BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025F14

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795808.1|  PREDICTED: uncharacterized protein LOC104242...    108   3e-25   Nicotiana sylvestris
ref|XP_009795807.1|  PREDICTED: uncharacterized protein LOC104242...    108   3e-25   Nicotiana sylvestris
ref|XP_009587544.1|  PREDICTED: uncharacterized protein LOC104085254    107   7e-25   Nicotiana tomentosiformis
ref|XP_009782262.1|  PREDICTED: uncharacterized protein LOC104231037    102   5e-23   Nicotiana sylvestris
ref|XP_009587546.1|  PREDICTED: uncharacterized protein LOC104085255    100   2e-22   Nicotiana tomentosiformis
ref|XP_004236994.1|  PREDICTED: uncharacterized protein LOC101257950  96.7    6e-21   Solanum lycopersicum
ref|XP_006344145.1|  PREDICTED: uncharacterized protein LOC102580705  95.1    2e-20   Solanum tuberosum [potatoes]
ref|XP_010254097.1|  PREDICTED: uncharacterized protein LOC104595181  77.8    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_006360447.1|  PREDICTED: uncharacterized protein LOC102591290  76.6    5e-14   Solanum tuberosum [potatoes]
ref|XP_004237003.1|  PREDICTED: uncharacterized protein LOC101260633  76.6    5e-14   Solanum lycopersicum
ref|XP_004239412.1|  PREDICTED: uncharacterized protein LOC101244288  77.0    5e-14   Solanum lycopersicum
ref|XP_011070785.1|  PREDICTED: uncharacterized protein LOC105156369  76.3    1e-13   Sesamum indicum [beniseed]
emb|CDP00644.1|  unnamed protein product                              74.3    6e-13   Coffea canephora [robusta coffee]
ref|XP_010249704.1|  PREDICTED: uncharacterized protein LOC104592180  72.0    3e-12   Nelumbo nucifera [Indian lotus]
emb|CBI26998.3|  unnamed protein product                              67.4    7e-11   Vitis vinifera
ref|XP_002279484.2|  PREDICTED: uncharacterized protein LOC100244117  67.4    9e-11   Vitis vinifera
ref|XP_007223127.1|  hypothetical protein PRUPE_ppa010016mg           66.6    2e-10   
ref|XP_011076562.1|  PREDICTED: uncharacterized protein LOC105160775  67.0    2e-10   Sesamum indicum [beniseed]
gb|KDP29438.1|  hypothetical protein JCGZ_18359                       66.6    3e-10   Jatropha curcas
ref|XP_008243261.1|  PREDICTED: uncharacterized protein LOC103341506  65.9    6e-10   Prunus mume [ume]
ref|XP_007142930.1|  hypothetical protein PHAVU_007G029200g           65.1    6e-10   Phaseolus vulgaris [French bean]
ref|XP_007160389.1|  hypothetical protein PHAVU_002G317700g           63.9    8e-10   Phaseolus vulgaris [French bean]
ref|XP_007044281.1|  Uncharacterized protein TCM_009632               63.5    5e-09   
ref|XP_002314852.2|  hypothetical protein POPTR_0010s13260g           62.4    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008445636.1|  PREDICTED: uncharacterized protein LOC103488593  62.0    1e-08   Cucumis melo [Oriental melon]
gb|EYU29997.1|  hypothetical protein MIMGU_mgv1a010415mg              61.2    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_002312408.2|  hypothetical protein POPTR_0008s12160g           60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004166843.1|  PREDICTED: uncharacterized protein LOC101226094  59.7    6e-08   
ref|XP_004135397.1|  PREDICTED: uncharacterized protein LOC101211482  60.1    7e-08   
ref|XP_008446612.1|  PREDICTED: uncharacterized protein LOC103489295  59.7    9e-08   Cucumis melo [Oriental melon]
gb|AFK44975.1|  unknown                                               58.5    9e-08   Lotus japonicus
gb|KGN52094.1|  hypothetical protein Csa_5G609800                     60.1    1e-07   Cucumis sativus [cucumbers]
gb|KJB50186.1|  hypothetical protein B456_008G158100                  58.9    2e-07   Gossypium raimondii
ref|XP_004137319.1|  PREDICTED: uncharacterized protein LOC101214785  57.8    2e-07   Cucumis sativus [cucumbers]
ref|XP_008453422.1|  PREDICTED: uncharacterized protein LOC103494136  57.8    2e-07   Cucumis melo [Oriental melon]
ref|XP_006605904.1|  PREDICTED: uncharacterized protein LOC100782256  58.5    2e-07   Glycine max [soybeans]
