BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025E15

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002518432.1|  conserved hypothetical protein                     224   4e-65   
ref|XP_010099166.1|  Uncharacterized membrane protein                   222   2e-64   Morus notabilis
emb|CDP04437.1|  unnamed protein product                                221   3e-64   Coffea canephora [robusta coffee]
ref|XP_007026163.1|  ERD (early-responsive to dehydration stress)...    215   1e-63   
gb|KDO78340.1|  hypothetical protein CISIN_1g004125mg                   215   1e-63   Citrus sinensis [apfelsine]
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    218   4e-63   Solanum lycopersicum
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    218   4e-63   Solanum tuberosum [potatoes]
gb|KHG30770.1|  putative membrane C2G11.09                              217   9e-63   Gossypium arboreum [tree cotton]
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    217   1e-62   Populus euphratica
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    217   1e-62   Nicotiana tomentosiformis
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    217   1e-62   Populus euphratica
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                   215   2e-62   Citrus sinensis [apfelsine]
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...    214   2e-62   
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    216   2e-62   Prunus mume [ume]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    216   2e-62   Sesamum indicum [beniseed]
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg             214   2e-62   
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg             214   3e-62   
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    216   4e-62   Populus euphratica
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    216   4e-62   Populus euphratica
gb|KJB57786.1|  hypothetical protein B456_009G181100                    215   5e-62   Gossypium raimondii
ref|XP_002317144.2|  early-responsive to dehydration family protein     215   5e-62   
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    215   6e-62   
gb|KJB69237.1|  hypothetical protein B456_011G012200                    213   6e-62   Gossypium raimondii
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    215   7e-62   Citrus sinensis [apfelsine]
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    214   1e-61   Cucumis melo [Oriental melon]
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    214   1e-61   Nicotiana sylvestris
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             214   2e-61   Prunus persica
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             214   2e-61   Phaseolus vulgaris [French bean]
gb|KJB69236.1|  hypothetical protein B456_011G012200                    213   3e-61   Gossypium raimondii
gb|KJB69239.1|  hypothetical protein B456_011G012200                    213   3e-61   Gossypium raimondii
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             213   5e-61   Tarenaya hassleriana [spider flower]
gb|KDO54267.1|  hypothetical protein CISIN_1g018945mg                   201   8e-61   Citrus sinensis [apfelsine]
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    212   9e-61   Glycine max [soybeans]
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...    211   9e-61   Elaeis guineensis
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    212   1e-60   Cicer arietinum [garbanzo]
gb|KHG01808.1|  putative membrane C2G11.09                              211   1e-60   Gossypium arboreum [tree cotton]
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    211   1e-60   Sesamum indicum [beniseed]
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             211   2e-60   
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          211   2e-60   
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    211   2e-60   Cucumis sativus [cucumbers]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    211   3e-60   
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    210   3e-60   Elaeis guineensis
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    210   3e-60   Phoenix dactylifera
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    210   3e-60   Nicotiana tomentosiformis
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    214   4e-60   Populus euphratica
gb|KDO54265.1|  hypothetical protein CISIN_1g018945mg                   200   5e-60   Citrus sinensis [apfelsine]
dbj|BAF98597.1|  CM0545.360.nc                                          209   5e-60   Lotus japonicus
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    209   6e-60   Pyrus x bretschneideri [bai li]
ref|XP_003610472.1|  Membrane protein, putative                         209   9e-60   Medicago truncatula
emb|CDX79125.1|  BnaA01g11920D                                          208   1e-59   
gb|KDO54266.1|  hypothetical protein CISIN_1g018945mg                   201   1e-59   Citrus sinensis [apfelsine]
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                209   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    208   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    208   1e-59   Brassica rapa
emb|CDX82907.1|  BnaC01g13570D                                          208   1e-59   
ref|XP_010449935.1|  PREDICTED: CSC1-like protein At4g15430             195   2e-59   
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    208   2e-59   
ref|NP_172660.5|  putative ERD4 protein                                 207   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    207   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    207   4e-59   Glycine max [soybeans]
gb|EPS60017.1|  hypothetical protein M569_14787                         207   6e-59   Genlisea aurea
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    206   8e-59   Nelumbo nucifera [Indian lotus]
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    206   8e-59   Nicotiana sylvestris
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             206   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             206   1e-58   
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             206   1e-58   Camelina sativa [gold-of-pleasure]
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                206   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          205   2e-58   Amborella trichopoda
gb|EPS71959.1|  hypothetical protein M569_02795                         205   3e-58   Genlisea aurea
ref|XP_003616997.1|  Transmembrane protein                              205   3e-58   Medicago truncatula
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    205   3e-58   Populus euphratica
emb|CAA18115.1|  putative protein                                       204   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383870.1|  early-responsive to dehydration family protein     204   4e-58   
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    204   4e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93792.1|  hypothetical protein                                   204   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    204   4e-58   
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             204   5e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    204   5e-58   Tarenaya hassleriana [spider flower]
emb|CDY27443.1|  BnaC03g64830D                                          204   5e-58   Brassica napus [oilseed rape]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    204   5e-58   
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             203   9e-58   Capsella rubella
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       203   9e-58   Cicer arietinum [garbanzo]
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    203   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    203   1e-57   
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    203   1e-57   Glycine max [soybeans]
gb|KHN38468.1|  Putative membrane protein C2G11.09                      202   2e-57   Glycine soja [wild soybean]
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    202   2e-57   Solanum tuberosum [potatoes]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            202   2e-57   
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             201   4e-57   
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    201   5e-57   Populus euphratica
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    201   6e-57   Fragaria vesca subsp. vesca
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             201   6e-57   Citrus clementina [clementine]
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    204   6e-57   Populus euphratica
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             201   7e-57   Capsella rubella
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    201   9e-57   
emb|CBI32349.3|  unnamed protein product                                201   9e-57   Vitis vinifera
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             201   9e-57   Vitis vinifera
gb|EMS56195.1|  hypothetical protein TRIUR3_24213                       186   1e-56   Triticum urartu
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             200   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...    199   2e-56   Elaeis guineensis
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             200   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             200   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             199   2e-56   Populus euphratica
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             199   2e-56   Populus euphratica
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    199   2e-56   Elaeis guineensis
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    199   3e-56   Fragaria vesca subsp. vesca
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    199   3e-56   
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           199   3e-56   
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    199   3e-56   Elaeis guineensis
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    199   3e-56   
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    199   3e-56   
ref|XP_002321139.1|  early-responsive to dehydration family protein     199   4e-56   Populus trichocarpa [western balsam poplar]
dbj|BAD94445.1|  hypothetical protein                                   199   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             198   8e-56   Nicotiana sylvestris
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             198   9e-56   Phaseolus vulgaris [French bean]
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    197   1e-55   
ref|XP_002886475.1|  F24O1.4                                            197   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             197   2e-55   Nicotiana tomentosiformis
