Y         R  +   + ++GMLP LL+N  R H + T +LK+ GGT EF GP   
Sbjct  16   CFLYF-FHRRQCCRHPLFTDFPILGMLPQLLFNLWRAHDYSTQVLKQRGGTAEFTGPWFT  74

Query  306  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  485
             ++ L+T DP N+HH++S++F NY KGP FR+IF   GDGIF  DS+ W+++R    S F
Sbjct  75   KMNCLVTGDPINVHHVMSKSFPNYVKGPVFREIFQAFGDGIFTADSEAWKYNRNLFHSLF  134

Query  486  NHAHFHSLLETNV  524
             H  F   LE  +
Sbjct  135  KHRSFEVFLEKTI  147



>ref|XP_006643842.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=510

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +3

Query  117  FLGCFCYMKMKM----ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  284
            FL   C+  + +        +  +P  W V+GMLP L+ N H +H  VTD L+E+G TF 
Sbjct  15   FLAIICFFWLSLFRLIRQCQKRTLPVNWPVLGMLPFLVKNLHYIHDKVTDALREAGCTFM  74

Query  285  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  464
              GP   N++ L+TCDPA ++H  + NF NYPKG +F ++FD+LGDG+   DS+ WE  R
Sbjct  75   VTGPWFLNMNFLVTCDPATVNHCFNANFKNYPKGSEFAEMFDILGDGLLVADSESWEHQR  134

Query  465  KTTLSFFNHAHFHSLLETNV  524
            +  +  F    F S   + +
Sbjct  135  RMAMYIFAARKFRSFAMSTI  154



>gb|KJB44293.1| hypothetical protein B456_007G244800 [Gossypium raimondii]
Length=499

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 79/132 (60%), Gaps = 2/132 (2%)
 Frame = +3

Query  117  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  296
            FL   C++ +          P+ + +VGM+P  L N  RLH + TD L+    TF FKG 
Sbjct  10   FLPLVCFLLLYCLRDKYHGPPKSFPLVGMMPQFLSNIPRLHDWFTDTLEICHCTFLFKG-  68

Query  297  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  476
                 ++L+TCDP+NIH+I+S NF+N+PKGP F+QIFD+LGDGIFNVD  LW   R    
Sbjct  69   -FAKTNVLVTCDPSNIHYIMSSNFNNFPKGPGFKQIFDILGDGIFNVDMDLWRKQRIAAQ  127

Query  477  SFFNHAHFHSLL  512
             F  H  F+  L
Sbjct  128  GFMRHQLFYRFL  139



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  177  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  356
            P  W V+GMLPG+L   HR++    ++L+ S  TF+FKGP    +D+L+T  PANIH+IL
Sbjct  41   PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  100

Query  357  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHS  506
            S NFSNY KGP+F++IF+  GDGI N D +LW   RK +   F+H  + +
Sbjct  101  SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQN  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200