gb|EYU40770.1|  hypothetical protein MIMGU_mgv1a010835mg              58.5    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004138348.1|  PREDICTED: uncharacterized protein LOC101205564  57.8    4e-07   Cucumis sativus [cucumbers]
ref|XP_010099253.1|  hypothetical protein L484_015442                 57.0    7e-07   
ref|XP_011022313.1|  PREDICTED: uncharacterized protein LOC105124132  56.6    9e-07   Populus euphratica
ref|XP_011007676.1|  PREDICTED: uncharacterized protein LOC105113268  56.6    9e-07   Populus euphratica
ref|NP_001241159.1|  uncharacterized protein LOC100805289             55.5    9e-07   Glycine max [soybeans]
ref|XP_011003255.1|  PREDICTED: uncharacterized protein LOC105110053  56.6    9e-07   Populus euphratica
ref|XP_008339652.1|  PREDICTED: uncharacterized protein LOC103402678  57.0    9e-07   Malus domestica [apple tree]
ref|XP_003535721.2|  PREDICTED: uncharacterized protein LOC100779683  56.2    1e-06   Glycine max [soybeans]
ref|XP_009356989.1|  PREDICTED: uncharacterized protein LOC103947762  55.5    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_007154144.1|  hypothetical protein PHAVU_003G094100g           53.9    3e-06   Phaseolus vulgaris [French bean]
ref|XP_002533698.1|  conserved hypothetical protein                   53.9    5e-06   Ricinus communis
gb|KHG24859.1|  hypothetical protein F383_07684                       54.7    5e-06   Gossypium arboreum [tree cotton]
ref|XP_010549544.1|  PREDICTED: uncharacterized protein LOC104820683  54.3    6e-06   Tarenaya hassleriana [spider flower]
gb|KJB61218.1|  hypothetical protein B456_009G347700                  54.3    6e-06   Gossypium raimondii
gb|KJB61217.1|  hypothetical protein B456_009G347700                  54.3    6e-06   Gossypium raimondii
gb|KJB61220.1|  hypothetical protein B456_009G347700                  53.9    8e-06   Gossypium raimondii
gb|KCW86313.1|  hypothetical protein EUGRSUZ_B03003                   53.9    9e-06   Eucalyptus grandis [rose gum]
ref|XP_003592633.1|  hypothetical protein MTR_1g110360                52.0    3e-05   
ref|XP_002526996.1|  conserved hypothetical protein                   51.2    6e-05   Ricinus communis
ref|XP_003616744.1|  hypothetical protein MTR_5g083820                51.6    6e-05   
ref|XP_010265083.1|  PREDICTED: uncharacterized protein LOC104602914  51.2    6e-05   Nelumbo nucifera [Indian lotus]
gb|AES99702.2|  DUF1639 family protein                                51.2    7e-05   Medicago truncatula
emb|CAN68110.1|  hypothetical protein VITISV_000764                   48.9    7e-05   Vitis vinifera
emb|CAN67779.1|  hypothetical protein VITISV_029297                   49.7    8e-05   Vitis vinifera
ref|XP_008799251.1|  PREDICTED: diacylglycerol kinase kappa-like      51.2    8e-05   Phoenix dactylifera
ref|XP_010532317.1|  PREDICTED: uncharacterized protein LOC104808336  51.2    8e-05   Tarenaya hassleriana [spider flower]
ref|XP_003618367.1|  hypothetical protein MTR_6g008660                50.8    8e-05   
gb|ACU20234.1|  unknown                                               48.9    1e-04   Glycine max [soybeans]
ref|XP_003525235.1|  PREDICTED: uncharacterized protein LOC100801179  48.5    1e-04   Glycine max [soybeans]
ref|XP_004497073.1|  PREDICTED: uncharacterized protein LOC101492865  50.1    1e-04   Cicer arietinum [garbanzo]
ref|XP_008389276.1|  PREDICTED: uncharacterized protein LOC103451638  50.1    2e-04   
ref|XP_002278683.1|  PREDICTED: uncharacterized protein LOC100259406  48.9    2e-04   Vitis vinifera
ref|XP_010688487.1|  PREDICTED: uncharacterized protein LOC104902410  48.5    4e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009127623.1|  PREDICTED: uncharacterized protein LOC103852469  48.1    4e-04   Brassica rapa
ref|XP_006448443.1|  hypothetical protein CICLE_v10016320mg           48.5    6e-04   Citrus clementina [clementine]
ref|XP_009112799.1|  PREDICTED: uncharacterized protein LOC103838123  47.4    8e-04   Brassica rapa
ref|XP_003620440.1|  hypothetical protein MTR_6g083920                47.8    0.001   Medicago truncatula