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             197   2e-55   
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    196   3e-55   
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    196   3e-55   Camelina sativa [gold-of-pleasure]
emb|CAB10322.1|  hypothetical protein                                   196   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             196   5e-55   Prunus persica
ref|XP_010905258.1|  PREDICTED: protein OSCA1-like                      195   5e-55   Elaeis guineensis
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    196   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    196   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28986.1|  Putative membrane protein C2G11.09                      195   7e-55   Glycine soja [wild soybean]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             195   7e-55   Phaseolus vulgaris [French bean]
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    195   7e-55   Glycine max [soybeans]
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          195   9e-55   Amborella trichopoda
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             195   9e-55   Camelina sativa [gold-of-pleasure]
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      195   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    194   1e-54   
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    194   1e-54   Nicotiana tomentosiformis
gb|KDO68802.1|  hypothetical protein CISIN_1g015063mg                   189   2e-54   Citrus sinensis [apfelsine]
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             194   2e-54   Capsella rubella
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             194   2e-54   
ref|XP_009771290.1|  PREDICTED: CSC1-like protein At4g02900             193   2e-54   Nicotiana sylvestris
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             194   2e-54   Capsella rubella
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             194   3e-54   Solanum lycopersicum
emb|CDY09064.1|  BnaC08g10180D                                          194   3e-54   Brassica napus [oilseed rape]
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    194   3e-54   Cicer arietinum [garbanzo]
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             193   3e-54   Brassica rapa
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    193   3e-54   Cucumis melo [Oriental melon]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             193   3e-54   Prunus persica
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    193   3e-54   Solanum tuberosum [potatoes]
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             193   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    193   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    193   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    193   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             193   4e-54   
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    193   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY08641.1|  BnaC04g19500D                                          182   5e-54   Brassica napus [oilseed rape]
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             192   6e-54   Nicotiana tomentosiformis
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             192   8e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             192   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       192   1e-53   
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       192   1e-53   Cucumis sativus [cucumbers]
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             192   1e-53   Eucalyptus grandis [rose gum]
emb|CDY49293.1|  BnaC01g22480D                                          191   1e-53   Brassica napus [oilseed rape]
emb|CDY22920.1|  BnaA01g18580D                                          191   3e-53   Brassica napus [oilseed rape]
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    191   3e-53   Glycine max [soybeans]
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    191   4e-53   Brassica rapa
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    191   4e-53   Brassica rapa
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    190   4e-53   Brassica rapa
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    189   4e-53   
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    190   6e-53   
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             189   7e-53   Solanum lycopersicum
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    190   7e-53   Brachypodium distachyon [annual false brome]
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             189   7e-53   Citrus clementina [clementine]
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    189   7e-53   
ref|XP_002301612.2|  early-responsive to dehydration family protein     189   8e-53   
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    189   9e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    189   1e-52   Prunus mume [ume]
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    189   1e-52   
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             189   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    189   1e-52   Solanum tuberosum [potatoes]
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    189   1e-52   Solanum tuberosum [potatoes]
dbj|BAK03311.1|  predicted protein                                      189   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    188   2e-52   Setaria italica
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             188   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             188   2e-52   Populus euphratica
gb|EMT27455.1|  Putative membrane protein                               188   3e-52   
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    188   3e-52   Solanum lycopersicum
emb|CDX90856.1|  BnaA03g25360D                                          187   3e-52   
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             187   4e-52   Brassica rapa
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    187   4e-52   Brassica rapa
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    187   4e-52   
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         187   5e-52   Jatropha curcas
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    187   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    187   5e-52   
emb|CDY21297.1|  BnaC03g29810D                                          187   5e-52   Brassica napus [oilseed rape]
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    187   5e-52   Eucalyptus grandis [rose gum]
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             187   6e-52   Brassica rapa
emb|CDY30043.1|  BnaC05g09770D                                          187   6e-52   Brassica napus [oilseed rape]
emb|CDX98089.1|  BnaA06g08400D                                          187   6e-52   
emb|CDX76386.1|  BnaA08g10140D                                          187   6e-52   
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    187   7e-52   Phoenix dactylifera
gb|KJB42871.1|  hypothetical protein B456_007G171500                    186   1e-51   Gossypium raimondii
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    186   1e-51   Medicago truncatula
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             186   2e-51   Eutrema salsugineum [saltwater cress]
gb|KJB42870.1|  hypothetical protein B456_007G171500                    186   2e-51   Gossypium raimondii
gb|KJB10673.1|  hypothetical protein B456_001G215500                    186   2e-51   Gossypium raimondii
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    185   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             185   3e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             185   3e-51   Capsella rubella
emb|CDY12941.1|  BnaA09g13330D                                          185   3e-51   Brassica napus [oilseed rape]
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             185   3e-51   Brassica rapa
emb|CDY19541.1|  BnaC09g13620D                                          185   4e-51   Brassica napus [oilseed rape]
ref|XP_002533077.1|  conserved hypothetical protein                     184   5e-51   Ricinus communis
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            184   5e-51   Malus domestica [apple tree]
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    184   6e-51   
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    184   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             184   6e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG17938.1|  putative membrane C2G11.09                              184   8e-51   Gossypium arboreum [tree cotton]
ref|NP_001043256.1|  Os01g0534900                                       184   9e-51   
emb|CDP11354.1|  unnamed protein product                                184   1e-50   Coffea canephora [robusta coffee]
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    184   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          183   1e-50   Sorghum bicolor [broomcorn]
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    183   2e-50   
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             183   2e-50   Fragaria vesca subsp. vesca
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    183   2e-50   Fragaria vesca subsp. vesca
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    182   2e-50   
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    182   2e-50   
gb|AAM74515.1|  hv711N16.16                                             173   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             182   2e-50   Brassica rapa
emb|CDY48898.1|  BnaA03g36370D                                          182   2e-50   Brassica napus [oilseed rape]
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             182   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    182   2e-50   
gb|KHN19872.1|  Putative membrane protein C2G11.09                      182   2e-50   Glycine soja [wild soybean]
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    182   2e-50   
emb|CDY32438.1|  BnaC03g42220D                                          182   3e-50   Brassica napus [oilseed rape]
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    182   3e-50   Glycine max [soybeans]
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    182   3e-50   
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          182   4e-50   Sorghum bicolor [broomcorn]
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    182   4e-50   Cucumis melo [Oriental melon]
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    182   5e-50   