>ref|XP_009795808.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009795809.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
Length=267

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 4/71 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASAR----  380
            MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV+S+G+ISA+HRRS+GS     R    
Sbjct  1    MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVESDGQISAIHRRSFGSELIGRRRSND  60

Query  381  RRVQPPAAATA  413
            R+ +PP    A
Sbjct  61   RKFRPPEKQDA  71



>ref|XP_009795807.1| PREDICTED: uncharacterized protein LOC104242454 isoform X1 [Nicotiana 
sylvestris]
Length=284

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 4/71 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASAR----  380
            MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV+S+G+ISA+HRRS+GS     R    
Sbjct  1    MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVESDGQISAIHRRSFGSELIGRRRSND  60

Query  381  RRVQPPAAATA  413
            R+ +PP    A
Sbjct  61   RKFRPPEKQDA  71



>ref|XP_009587544.1| PREDICTED: uncharacterized protein LOC104085254 [Nicotiana tomentosiformis]
Length=265

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASAR----  380
            MAMGPERSK PLHNFTLPCGLKWGNQKFLRCAKV+SNG ISAVHRRSYGS     R    
Sbjct  1    MAMGPERSKLPLHNFTLPCGLKWGNQKFLRCAKVESNGNISAVHRRSYGSELIGRRRSND  60

Query  381  RRVQPPAAATA  413
            R+ +PP    A
Sbjct  61   RKFRPPEKEDA  71



>ref|XP_009782262.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782263.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782264.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
Length=278

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 65/91 (71%), Gaps = 8/91 (9%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            MAMGPERSKP LHNFTLPCGLKWGNQKFLRCAKVDS+GEIS VHRRSY   E+  RRR +
Sbjct  1    MAMGPERSKP-LHNFTLPCGLKWGNQKFLRCAKVDSDGEISTVHRRSY-EKESIGRRR-E  57

Query  393  PPAAATAQRRGSNERVQETCVAKRARVGESG  485
            P A    +R   N+R   T   +    G+SG
Sbjct  58   PEA---VERHRLNDRF--TRKFRSVNAGDSG  83



>ref|XP_009587546.1| PREDICTED: uncharacterized protein LOC104085255 [Nicotiana tomentosiformis]
Length=274

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 2/58 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRR  386
            MAMGPERSKP LHNFTLPCGLKWGNQKFLRCAKVDS+GEIS VHRR Y + E+  RRR
Sbjct  1    MAMGPERSKP-LHNFTLPCGLKWGNQKFLRCAKVDSDGEISTVHRRPY-NKESIGRRR  56



>ref|XP_004236994.1| PREDICTED: uncharacterized protein LOC101257950 [Solanum lycopersicum]
Length=267

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 55/76 (72%), Gaps = 4/76 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            M MGPERSKP LHNFTLP GLKWGNQ+ LRCAKV+SNGEIS+VHRRS GS     R  ++
Sbjct  1    MTMGPERSKP-LHNFTLPYGLKWGNQRHLRCAKVESNGEISSVHRRSNGSESIGRRMEME  59

Query  393  PPAAATAQRRGSNERV  440
                    RRGSN+R 
Sbjct  60   ---IEMVNRRGSNDRF  72



>ref|XP_006344145.1| PREDICTED: uncharacterized protein LOC102580705 [Solanum tuberosum]
Length=291

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 58/84 (69%), Gaps = 6/84 (7%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            MAMG ERSKP LHNF LPCGLKWGNQKFLRCAKVDSNGEI   HRRS GS   S  RR++
Sbjct  1    MAMGHERSKP-LHNFDLPCGLKWGNQKFLRCAKVDSNGEIPHFHRRSNGSD--SIGRRMR  57

Query  393  PPAAATAQRRGS---NERVQETCV  455
                    RR S   +E ++ET V
Sbjct  58   EIDGMVNNRRSSVVKDELLKETEV  81



>ref|XP_010254097.1| PREDICTED: uncharacterized protein LOC104595181 [Nelumbo nucifera]
Length=271

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 5/61 (8%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRR---SYGSSEASARR  383
            MAMGPERSKP LHNF++P  LKWGNQ+ LRC KVDSNGEI++  RR   S G SE S  R
Sbjct  1    MAMGPERSKP-LHNFSMPR-LKWGNQRLLRCMKVDSNGEITSFQRRFSASGGQSEGSVTR  58

Query  384  R  386
            R
Sbjct  59   R  59



>ref|XP_006360447.1| PREDICTED: uncharacterized protein LOC102591290 [Solanum tuberosum]
Length=257

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEIS  335
            MAMGPERSKP LHNF+LPCGLKWGNQKFLRC K DS+ E+S
Sbjct  1    MAMGPERSKP-LHNFSLPCGLKWGNQKFLRCVKEDSDEEMS  40



>ref|XP_004237003.1| PREDICTED: uncharacterized protein LOC101260633 [Solanum lycopersicum]
Length=259

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEIS  335
            MAMGPERSKP LHNF+LPCGLKWGNQKFLRC K DS+ E+S
Sbjct  1    MAMGPERSKP-LHNFSLPCGLKWGNQKFLRCVKEDSDEEMS  40