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      182   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    181   5e-50   Fragaria vesca subsp. vesca
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    182   5e-50   Cucumis melo [Oriental melon]
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    181   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    181   7e-50   Cucumis sativus [cucumbers]
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    181   7e-50   
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             181   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             180   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_010089460.1|  Uncharacterized membrane protein                   180   1e-49   
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    180   2e-49   Oryza brachyantha
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       180   2e-49   Setaria italica
ref|NP_001055457.1|  Os05g0393800                                       180   2e-49   
gb|EPS74192.1|  hypothetical protein M569_00556                         179   3e-49   Genlisea aurea
ref|XP_002529341.1|  conserved hypothetical protein                     179   3e-49   
gb|EAY97938.1|  hypothetical protein OsI_19855                          179   4e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    179   4e-49   Oryza brachyantha
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                179   6e-49   Erythranthe guttata [common monkey flower]
gb|AAL07154.1|  unknown protein                                         179   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         178   6e-49   Jatropha curcas
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    178   7e-49   Brachypodium distachyon [annual false brome]
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    178   7e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    178   8e-49   
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             178   8e-49   Vitis vinifera
ref|NP_001147493.1|  LOC100281102                                       178   9e-49   Zea mays [maize]
gb|AFW81357.1|  HYP1 isoform 1                                          178   9e-49   
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               178   9e-49   Triticum urartu
gb|KJB69243.1|  hypothetical protein B456_011G012200                    178   1e-48   Gossypium raimondii
gb|KHG10946.1|  putative membrane C2G11.09                              178   1e-48   Gossypium arboreum [tree cotton]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    177   2e-48   Setaria italica
gb|EMT11783.1|  Putative membrane protein                               177   2e-48   
dbj|BAJ96091.1|  predicted protein                                      177   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             177   2e-48   Capsella rubella
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          177   3e-48   Sorghum bicolor [broomcorn]
dbj|BAK05559.1|  predicted protein                                      176   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             176   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg             175   5e-48   
ref|XP_010090368.1|  Uncharacterized membrane protein                   176   8e-48   
ref|XP_008344855.1|  PREDICTED: uncharacterized protein LOC103407754    169   8e-48   
ref|XP_006287198.1|  hypothetical protein CARUB_v10000374mg             173   1e-47   
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               175   1e-47   
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             175   1e-47   
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             174   2e-47   
ref|NP_001056508.1|  Os05g0594700                                       174   2e-47   
emb|CDY32032.1|  BnaA03g60360D                                          174   2e-47   
ref|XP_009765629.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    173   2e-47   
gb|EMT22148.1|  Putative membrane protein                               174   4e-47   
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             173   5e-47   
gb|EEE64912.1|  hypothetical protein OsJ_19772                          174   5e-47   
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    172   6e-47   
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    172   8e-47   
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    172   9e-47   
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             172   9e-47   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             172   1e-46   
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             172   1e-46   
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             172   2e-46   
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            172   2e-46   
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    171   4e-46   
emb|CDX90914.1|  BnaA03g25940D                                          170   6e-46   
emb|CDY17981.1|  BnaC03g30530D                                          170   7e-46   
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             170   8e-46   
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    168   3e-45   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    168   3e-45   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    168   4e-45   
gb|EPS61005.1|  hypothetical protein M569_13796                         159   4e-45   
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             168   5e-45   
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             167   5e-45   
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    167   1e-44   
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    167   1e-44   
gb|EPS71707.1|  hypothetical protein M569_03051                         166   1e-44   
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             166   2e-44   
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            166   2e-44   
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    164   7e-44   
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    164   7e-44   
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    164   8e-44   
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    163   1e-43   
gb|KJB42060.1|  hypothetical protein B456_007G134700                    163   2e-43   
gb|KJB42062.1|  hypothetical protein B456_007G134700                    163   2e-43   
gb|KJB42059.1|  hypothetical protein B456_007G134700                    163   2e-43   
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             163   3e-43   
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          162   4e-43   
emb|CDY29933.1|  BnaC05g29030D                                          163   4e-43   
emb|CDY35541.1|  BnaA05g16450D                                          162   5e-43   
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             162   5e-43   
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             160   2e-42   
emb|CDP03600.1|  unnamed protein product                                160   2e-42   
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             160   4e-42   
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                160   4e-42   
gb|KHG01781.1|  putative membrane C2G11.09                              159   5e-42   
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             159   5e-42   
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             160   6e-42   
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    159   6e-42   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    159   8e-42   
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             159   8e-42   
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             158   2e-41   
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             158   2e-41   
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             158   2e-41   
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             157   2e-41   
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             157   4e-41   
gb|KHG26829.1|  putative membrane C2G11.09                              157   6e-41   
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    157   7e-41   
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             157   7e-41   
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             156   7e-41   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                156   8e-41   
gb|AFI41197.1|  dehydration stress protein                              157   8e-41   
gb|KJB51549.1|  hypothetical protein B456_008G222200                    156   1e-40   
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             155   2e-40   
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   155   2e-40   
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             155   2e-40   
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             154   5e-40   
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            154   5e-40   
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    154   5e-40   
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    154   6e-40   
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             153   7e-40   
emb|CDP11733.1|  unnamed protein product                                154   1e-39   
emb|CDP11732.1|  unnamed protein product                                153   1e-39   
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         153   1e-39   
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    152   3e-39   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       152   3e-39   
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       151   5e-39   
gb|KHN40403.1|  Putative membrane protein C2G11.09                      151   5e-39   
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             151   5e-39   
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       151   8e-39   
ref|XP_003612662.1|  Membrane protein, putative                         151   8e-39   
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             150   1e-38   
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    150   1e-38   
ref|XP_010110413.1|  Uncharacterized protein RSN1                       148   2e-38   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             149   3e-38   
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          149   3e-38   
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    148   6e-38   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             148   8e-38   
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             148   8e-38   
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             147   2e-37   
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             146   2e-37   
ref|XP_006368323.1|  early-responsive to dehydration family protein     146   4e-37   
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             145   6e-37   
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             145   8e-37   
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             144   1e-36   
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             143   2e-36   
ref|NP_001065504.1|  Os10g0579100                                       144   2e-36   
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    144   2e-36   
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            144   2e-36   
gb|EAY79648.1|  hypothetical protein OsI_34792                          144   2e-36   
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              143   4e-36   
dbj|BAK07493.1|  predicted protein                                      140   7e-36   
gb|EMT13890.1|  Putative membrane protein                               142   1e-35   
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               142   1e-35   
emb|CDM81261.1|  unnamed protein product                                142   1e-35   
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                141   2e-35   
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               141   2e-35   
ref|XP_008355138.1|  PREDICTED: uncharacterized protein LOC103418807    135   3e-35   
ref|XP_002519965.1|  Extensin-3 precursor, putative                     140   4e-35   
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             140   7e-35   
gb|EMT18085.1|  Putative membrane protein                               138   3e-34   
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             137   1e-33   
gb|EMT23208.1|  Putative membrane protein                               136   1e-33   
ref|XP_001754358.1|  predicted protein                                  125   1e-29   
gb|EPS60193.1|  hypothetical protein M569_14609                         124   2e-29   
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    122   1e-28   
ref|XP_001782141.1|  predicted protein                                  117   4e-27   
gb|EMS50375.1|  Transmembrane protein 63B                               117   7e-27   
ref|XP_001759032.1|  predicted protein                                  112   3e-25   
ref|XP_001770572.1|  predicted protein                                97.4    6e-20   
ref|XP_001768825.1|  predicted protein                                93.2    2e-19   
emb|CDY24365.1|  BnaA07g02900D                                        82.0    8e-16   
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g           81.3    2e-14   
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                  79.7    6e-14   
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                  79.7    7e-14   
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  77.8    3e-13   
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  77.8    3e-13   
gb|KDP20707.1|  hypothetical protein JCGZ_21178                       74.7    3e-12   
ref|XP_001757556.1|  predicted protein                                73.2    1e-11   
ref|XP_009336442.1|  PREDICTED: CSC1-like protein At3g54510           63.9    1e-08   
ref|XP_009764506.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  61.6    6e-08   
ref|XP_009764505.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  61.6    6e-08   
ref|XP_009764507.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  61.6    6e-08   
ref|XP_010670424.1|  PREDICTED: CSC1-like protein At3g54510           59.7    2e-07   
ref|XP_004308611.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  59.3    3e-07   
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           58.9    5e-07   
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           58.5    5e-07   
gb|KCW65937.1|  hypothetical protein EUGRSUZ_G03247                   58.2    7e-07   
ref|XP_007220369.1|  hypothetical protein PRUPE_ppa017744mg           58.2    7e-07   
ref|XP_010068951.1|  PREDICTED: CSC1-like protein At3g54510           58.2    7e-07   
ref|XP_007139547.1|  hypothetical protein PHAVU_008G039200g           57.8    1e-06   
ref|XP_009602132.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.4    1e-06   
gb|EPS71647.1|  hypothetical protein M569_03112                       57.0    1e-06   
ref|XP_009602131.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.4    1e-06   
ref|XP_009602133.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.4    1e-06   
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.4    1e-06   
ref|XP_009354442.1|  PREDICTED: CSC1-like protein At3g54510           57.4    1e-06   
ref|XP_010670229.1|  PREDICTED: CSC1-like protein HYP1 isoform X2     56.2    3e-06   
ref|XP_008775844.1|  PREDICTED: CSC1-like protein At3g54510           55.8    4e-06   
ref|XP_010089233.1|  Uncharacterized membrane protein                 55.8    4e-06   
ref|XP_010670228.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     55.8    4e-06   
ref|XP_003551746.1|  PREDICTED: uncharacterized membrane protein ...  55.5    6e-06   
ref|XP_003613914.1|  Membrane protein, putative                       55.5    6e-06   
ref|XP_011017881.1|  PREDICTED: CSC1-like protein At1g69450 isofo...  54.7    9e-06   
ref|XP_011017887.1|  PREDICTED: CSC1-like protein At1g69450 isofo...  54.7    9e-06   
ref|XP_004229157.2|  PREDICTED: CSC1-like protein At3g54510           54.7    1e-05   
ref|XP_004232200.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     54.3    1e-05   
ref|XP_010521464.1|  PREDICTED: CSC1-like protein At3g54510           54.3    1e-05   
ref|XP_004963302.1|  PREDICTED: uncharacterized protein RSN1-like...  54.3    1e-05   
ref|XP_002892546.1|  hypothetical protein ARALYDRAFT_471124           53.9    2e-05   
ref|XP_010906445.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  53.9    2e-05   
ref|XP_010906444.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  53.9    2e-05   
tpg|DAA54769.1|  TPA: hypothetical protein ZEAMMB73_421656            53.5    2e-05   
ref|XP_002513083.1|  conserved hypothetical protein                   53.5    2e-05   
ref|XP_008674128.1|  PREDICTED: uncharacterized protein LOC103650...  53.9    2e-05   
ref|XP_010273235.1|  PREDICTED: CSC1-like protein At3g54510           53.5    2e-05   
ref|XP_002311322.1|  hypothetical protein POPTR_0008s09070g           53.5    2e-05   
emb|CBI17725.3|  unnamed protein product                              53.1    3e-05   
gb|AAC34340.1|  Hypothetical protein                                  52.4    3e-05   
ref|XP_002265197.1|  PREDICTED: CSC1-like protein At3g54510           53.1    3e-05   
ref|XP_003575997.1|  PREDICTED: CSC1-like protein RXW8                52.8    4e-05   
ref|XP_004982193.1|  PREDICTED: uncharacterized membrane protein ...  52.4    5e-05   
ref|XP_003561326.1|  PREDICTED: CSC1-like protein At1g10090 isofo...  52.4    5e-05   
ref|XP_003561325.1|  PREDICTED: CSC1-like protein RXW8 isoform X1     52.4    5e-05   
gb|EYU44140.1|  hypothetical protein MIMGU_mgv1a002119mg              52.4    6e-05   
emb|CDO77517.1|  hypothetical protein BN946_scf184912.g16             52.4    6e-05   
ref|XP_004982191.1|  PREDICTED: uncharacterized membrane protein ...  52.4    6e-05   
gb|KFY12414.1|  hypothetical protein V492_03891                       52.0    7e-05   
ref|XP_010231660.1|  PREDICTED: CSC1-like protein RXW8 isoform X3     52.0    7e-05   
gb|EMT18535.1|  Putative membrane protein                             52.0    7e-05   
dbj|BAD43330.1|  unnamed protein product                              52.0    7e-05   
ref|XP_010044468.1|  PREDICTED: CSC1-like protein At1g69450           52.0    8e-05   
ref|NP_172480.2|  Early-responsive to dehydration stress protein ...  52.0    8e-05   
ref|XP_006338419.1|  PREDICTED: uncharacterized membrane protein ...  51.6    9e-05   
ref|XP_006664233.1|  PREDICTED: uncharacterized protein RSN1-like     51.6    9e-05   
ref|XP_006417497.1|  hypothetical protein EUTSA_v10006880mg           51.6    9e-05   
gb|KFY46229.1|  hypothetical protein V494_00538                       51.6    1e-04   
ref|NP_001067352.1|  Os12g0633600                                     51.6    1e-04   
ref|XP_004490117.1|  PREDICTED: uncharacterized membrane protein ...  51.6    1e-04   
ref|XP_002443649.1|  hypothetical protein SORBIDRAFT_08g022840        51.6    1e-04   
ref|XP_002888209.1|  hypothetical protein ARALYDRAFT_893642           51.2    1e-04   
ref|XP_002303914.1|  early-responsive to dehydration family protein   51.2    1e-04   
ref|XP_009144475.1|  PREDICTED: CSC1-like protein At1g10090           51.2    1e-04   
ref|XP_010911661.1|  PREDICTED: CSC1-like protein HYP1                48.5    1e-04   
ref|XP_011088342.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  51.2    1e-04   
ref|XP_011088359.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  51.2    1e-04   
gb|EMT10348.1|  Putative membrane protein                             51.2    1e-04   
ref|XP_011088368.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  51.2    1e-04   
dbj|BAJ92039.1|  predicted protein                                    51.2    1e-04   
ref|XP_011088351.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  51.2    1e-04   
ref|XP_010108715.1|  Uncharacterized membrane protein                 50.8    2e-04   
ref|XP_001702327.1|  ERD4-related membrane protein                    51.2    2e-04   
emb|CDY20660.1|  BnaC08g13980D                                        50.8    2e-04   
ref|XP_007148980.1|  hypothetical protein PHAVU_005G030600g           50.8    2e-04   
ref|XP_001416012.1|  predicted protein                                50.8    2e-04   
gb|KJB58718.1|  hypothetical protein B456_009G222800                  50.8    2e-04   
emb|CDX73475.1|  BnaC08g25280D                                        50.8    2e-04   
gb|KJB58719.1|  hypothetical protein B456_009G222800                  50.8    2e-04   
ref|XP_006292418.1|  hypothetical protein CARUB_v10018632mg           50.8    2e-04   
gb|EMT19397.1|  Putative membrane protein                             50.8    2e-04   
ref|NP_683440.2|  protein RXW8                                        50.4    2e-04   
ref|XP_009116132.1|  PREDICTED: CSC1-like protein At3g54510           50.4    2e-04   
dbj|BAJ86319.1|  predicted protein                                    50.4    2e-04   
gb|AAR87202.1|  expressed protein (with alternative splicing)         50.4    2e-04   
ref|XP_010467963.1|  PREDICTED: CSC1-like protein HYP1                50.1    2e-04   
emb|CDX78241.1|  BnaA09g34360D                                        50.4    2e-04   
gb|ELR02636.1|  hypothetical protein GMDG_05597                       50.4    3e-04   
gb|AAM63909.1|  unknown                                               50.4    3e-04   