>ref|XP_004239412.1| PREDICTED: uncharacterized protein LOC101244288 [Solanum lycopersicum]
Length=290

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +3

Query  219  MGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQPP  398
            MG ERSK  LHNF L CG KWGN KFLRCAKVDSNGEI   HRRS  S+     RR++  
Sbjct  1    MGHERSKH-LHNFDLSCGFKWGNHKFLRCAKVDSNGEIPHFHRRSNRSNAIG--RRMREI  57

Query  399  AAATAQRRGS---NERVQETCV  455
                  RR +   +E ++ET V
Sbjct  58   DVMVNNRRSNEVRDELLKETDV  79



>ref|XP_011070785.1| PREDICTED: uncharacterized protein LOC105156369 [Sesamum indicum]
Length=311

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEAS  374
            MAMG ERSK  LHNFT+PCGL+WGNQ+FLRC KV+SNG+IS + R +  +S +S
Sbjct  1    MAMGTERSKA-LHNFTMPCGLRWGNQRFLRCMKVNSNGQISPLQRFTTNNSGSS  53



>emb|CDP00644.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 10/56 (18%)
 Frame = +3

Query  213  MAMGPERSKP----------PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRR  350
            MAMG ER +           PLHNF LP GL+WGNQKFLRC KV+SNGEISAV RR
Sbjct  1    MAMGLEREREQSLSSSSSSKPLHNFNLPFGLRWGNQKFLRCMKVNSNGEISAVQRR  56



>ref|XP_010249704.1| PREDICTED: uncharacterized protein LOC104592180 [Nelumbo nucifera]
 ref|XP_010249706.1| PREDICTED: uncharacterized protein LOC104592181 [Nelumbo nucifera]
Length=274

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            M MGPE+SKP LHNF++P  LKWGNQK LRC KVDS GEIS+V RR   ++  S    ++
Sbjct  1    MEMGPEKSKP-LHNFSMPR-LKWGNQKLLRCMKVDSKGEISSVERRFSAAAGQSGASIIR  58

Query  393  PPAAATAQRRGSN  431
               + + +RR SN
Sbjct  59   GRESRSLKRRFSN  71



>emb|CBI26998.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = +3

Query  210  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  353
            +  MGPERSKP LHNF +P  LKWGNQ+FLRC KV+SNGE++A   RS
Sbjct  15   LKTMGPERSKP-LHNFAMPS-LKWGNQRFLRCMKVNSNGEVAADDGRS  60



>ref|XP_002279484.2| PREDICTED: uncharacterized protein LOC100244117 [Vitis vinifera]
Length=259

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = +3

Query  210  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  353
            +  MGPERSKP LHNF +P  LKWGNQ+FLRC KV+SNGE++A   RS
Sbjct  14   LKTMGPERSKP-LHNFAMPS-LKWGNQRFLRCMKVNSNGEVAADDGRS  59



>ref|XP_007223127.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica]
 gb|EMJ24326.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica]
Length=267

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 37/52 (71%), Gaps = 6/52 (12%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-----GEISAVHRRS  353
            MAMG ER+KP LHNF LP  LKWGNQK LRC KV S+     GE SAV RRS
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQKHLRCMKVSSDAGGSTGEASAVDRRS  68



>ref|XP_011076562.1| PREDICTED: uncharacterized protein LOC105160775 [Sesamum indicum]
Length=312

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 5/66 (8%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHR----RSYGSSEASAR  380
            MAMG ER K  LHNFTLP  L+WGN++FLRC K++SNG+IS + R     SY S +    
Sbjct  1    MAMGIERLKA-LHNFTLPSELRWGNRQFLRCMKINSNGQISPLRRFTTTNSYSSDQHQQN  59

Query  381  RRVQPP  398
              VQ P
Sbjct  60   NYVQQP  65



>gb|KDP29438.1| hypothetical protein JCGZ_18359 [Jatropha curcas]
Length=299

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = +3

Query  207  LVMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN  323
            LVMAMG ERSKPPLHNF LPC LKWG+QK+LRC K DS+
Sbjct  14   LVMAMGTERSKPPLHNFNLPC-LKWGSQKYLRCMK-DSD  50



>ref|XP_008243261.1| PREDICTED: uncharacterized protein LOC103341506 [Prunus mume]
Length=306

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 37/52 (71%), Gaps = 6/52 (12%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-----GEISAVHRRS  353
            MAMG ER+KP LHNF LP  LKWGNQK LRC KV S+     GE SAV RRS
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQKHLRCMKVSSDAGGSTGEASAVDRRS  68



>ref|XP_007142930.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
 gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
Length=263