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV+AAIN+LTAFIFL+AFAILRLQPFNDRVYFPKWYLKG+RSSP++SGAFV+R
Sbjct  1    MATLGDIGVSAAINLLTAFIFLLAFAILRLQPFNDRVYFPKWYLKGIRSSPTRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEAL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L+WA+L
Sbjct  61   FVNLDFRSYLRFLNWMPEALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAWAIL  120



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV+AAINI TAFIFL+AFA+LRLQPFNDRVYFPKWYLKGLR+SPS+SGAFV+R
Sbjct  1    MATLGDIGVSAAINIFTAFIFLLAFAVLRLQPFNDRVYFPKWYLKGLRNSPSRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSYVRFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+WA+L
Sbjct  61   FVNLDSRSYVRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWAIL  120



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGDMG++AAINIL+A +FLVAFAILRLQPFNDRVYFPKWYLKGLRSSP++SGAFV R
Sbjct  1    MATLGDMGLSAAINILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPTRSGAFVTR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSY+RFLNWMP+AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVP+ L++W +L
Sbjct  61   FVNLDWRSYLRFLNWMPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLIAWTIL  120



>ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
 gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
Length=521

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA IN+L+A +F +AFAILRLQPFNDRVYFPKWYLKGLRSSPS SGAFV++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>gb|KDO78340.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
 gb|KDO78341.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=505

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AFIFL+AFAILRLQPFNDRVYFPKWYLKGLR SP+  GAFV++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIAL++W+VL
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL  120



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G+AAAINI++A IFLVAFAILRLQPFNDRVYFPKWYLKGLR SP+ SGAFV +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVAK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+DWR+Y+RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPI LL+WA+L
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAWAIL  120



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G+AAAINI++A IFLVAFAILRLQPFNDRVYFPKWYLKGLR SP++SGAFV +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTRSGAFVAK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+DWR+Y+RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPI LL+WA+L
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAWAIL  120



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA IN+L+AF+FL+AFAILRLQPFNDRVYFPKWYLKGLRSSPS+SG FVK+
Sbjct  1    MATLGDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPI  L+WAVL
Sbjct  61   FVNLDFRSYLRFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITFLAWAVL  120



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+ V+ AIN+L+AFIFL+AFA+LR+QPFNDRVYFPKWY KGLRSS S+SGAFV+R
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WA+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAIL  120



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G++AAINI++A IFLVAFAILRLQPFNDRVYFPKWYLKGLR SP+ SGAFV +
Sbjct  1    MATLGDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+DWR+Y+RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPI LL+WA+L
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAWAIL  120



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+ V+ AIN+L+AFIFL+AFA+LR+QPFNDRVYFPKWY KGLRSS S+SGAFV+R
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WA+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAIL  120



>gb|KDO78339.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=677

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AFIFL+AFAILRLQPFNDRVYFPKWYLKGLR SP+  GAFV++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIAL++W+VL
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL  120



>ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
Length=618

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA IN+L+A +F +AFAILRLQPFNDRVYFPKWYLKGLRSSPS SGAFV++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV AAINIL+AF+F V FAILRLQPFNDRVYFPKWY KGLR SP+ SGAFV++
Sbjct  1    MATLGDLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT GD+G+AA +NIL+A +FLVAFAILRLQPFNDRVYFPKWYLKGLRS+P+QSG FV +
Sbjct  1    MATFGDIGLAAGVNILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSNPAQSGVFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y+RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVP+ LL+WA+L
Sbjct  61   FVNLDWRAYIRFLNWVPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAWAIL  120



>ref|XP_006449786.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63026.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=618

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AF+FL+AFAILRLQPFNDRVYFPKWYLKGLR SP+  GAFV++
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIAL++W+VL
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL  120



>ref|XP_006449787.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63027.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=634

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AF+FL+AFAILRLQPFNDRVYFPKWYLKGLR SP+  GAFV++
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIAL++W+VL
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL  120



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQPFNDRVYFPKWYLKGLRSSPS+SGAFV+R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPI+ L+ A+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPISFLALAIL  120



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQPFNDRVYFPKWYLKGLRSSPS+SGAFV+R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA ++ A+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFVALAIL  120



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA IN+L+AF+FL+AFAILRLQPFNDRVYFPKWYLKGLRSSPS+SG FVK+
Sbjct  1    MATLSDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPI  L+WAVL
Sbjct  61   FVNLDFRSYLRFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITFLAWAVL  120



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+ V+ A+N+L AFIFL+AFAILR+QPFNDRVYFPKWYLKGLRSS S SGAF +R
Sbjct  1    MATLGDIAVSGALNLLGAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSASHSGAFARR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLD+RSY RFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WA+L
Sbjct  61   IVNLDFRSYTRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAIL  120



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA IN+L+A +F +AFAILRLQPFNDRVYFPKWYLKGLRSSPS SGAFV++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=612

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAA N+L+AF+F +AFA+LRLQPFNDRVYFPKWYLKGLR+SP+ SGAFVK+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPI +++WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAWAVL  120



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AFIFL+AFAILRLQPFNDRVYFPKWYLKGLR SP+  GAFV++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIAL++W+VL
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL  120



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AAINILTAFIFL+ FA+LRLQPFNDRVYF KWYLKGLRSSP+ +GAFV+R
Sbjct  1    MATLQDIGVSAAINILTAFIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEA++MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G++AAINI++A IFLVAFAILRLQPFNDRVYFPKWYLKGLR SP+ SGAFV +
Sbjct  1    MATLQDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+DWR+Y+RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPI LL+WA+L
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAWAIL  120



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV AAINIL+AF+F V FAILRLQPFNDRVYFPKWY KGLR SP+ SGAFV++
Sbjct  1    MATLADLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA +NIL+AFIF VAFAILRLQPFNDRVYFPKWYLKGLR+ P   GAFV++
Sbjct  1    MATLEDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAA N+L+AF+F +AFA+LRLQPFNDRVYFPKWYLKGLR+SP+ SGAFVK+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPI +++WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAWAVL  120



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAA N+L+AF+F +AFA+LRLQPFNDRVYFPKWYLKGLR+SP+ SGAFVK+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPI +++WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAWAVL  120



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAAINIL+AFIFL+AFAILR+QPFNDRVYFPKWYLKGLRSSP  SGA V++
Sbjct  1    MATLGDIGVAAAINILSAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSPLHSGALVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W VL
Sbjct  61   FVNLDLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWTVL  120



>gb|KDO54267.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=272

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INIL+AF FL AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G  V +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA L +AV+
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM  120



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA +NIL+AFIF VAFAILRLQPFNDRVYFPKWYLKGLR+ P   GAFV++
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSY+RFLNWMP AL+MPEPELIDHAGLDS VYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDWRSYLRFLNWMPAALRMPEPELIDHAGLDSVVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_010921304.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X2 [Elaeis guineensis]
Length=682

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF FL+AFAILRLQP NDRVYFPKWYLKG+RSSP+ SGAFV++
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFVQK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+WRSY+RFL WMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA+L++AVL
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAFAVL  120



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AA INIL+AFIF VAFAILRLQP NDRVYFPKWYLKGLR+ P   GAFV++
Sbjct  1    MATLSDIGLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLDWRSY+RFLNWMP AL+MPEPELIDHAGLDS VYLRIYLLGLKIFVPIA L+WA+L
Sbjct  61   IVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSVVYLRIYLLGLKIFVPIAFLAWAML  120



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAA N+L+AF+F +AFA+LRLQPFNDRVYFPKWYLKGLR+SP+ SGAFV++
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPE EL+DHAGLDSAVYLRIYL+GLKIFVPI +++WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELVDHAGLDSAVYLRIYLIGLKIFVPITIVAWAVL  120



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT  D+GVAA INIL A  FLVAFAILRLQP NDRVYFPKWYLKGLRSSP  SG+FV +
Sbjct  1    MATFADIGVAAGINILFAVAFLVAFAILRLQPINDRVYFPKWYLKGLRSSPMHSGSFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSYVRFLNW+P+AL+MPEPELIDHAGLDSAVYLRIYLLGLKIF+PIALLSWA+L
Sbjct  61   FVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFIPIALLSWAIL  120



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQPFNDRVYFPKWYLKG+R SPS+SGA V+R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGVRGSPSRSGALVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLD AVYLRIYL+GLKIFVPI  L+WA+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDYAVYLRIYLMGLKIFVPITFLAWAIL  120