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 41/70 (59%), Gaps = 8/70 (11%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            MAMGPERSKP LHNF LPC LKWG+Q+ LRC K+ S+    A  RRS       A R   
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGSQRHLRCTKLGSDSSTDAGDRRS------PAPREFD  63

Query  393  PPAAATAQRR  422
            PP    A  R
Sbjct  64   PPPPGNADAR  73



>ref|XP_007160389.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
 gb|ESW32383.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
Length=170

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-GEISAVHRR  350
            MAMGPERSKP LHNF +PC LKWGNQKFLRC KV ++  +I+ V R+
Sbjct  1    MAMGPERSKP-LHNFPMPC-LKWGNQKFLRCVKVANDPNDIADVRRK  45



>ref|XP_007044281.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
 gb|EOY00113.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
Length=312

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 2/36 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDS  320
            MAMGPERSKP LHNF LPC LKWGNQ++LRC K+D 
Sbjct  12   MAMGPERSKP-LHNFKLPC-LKWGNQRYLRCVKLDD  45



>ref|XP_002314852.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
 gb|EEF01023.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
Length=290

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +3

Query  210  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHR  347
            VMAMG ERSKPPLHNF LP  LKWGNQ+ LRC K+  +   +AV R
Sbjct  11   VMAMGQERSKPPLHNFDLPF-LKWGNQRHLRCMKLPDSSTAAAVVR  55



>ref|XP_008445636.1| PREDICTED: uncharacterized protein LOC103488593 [Cucumis melo]
Length=279

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG-EISAVHRRSYGS-SEASARRR  386
            M M  +RSKP LHNF LPC LKWG+QK LRC KV+SNG ++S V+R+S+ S SE S   R
Sbjct  1    MRMRSKRSKP-LHNFMLPC-LKWGSQKHLRCMKVNSNGVQVSGVNRQSHSSRSEESTETR  58



>gb|EYU29997.1| hypothetical protein MIMGU_mgv1a010415mg [Erythranthe guttata]
Length=313

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            MA G ERS   LHNFT+P  L+WG Q+FLRC KV+S  +IS  HR    SS +S      
Sbjct  1    MATGTERST--LHNFTMPGDLRWGRQRFLRCMKVNSGDQISPPHRIEPNSSGSSDHHNHL  58

Query  393  PPAAATAQRRGSNERVQE  446
            P      QRR + +R +E
Sbjct  59   P----IQQRRTARDRERE  72



>ref|XP_002312408.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
 gb|EEE89775.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
Length=280

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHR  347
            MAMG ERSKPPLHNF LP  LKWGNQ+ LRC K+ DSN    A  R
Sbjct  1    MAMGQERSKPPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVR  45



>ref|XP_004166843.1| PREDICTED: uncharacterized protein LOC101226094 [Cucumis sativus]
Length=269

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG  326
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+ 
Sbjct  1    MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSDA  36



>ref|XP_004135397.1| PREDICTED: uncharacterized protein LOC101211482 [Cucumis sativus]
Length=302

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG  326
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+ 
Sbjct  1    MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSDA  36



>ref|XP_008446612.1| PREDICTED: uncharacterized protein LOC103489295 [Cucumis melo]
Length=310

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  210  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG  326
             MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+ 
Sbjct  13   TMAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSDA  49



>gb|AFK44975.1| unknown [Lotus japonicus]
Length=223

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 1/32 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCA  308
            MAM PERSKPPLHNF+LPC LKWG Q+ LRC 
Sbjct  1    MAMIPERSKPPLHNFSLPC-LKWGTQRLLRCV  31



>gb|KGN52094.1| hypothetical protein Csa_5G609800 [Cucumis sativus]
Length=489

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG  326
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+ 
Sbjct  14   MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSDA  49



>gb|KJB50186.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50187.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50188.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50189.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
Length=309

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDS  320
            MAM PERSKP LHNF LPC LKWGN+++LRC K+D 
Sbjct  12   MAMAPERSKP-LHNFNLPC-LKWGNRRYLRCMKLDD  45



>ref|XP_004137319.1| PREDICTED: uncharacterized protein LOC101214785 [Cucumis sativus]
 ref|XP_004160439.1| PREDICTED: uncharacterized protein LOC101224469 [Cucumis sativus]
 gb|KGN63834.1| hypothetical protein Csa_1G024200 [Cucumis sativus]
Length=227

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 7/52 (13%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEIS-----AVHRRS  353
            M++ P+RS P LHNF+LPC LKWG+Q+FL+C KV SN   S     +VHR+S
Sbjct  1    MSIPPDRSNP-LHNFSLPC-LKWGSQRFLKCMKVSSNSNPSTLDHPSVHRQS  50



>ref|XP_008453422.1| PREDICTED: uncharacterized protein LOC103494136 [Cucumis melo]
Length=227