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INIL+A IF + FA LRLQPFNDRVYFPKWYLKGLR SP+ SGAFV++
Sbjct  1    MATLGDLGVAAGINILSALIFFIVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPI  L+WAVL
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIVFLAWAVL  120



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AAINIL+A IFL+ FA+LRLQPFNDRVYF KWYLKGLRSSP+ +GAFV+R
Sbjct  1    MATLQDIGVSAAINILSALIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEA++MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AAINIL+A IFL+ FA+LRLQPFNDRVYF KWYLKGLRSSP+ +GAFV+R
Sbjct  1    MATLQDIGVSAAINILSALIFLLXFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEA++MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVL  120



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF FL+AFAILRLQP NDRVYFPKWYLKG+RSSP+ SGAFV++
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFVQK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+WRSY+RFL WMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA+L++AVL
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAFAVL  120



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF FL+AFAILRLQP NDRVYFPKWYLKG+RSSP+ SG FV++
Sbjct  1    MATLSDIGVAAAINILSAFTFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGTFVQK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+WRSY+RFL WMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA+L++AVL
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAFAVL  120



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV+AAINIL+AFIFL+AFAILRLQP NDRVYFPKWYLKGLR+S +Q GAFVK+
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLKGLRNSVTQPGAFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLDWR+Y+RFLNW+P+ALKMPE ELIDHAGLDSAVYLRIYLLGLKIF+PI LL++ VL
Sbjct  61   IVNLDWRAYIRFLNWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAFTVL  120



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   214 bits (544),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 94/120 (78%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQP NDRVYFPKWYLKG+R SP +SGA V+R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPEL+DHAGLD AVYLRIYL+GLKIFVPIA ++ A+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPIAFVALAIL  120



>gb|KDO54265.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=305

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INIL+AF FL AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G  V +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA L +AV+
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM  120



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+LGD+G+AAAINILTAF FL+AFA+LR+QP NDRVYFPKWYLKGLRSSP Q GAFV +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAVLRIQPINDRVYFPKWYLKGLRSSPLQGGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPI+LL+++V+
Sbjct  61   FVNLDFRSYIRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPISLLAFSVM  120



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV A INIL+A IF + FA LRLQP NDRVYFPKWYLKGLR SP+ SGAFV++
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+WAVL
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWAVL  120



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+ +AA INIL+AFIF VAFAILRLQP NDRVYFPKWYLKGLR+ P   GAF+++
Sbjct  1    MAKLADISLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFMRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLDWRSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L+WAVL
Sbjct  61   IVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAWAVL  120



>emb|CDX79125.1| BnaA01g11920D [Brassica napus]
Length=695

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FA+LRLQPFNDRVYF KWYLKGLRSSPS+ GAFV+R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIFVPIA+L+WAVL
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAWAVL  120



>gb|KDO54266.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=348

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INIL+AF FL AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G  V +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA L +AV+
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM  120



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA   D+G+AA +NIL+A IFL+AFAILRLQPFNDRVYFPKWYLKGLR+SP+QSGAF  +
Sbjct  1    MADFRDIGLAAGVNILSALIFLIAFAILRLQPFNDRVYFPKWYLKGLRTSPTQSGAFANK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSY+RFL W+PEALKMPE ELIDHAGLDSAVYLRIYLLGLKIFVP+ LL+WA+L
Sbjct  61   FVNLDWRSYIRFLTWVPEALKMPEQELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAWAIL  120



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV A INIL+A +F + FA LRLQPFNDRVYFPKWYLKGLR SP+ SGAFV++
Sbjct  1    MATLGDLGVGAGINILSALVFFLVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPI  L+WAVL
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIVFLAWAVL  120



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FA+LRLQPFNDRVYF KWYLKGLRSSPS+ GAFV+R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIFVPIA+L+WAVL
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAWAVL  120



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FA+LRLQPFNDRVYF KWYLKGLRSSPS+ GAFV+R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIFVPIA+L+WAVL
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAWAVL  120



>ref|XP_010449935.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=185

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ +AAAINIL+A IF +AFA+LR+QPFNDRVYFPKWYLKGLRSSP++SGAFV+R
Sbjct  1    MATLQDIALAAAINILSACIFFLAFAVLRIQPFNDRVYFPKWYLKGLRSSPTRSGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+ALKMPEPELI+HAGLDSAVYLRIYL+GLK+FVPI  L+WA+L
Sbjct  61   FVNLDFRSYLRFLNWMPDALKMPEPELIEHAGLDSAVYLRIYLIGLKLFVPITFLAWAIL  120



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAAINILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAAAINILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA +NIL+AFIF VAFAILRLQPFNDRVYFPKWYLKGLR+ P   GAFV++
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSY+RFLNWMP AL+MPE ELIDHAGLDS VYLRIYL+GLKIFVPIA L+WAVL
Sbjct  61   FVNLDWRSYLRFLNWMPAALRMPELELIDHAGLDSVVYLRIYLVGLKIFVPIAFLAWAVL  120



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT  D+GVAA +NILTA +FL+AFAILRLQP NDRVYFPKWYLKGLR SPS SGAFV +
Sbjct  1    MATFSDIGVAAGVNILTALVFLIAFAILRLQPLNDRVYFPKWYLKGLRGSPSHSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+D  SY RFLNW+P+ALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVP+ LL+WAVL
Sbjct  61   FVNIDLVSYTRFLNWVPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAWAVL  120



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G+AAAINIL+A  FL+AFAILRLQPFNDRVYFPKWYLKGLRSSPS  GAFV +
Sbjct  1    MATLGDIGLAAAINILSAVAFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSHVGAFVHK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPI  L++ +L
Sbjct  61   FVNLDFRSYLRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPITFLAFTIL  120



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV+AAINIL+AFIFL+AFAILRLQP NDRVYFPKWYL GLR+  +QSGA VK+
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLMGLRNGVTQSGAIVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLDWR+Y+RFLNW+P+ALKMPE ELIDHAGLDSAVYLRIYLLGLKIFVPI LL++ VL
Sbjct  61   IVNLDWRAYIRFLNWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFVPITLLAFTVL  120



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FAILRLQPFNDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMRFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G+AAAINILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGLAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT GD+GVAA +NIL A  FL+AFA LRLQP NDRVYFPKWYLKGLRSSP  +G+ V +
Sbjct  1    MATFGDIGVAAGLNILFAVAFLIAFAFLRLQPINDRVYFPKWYLKGLRSSPVNAGSVVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWRSYVRFLNW+P+AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVP+ALLSWAVL
Sbjct  61   FVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVALLSWAVL  120



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AA+NIL AF FL+AFAILRLQP NDRVYFPKWYLKGLRSSP+ SG FV +
Sbjct  1    MATLRDIGVSAAVNILMAFAFLLAFAILRLQPINDRVYFPKWYLKGLRSSPTHSGVFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMPE L+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPI +L +A++
Sbjct  61   FVNLDYRSYIRFLNWMPEGLRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIMILGFAII  120



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INIL+A  FL+AFA+LRLQPFNDRVYFPKWYLKGLR SP +SG FV +
Sbjct  1    MATLEDIGVAAGINILSAVAFLIAFAVLRLQPFNDRVYFPKWYLKGLRGSP-RSGTFVAK  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDW+SY+RFLNW+P+A++MPEPELIDHAGLDS VYLRIYLLGLKIFVP+ALLSWAVL
Sbjct  60   FVNLDWKSYLRFLNWVPDAIRMPEPELIDHAGLDSVVYLRIYLLGLKIFVPVALLSWAVL  119