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  392
            M++ P+RS P LHNF+LPC LKWG+Q+FL+C KV SN   S +   S      S + R +
Sbjct  1    MSIPPDRSNP-LHNFSLPC-LKWGSQRFLKCMKVSSNSNPSTLDHPSVHRQSKSYQFRAR  58

Query  393  P  395
            P
Sbjct  59   P  59



>ref|XP_006605904.1| PREDICTED: uncharacterized protein LOC100782256 [Glycine max]
Length=290

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 41/72 (57%), Gaps = 8/72 (11%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAK--VDSNGEISAVHRRSYGSSEASARRR  386
            MAMGPERSKP LHNF LPC LKWG Q+ LRC K   DS+   +A  RRS    E  +   
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGGQRHLRCTKHPSDSSSADAAGDRRSPAPREFDS---  66

Query  387  VQPPAAATAQRR  422
              PP    A  R
Sbjct  67   -PPPPLTNADTR  77



>gb|EYU40770.1| hypothetical protein MIMGU_mgv1a010835mg [Erythranthe guttata]
Length=300

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV--DSNGEISAVHRRSYGSSEASARRR  386
            MA G ERSK  LHNFT+P  L+W NQ+FLRC KV  D++G IS + R +   S +S +RR
Sbjct  1    MATGTERSKT-LHNFTMPGELRWRNQRFLRCMKVNSDADGRISPLRRFAADKSFSSDQRR  59



>ref|XP_004138348.1| PREDICTED: uncharacterized protein LOC101205564 [Cucumis sativus]
 ref|XP_004160212.1| PREDICTED: uncharacterized protein LOC101227806 [Cucumis sativus]
 gb|KGN45937.1| hypothetical protein Csa_6G024940 [Cucumis sativus]
Length=279

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG-EISAVHRR  350
            M M  +RSKP LHNF LPC LKWG+QK LRC KV+SNG ++S V+R+
Sbjct  1    MRMRSKRSKP-LHNFMLPC-LKWGSQKHLRCMKVNSNGVQVSGVYRQ  45



>ref|XP_010099253.1| hypothetical protein L484_015442 [Morus notabilis]
 gb|EXB77517.1| hypothetical protein L484_015442 [Morus notabilis]
Length=296

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  213  MAMGPERSKP-PLHNFTLPCGLKWGNQKFLRCAKVDSNG  326
            MA+ PER+   PLHNF LPC LKWG+Q++LRC KV+S+G
Sbjct  1    MAVAPERTAAKPLHNFDLPC-LKWGSQRYLRCVKVNSDG  38



>ref|XP_011022313.1| PREDICTED: uncharacterized protein LOC105124132 [Populus euphratica]
Length=278

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHR  347
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+ DSN    A  R
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVR  45



>ref|XP_011007676.1| PREDICTED: uncharacterized protein LOC105113268 [Populus euphratica]
Length=280

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHR  347
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+  +   +AV R
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSSTAAAVVR  44



>ref|NP_001241159.1| uncharacterized protein LOC100805289 [Glycine max]
 ref|XP_006582933.1| PREDICTED: uncharacterized protein LOC100805289 isoform X1 [Glycine 
max]
 gb|ACU19791.1| unknown [Glycine max]
 gb|KHN20745.1| hypothetical protein glysoja_019062 [Glycine soja]
Length=198

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 8/47 (17%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  353
            MA GPERSKP LHNF+LPC LKWG Q+ LRC   D +      HRRS
Sbjct  1    MATGPERSKP-LHNFSLPC-LKWGTQRLLRCVNADLD------HRRS  39



>ref|XP_011003255.1| PREDICTED: uncharacterized protein LOC105110053 [Populus euphratica]
Length=278

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHR  347
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+ DSN    A  R
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVR  45



>ref|XP_008339652.1| PREDICTED: uncharacterized protein LOC103402678 [Malus domestica]
Length=312

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAK  311
            MAMG ER+KP LHNF LP  LKWGNQK+LRC K
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQKYLRCQK  49



>ref|XP_003535721.2| PREDICTED: uncharacterized protein LOC100779683 [Glycine max]
Length=257

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  353
            MAMGPERSKP LHNF LPC LKWG+Q+ LRC K  S+   S   RRS
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGSQRHLRCTKHPSDS--STEDRRS  54



>ref|XP_009356989.1| PREDICTED: uncharacterized protein LOC103947762 [Pyrus x bretschneideri]
Length=310

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 43/74 (58%), Gaps = 12/74 (16%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG-----EISAVHRRSYGSSEASA  377
            MAMG ER+KP LHNF LP  LKWGNQ+ LRC K  S+      E S V+RRS      S 
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQRHLRCQKETSDAGGSGGEGSGVNRRS------SV  70