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+LGD+G+AAAINILTA +FL+AFAILR+QP NDRVYFPKWY+KGLRSSP Q GAFV +
Sbjct  1    MASLGDIGLAAAINILTAIVFLLAFAILRIQPINDRVYFPKWYMKGLRSSPLQGGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+D+RSY+RFLNWMP AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVPI+LL+++V+
Sbjct  61   FVNIDFRSYIRFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLLGLKIFVPISLLAFSVM  120



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AAIN+L+A IFL  FAILRLQPFNDRVYFPKWYLKGLR+SPS+S A V R
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALVSR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FLNWMP+ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPI +L+W VL
Sbjct  61   FVNLDCRSYIQFLNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAWVVL  120



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQPFNDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL  120



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+AAIN+L+A IFL  FAILRLQPFNDRVYFPKWYLKGLR+SPS+S A V R
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALVSR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FLNWMP+ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPI +L+W VL
Sbjct  61   FVNLDCRSYIQFLNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAWVVL  120



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQPFNDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL  120



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQPFNDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL  120



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+G+AA INILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGLAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+  SY+RFLNWMP ALKMPEPELI HAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNLNLGSYLRFLNWMPAALKMPEPELIHHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INILTAFIF V FAILRLQPFNDRVYF KWYLK LRSSP+  GAFV R
Sbjct  1    MATLLDIGVSAGINILTAFIFFVVFAILRLQPFNDRVYFSKWYLKRLRSSPTHGGAFVSR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIAL++WA+L
Sbjct  61   FVNLDLRSYLRFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIALVAWAIL  120



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF V FAILRLQPFNDRVYF KWYLKGLRSSP++ GAFV+R
Sbjct  1    MATLVDIGVSAGINILSAFIFFVIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP+ALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQPFNDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA+INILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLEDIGVAASINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN+D  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL GLKIFVP+ALL+W++L
Sbjct  61   FVNVDLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLTGLKIFVPVALLAWSIL  120



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+LGD+G+AAAINILTAF FL+AFAILR+QP NDRVYFPKWYLKGLR SP Q GAFV +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAILRIQPINDRVYFPKWYLKGLRCSPLQGGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMP AL+MPEPELI+HAGLDSA+YLRIYLLGLKIFVPI+ L+++V+
Sbjct  61   FVNLDFRSYIKFLNWMPAALQMPEPELIEHAGLDSAIYLRIYLLGLKIFVPISFLAFSVM  120



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQPFNDRVYF KWYLKG+RSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGIRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AF+F + FA+LRLQP NDRVYF KWYLKGLRSSP++ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPLNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYV+FLNWMPEALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYVKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+LGD+G+AAAINIL+AF FL+AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G FV +
Sbjct  3    MASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAGIFVSK  62

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD++SY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA+L+++V+
Sbjct  63   FVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAVLAFSVM  122



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+LGD+G+AAAINIL+AF FL+AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G FV +
Sbjct  1    MASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAGIFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD++SY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA+L+++V+
Sbjct  61   FVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAVLAFSVM  120



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+GD+GV+AAINIL+A IFL+AFAILRLQP NDRVYFPKWYL GLR+ P +SG FVK+
Sbjct  1    MATIGDIGVSAAINILSALIFLLAFAILRLQPLNDRVYFPKWYLAGLRNDPLKSGGFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLDW++Y+RFLNW+P ALKMPE ELIDHAGLDSAVYLRIYLLGLKIF+PI LL++AVL
Sbjct  61   VVNLDWKAYIRFLNWVPAALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAFAVL  120



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV A INIL+A IF + FA LRLQP NDRVYFPKWY KGLR SP+ SGAFV++
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYFKGLRESPTPSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+WA L
Sbjct  61   FVNLDFRSYLRFLDWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAXL  120



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INILTA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLEDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP AL MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALNMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQP NDRVYFPKWYLKG+R SP +SGA V+R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPEL+DHAGLD AVYLRIYL+GLKIFVP+  L+ A+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPLTFLALAIL  120



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GV A+INIL+AF+F V FA LRLQPFNDRVYFPKWYLKG+R SP++SGAFV++
Sbjct  1    MATLGDIGVGASINILSAFLFFVVFAFLRLQPFNDRVYFPKWYLKGVRDSPTRSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIAL++WAVL
Sbjct  61   FVNLDYRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALVAWAVL  120



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INIL+AF FL AFAILR+QP NDRVYFPKWYLKGLRSSP Q+G  V +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFL+WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA L +AV+
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM  120



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+ AIN+L+AFIFL+AFAILRLQP NDRVYFPKWYLKG+R SP +SGA V+R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMPEALKMPEPEL+DHAGLD AVYLRIYL+GLKIFVPIA ++ A+L
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPIAFVALAIL  120



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+A +F + FA+LRLQPFNDRVYF KWYLKGLRSSPS+ GAF +R
Sbjct  1    MATLQDIGVSAGINILSAVVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFAQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FLNWMPEALKMPEPELIDHAGLDS VYLRIY +GLKIF PIA+L+WAVL
Sbjct  61   FVNLDLRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWMGLKIFAPIAVLAWAVL  120



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAA+NIL+A IFL+AFAILRLQP NDRVYFPKWYL GLR+ P +SG FVK+
Sbjct  1    MATLADIGVAAALNILSALIFLLAFAILRLQPLNDRVYFPKWYLVGLRNDPLKSGGFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLDW++Y+RFLNW+P ALKMPE ELIDHAGLDSAVYLRIYLLGLKIF+PI LL++AVL
Sbjct  61   VVNLDWKAYIRFLNWVPAALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAFAVL  120



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ VAA INIL+A  FLVAFAILRLQPFNDRVYFPKWYLKG+R SP +SGAFV +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP ALKMPEPELIDHAGLDSAV++RIYLLGLKIFVP+A+L++AVL
Sbjct  61   FVNLDCRTYLRFLNWMPVALKMPEPELIDHAGLDSAVFIRIYLLGLKIFVPLAVLAFAVL  120



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ VAA INIL+A  FLVAFAILRLQPFNDRVYFPKWYLKG+R SP +SGAFV +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP ALKMPEPELIDHAGLDSAV++RIYLLGLKIFVP+A+L++AVL
Sbjct  61   FVNLDCRTYLRFLNWMPVALKMPEPELIDHAGLDSAVFIRIYLLGLKIFVPLAVLAFAVL  120



>gb|EMS56195.1| hypothetical protein TRIUR3_24213 [Triticum urartu]
Length=139

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GV+AAINIL+A IFL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP AL+MPE ELI HAGLDSAVYLRIYL GLKIFVPI +L++ VL
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAFLVL  120



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF F + FAI+R+QPFNDRVYFPKWYL+GLR SP +S AF  +
Sbjct  1    MATLSDIGVAAAINILSAFAFFIVFAIVRIQPFNDRVYFPKWYLRGLRCSPLRSDAFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFLNWMPEAL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPI +L+++V+
Sbjct  61   FVNLDLRSYLRFLNWMPEALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITILAFSVM  120



>ref|XP_010924082.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X5 [Elaeis guineensis]
Length=688

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G++AA+NIL+A IFL+ FA+LRLQP+NDRVYFPKWYLKG+RSSP+ SG F+K+
Sbjct  1    MASLADIGMSAALNILSALIFLIVFAVLRLQPYNDRVYFPKWYLKGIRSSPTHSGNFIKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYLLGLKIF PIA+L++ VL
Sbjct  61   FVNLDCRTYLRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFAPIAVLAFGVL  120