Query  378  RRRVQPPAAATAQR  419
            +R    PA  T +R
Sbjct  71   QRIESSPAVMTRRR  84



>ref|XP_007154144.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
 gb|ESW26138.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
Length=190

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN  323
            MA GPERSKP LHNF+LPC LKWG Q+ LRC   D +
Sbjct  1    MATGPERSKP-LHNFSLPC-LKWGTQRLLRCVNADLD  35



>ref|XP_002533698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28681.1| conserved hypothetical protein [Ricinus communis]
Length=213

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGE  329
            M    +R KPPLHNF+LP  LKWGNQ+ LRC K+  NG+
Sbjct  1    MTTPQDRPKPPLHNFSLPY-LKWGNQRLLRCVKLTDNGQ  38



>gb|KHG24859.1| hypothetical protein F383_07684 [Gossypium arboreum]
Length=315

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+
Sbjct  12   MAMGTDRSYP-LHNFNLPC-LKWGNQRYLRCMKL  43



>ref|XP_010549544.1| PREDICTED: uncharacterized protein LOC104820683 [Tarenaya hassleriana]
Length=267

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  228  ERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASA  377
            ER KPPLHNF L   LKWGNQ+FLRC K DS+        R   SS A +
Sbjct  18   ERVKPPLHNFPL-SSLKWGNQRFLRCVKADSSSSDDEHRLRRQASSPAKS  66



>gb|KJB61218.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=316

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKL  43



>gb|KJB61217.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
 gb|KJB61219.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=317

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKL  43



>gb|KJB61220.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=324

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKL  43



>gb|KCW86313.1| hypothetical protein EUGRSUZ_B03003 [Eucalyptus grandis]
Length=318

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 2/34 (6%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MAMGPERSKP LHNFTLP  L+WG+Q+++RC KV
Sbjct  19   MAMGPERSKP-LHNFTLP-RLRWGSQRYMRCMKV  50



>ref|XP_003592633.1| hypothetical protein MTR_1g110360 [Medicago truncatula]
 gb|AES62884.1| DUF1639 family protein [Medicago truncatula]
Length=240

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  237  KPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  389
            K PLHNF LP  LKWG+Q+ LRC KV  NG+ S+  +R   S+  SA  R+
Sbjct  31   KAPLHNFDLPSSLKWGSQRQLRCQKVTDNGDGSS--QREMVSTLESAMERI  79



>ref|XP_002526996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35368.1| conserved hypothetical protein [Ricinus communis]
Length=266

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 27/42 (64%), Gaps = 7/42 (17%)
 Frame = +3

Query  207  LVMAMGP------ERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            LVM MG         SKPPLHNF LP  LKWGNQK LRC K+
Sbjct  15   LVMGMGAAAGQRWNNSKPPLHNFDLPF-LKWGNQKHLRCMKI  55



>ref|XP_003616744.1| hypothetical protein MTR_5g083820 [Medicago truncatula]
Length=297

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +3

Query  231  RSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  389
            R K PLHNF LP  LKWG+Q+ LRC KV  NG+ S+  +R   SS  SA  R+
Sbjct  27   RVKVPLHNFRLPSSLKWGSQRQLRCQKVPDNGDGSS--QREMVSSPESAMERM  77



>ref|XP_010265083.1| PREDICTED: uncharacterized protein LOC104602914 [Nelumbo nucifera]
Length=280

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +3

Query  243  PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  353
            PLHNF LPC LKWG Q+ LRC KV SN EI ++ R S
Sbjct  23   PLHNFLLPC-LKWGRQRRLRCIKVRSNAEIPSLERGS  58



>gb|AES99702.2| DUF1639 family protein [Medicago truncatula]
Length=284

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +3

Query  231  RSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  389
            R K PLHNF LP  LKWG+Q+ LRC KV  NG+ S+  +R   SS  SA  R+
Sbjct  27   RVKVPLHNFRLPSSLKWGSQRQLRCQKVPDNGDGSS--QREMVSSPESAMERM  77



>emb|CAN68110.1| hypothetical protein VITISV_000764 [Vitis vinifera]
Length=114

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>emb|CAN67779.1| hypothetical protein VITISV_029297 [Vitis vinifera]
Length=160

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>ref|XP_008799251.1| PREDICTED: diacylglycerol kinase kappa-like [Phoenix dactylifera]
Length=279

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  228  ERSKP----PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARR  383
            ER KP    PL NF+ P   +WGNQ+ LRCA V+  GEI    RR    + AS RR
Sbjct  7    EREKPQSSNPLDNFSFPILKRWGNQRMLRCANVNRKGEIIEGDRRPSLPAAASERR  62



>ref|XP_010532317.1| PREDICTED: uncharacterized protein LOC104808336 [Tarenaya hassleriana]
Length=328

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 2/36 (6%)
 Frame = +3

Query  210  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVD  317
             M  GPERSK  LHNFTLP  LKWG+Q+ LRC KVD
Sbjct  9    FMETGPERSKN-LHNFTLP-NLKWGSQRHLRCMKVD  42



>ref|XP_003618367.1| hypothetical protein MTR_6g008660 [Medicago truncatula]
 gb|AES74585.1| DUF1639 family protein [Medicago truncatula]
Length=273

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = +3

Query  228  ERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  389
            ER K PLH+F  P  LKWG Q+ LRC KV  NG+ S+  +R   SS+ SA  R+
Sbjct  26   ERVKAPLHSFNFPSSLKWGYQRQLRCQKVPENGDGSS--QREMVSSQESAMERM  77



>gb|ACU20234.1| unknown [Glycine max]
Length=129

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = +3

Query  228  ERSKPPLHNFTLPCGLKWGNQKFLRCAK  311
            ERSKP LHNF++PC LKWGNQ+FLRC K
Sbjct  12   ERSKP-LHNFSMPC-LKWGNQRFLRCVK  37



>ref|XP_003525235.1| PREDICTED: uncharacterized protein LOC100801179 [Glycine max]
Length=129

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = +3

Query  228  ERSKPPLHNFTLPCGLKWGNQKFLRCAK  311
            ERSKP LHNF++PC LKWGNQ+FLRC K
Sbjct  12   ERSKP-LHNFSMPC-LKWGNQRFLRCVK  37



>ref|XP_004497073.1| PREDICTED: uncharacterized protein LOC101492865 [Cicer arietinum]
Length=243

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 6/63 (10%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG----EISAVHRRSYGSSEASAR  380
            MA   ER KP LHNF LPC LKWGNQ+ LRC K+ S+       S    R   SS  +AR
Sbjct  13   MATNSERVKP-LHNFMLPC-LKWGNQRHLRCMKIPSDDGDRQSPSNAPTREIESSLNNAR  70

Query  381  RRV  389
             R+
Sbjct  71   MRI  73



>ref|XP_008389276.1| PREDICTED: uncharacterized protein LOC103451638 [Malus domestica]
Length=308

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAK  311
            MAMG ER+K  LHNF LP  LKWGNQ+ LRC K
Sbjct  18   MAMGSERTKA-LHNFNLPWDLKWGNQRHLRCQK  49



>ref|XP_002278683.1| PREDICTED: uncharacterized protein LOC100259406 [Vitis vinifera]
Length=187

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  213  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>ref|XP_010688487.1| PREDICTED: uncharacterized protein LOC104902410 [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +3

Query  216  AMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  314
            AM PERS+  LHNF+LP  L WG QK LRCAK+
Sbjct  3    AMAPERSRT-LHNFSLPPRLNWGTQKLLRCAKL  34



>ref|XP_009127623.1| PREDICTED: uncharacterized protein LOC103852469 [Brassica rapa]
Length=190

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query  216  AMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSS  365
             MG ER K  LHNFTLP  LKWG Q+ LRC K+ SNG +   +RR + S+
Sbjct  13   TMGRERPKT-LHNFTLP-DLKWGVQRSLRCMKLQSNGGVDDRNRRLWRSA  60



>ref|XP_006448443.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 ref|XP_006468717.1| PREDICTED: uncharacterized protein LOC102623112 [Citrus sinensis]
 gb|ESR61683.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 gb|KDO76960.1| hypothetical protein CISIN_1g025032mg [Citrus sinensis]
Length=259

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +3

Query  210  VMAMGPERSKP-PLHNFTLPCGLKWGNQKFLRCAKVDS  320
            +MAMG  RS   PLHNFTLP  LKWG+Q+ LRC KV+ 
Sbjct  7    LMAMGTARSSSKPLHNFTLPY-LKWGHQRHLRCMKVED  43



>ref|XP_009112799.1| PREDICTED: uncharacterized protein LOC103838123 [Brassica rapa]
Length=181

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = +3

Query  225  PERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQPPAA  404
            PERSK  LHNFTLP  L+WG+Q+FL+C K+ S+   S  HR    S     + R+ PP  
Sbjct  7    PERSKR-LHNFTLPY-LRWGHQRFLKCVKLPSSS--SPDHR----SPAVDGKLRLDPPKV  58

Query  405  AT  410
            +T
Sbjct  59   ST  60



>ref|XP_003620440.1| hypothetical protein MTR_6g083920 [Medicago truncatula]
 gb|AES76658.1| DUF1639 family protein [Medicago truncatula]
Length=230

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 2/30 (7%)
 Frame = +3

Query  219  MGPERSKPPLHNFTLPCGLKWGNQKFLRCA  308
            M PERSKP LHNF+ PC LKWGNQ+ LRC 
Sbjct  1    MEPERSKP-LHNFSFPC-LKWGNQRTLRCV  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190