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+GV+AAIN+L+AF FLVAFAILRLQPFNDRVYFPKWYL+G+RSSP+ SGA V++
Sbjct  1    MASLQDIGVSAAINLLSAFAFLVAFAILRLQPFNDRVYFPKWYLRGIRSSPTHSGALVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELI HAGLDSAVY+RIYLLGLKIF+P  +LS+ VL
Sbjct  61   FVNLDCRTYIRFLNWMPAALRMPEPELIQHAGLDSAVYIRIYLLGLKIFIPFTVLSFVVL  120



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINILTAF F + FAILR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
             VNLD+RSYVRFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L++ +
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAFTI  119



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINILTAF F + FAILR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
             VNLD+RSYVRFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L++ +
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAFTI  119



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+  D+GV AAINIL+AF+F + FAILRLQP NDRVYFPKWY KG+R SP++SG FV +
Sbjct  1    MASFRDIGVGAAINILSAFVFFIVFAILRLQPLNDRVYFPKWYFKGVRDSPTRSGTFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP AL MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIAL++ A+L
Sbjct  61   FVNLDYRSYVRFLNWMPAALNMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALVASAIL  120



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ VAAAINILTA  F VAFAILR+QP NDRVYFPKWY+KGLRSSPS  GA V +
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP AL+MPEPELIDHAGLDSA YLRIYL+GLKIFVPIA +++AV+
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAAYLRIYLIGLKIFVPIAFIAFAVM  120



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF FL+AFA+LRLQP NDRVYFPKWYLKG+RSSP  SG FV++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELI+HAGLDS+VYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAFAVL  120



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINILTAF F + FAILR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
             VNLD+RSYVRFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL GLKIFVPIA L++ +
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLTGLKIFVPIAFLAFTI  119



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INILT F F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G F  +
Sbjct  1    MATLTDIGVAATINILTVFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A +FL+AFAILR+QP NDRVYFPKWYLKGLRSSP  SG  V +
Sbjct  1    MATLSDIGVAAAINILSACVFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA ++++V+
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFIAFSVM  120



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M TL D+GVAAAINI +A +F +AFAILRLQP+NDRVYFPKWYLKGLR+ P Q  AFV +
Sbjct  1    MTTLSDIGVAAAINISSALLFFLAFAILRLQPWNDRVYFPKWYLKGLRTDPIQGRAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLDWRSY+ FLNWMPEA++MPEPELIDHAGLDS VYLRIYL+GLKIFVPIA L+W VL
Sbjct  61   FINLDWRSYLGFLNWMPEAIRMPEPELIDHAGLDSVVYLRIYLIGLKIFVPIAFLAWTVL  120



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+AAIN+L+AF FLVAFAILRLQP NDRV+FPKWY KG+RSSP++SGAFV +
Sbjct  1    MATLQDITVSAAINLLSAFAFLVAFAILRLQPINDRVFFPKWYRKGIRSSPTRSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y++FLNWMP AL+MPEPELIDHAGLDS VY+RIYLLGLKI VP+A+L+++VL
Sbjct  61   FVNLDWRTYIKFLNWMPAALRMPEPELIDHAGLDSVVYIRIYLLGLKITVPLAVLAFSVL  120



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAFV +
Sbjct  1    MATLADIGVAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            I+NLD+RSYVRFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW++L
Sbjct  61   IMNLDFRSYVRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSIL  120



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+GVAAAINIL+A IFL+AFAILR+QP NDRVYFPKWYLKGLRSSP  SG  V +
Sbjct  1    MASLSDIGVAAAINILSACIFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP AL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA ++++V+
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFIAFSVM  120



>ref|XP_006414511.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
 gb|ESQ55964.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
Length=743

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAIAFLIAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A  FL+AFA+LRLQP NDRVYFPKWYLKG+R SP++SG FV +
Sbjct  1    MATLTDIGLAAAINILSAVAFLIAFAVLRLQPINDRVYFPKWYLKGVRGSPTRSGTFVHK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+ RSY+RFL WMP AL+MPEPELIDHAGLDSAVYLRIYL+GLK+FVP+A+LS+A+L
Sbjct  61   FVNLNLRSYLRFLEWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKLFVPMAILSFAIL  120



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_010449936.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_010434983.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_010449938.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>emb|CAB10322.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78585.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ VAAAINILTA  F VAFAILR+QP NDRVYFPKWY+KGLRSSPS  GA V +
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY +FLNWMP AL+MPEPELIDHAGLDSA YLRIYL+GLKIFVPIA +++AV+
Sbjct  61   FVNLDFRSYAKFLNWMPAALQMPEPELIDHAGLDSAAYLRIYLIGLKIFVPIAFVAFAVM  120



>ref|XP_010905258.1| PREDICTED: protein OSCA1-like [Elaeis guineensis]
Length=682

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+ ++A INIL+AF+F VAFAILRLQPFNDRVYFPKW+LKG+RSSP  SG  V +
Sbjct  1    MASLQDIALSAFINILSAFVFFVAFAILRLQPFNDRVYFPKWHLKGIRSSPRHSGKSVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYLLGLKIFVP+ +L++ +L
Sbjct  61   FVNLDWRTYLRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAFGIL  120



>ref|NP_001154237.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE83603.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34618.1| hyperosmolality-gated Ca2+ permeable channel 1.6 [Arabidopsis 
thaliana]
Length=760

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|NP_193278.4| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q8VZM5.1|CSCL3_ARATH RecName: Full=CSC1-like protein At4g15430 [Arabidopsis thaliana]
 gb|AAL36364.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83602.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
Length=761

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M TL D+GVAAAINI TA +F VAFAILRLQP+NDRVYFPKWYLKGLR+ P    A V +
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLDWR+Y+ FLNWMPEAL+MPEPELIDHAGLDS VYLRIYL+GLKIF+PIA L+W VL
Sbjct  61   FINLDWRAYLSFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLIGLKIFIPIAFLAWIVL  120



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G+AAAINIL+AF FL+AFA+LR+QP NDRVYFPKWYLKGLRSSP Q+G FV +
Sbjct  3    MASLSDIGLAAAINILSAFTFLLAFALLRIQPINDRVYFPKWYLKGLRSSPLQAGLFVSK  62

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD++SY+ FL+WMP AL+MPEPELIDHAGLDSAV+LRIYLLGLKIFVPIA L+++V+
Sbjct  63   FVNLDFKSYISFLSWMPSALQMPEPELIDHAGLDSAVFLRIYLLGLKIFVPIAFLAFSVM  122



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M TL D+GVAAAINI TA +F VAFAILRLQP+NDRVYFPKWYLKGLR+ P    A V +
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLDWR+Y+ FLNWMPEAL+MPEPELIDHAGLDS VYLRIYL+GLKIF+PIA L+W VL
Sbjct  61   FINLDWRAYLSFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLIGLKIFIPIAFLAWIVL  120



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT  D+GV+ +IN  TA  FL+AFAILRLQPFNDRVYFPKWYLKGLRSSP  SG  V +
Sbjct  1    MATTSDIGVSLSINFPTALAFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPRHSGTIVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDW++Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYL+GLK+FVPI LL+++VL
Sbjct  61   FVNLDWKNYMRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLVGLKLFVPITLLAFSVL  120



>ref|XP_010440309.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=762

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWY KGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYFKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAFV +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            I+NLD+RSYVRFLNWMP+ALKMPEPELIDHAGLDSAVYLRIYL+GLKIF PIALLSW++L
Sbjct  61   IMNLDFRSYVRFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLIGLKIFGPIALLSWSIL  120



>ref|NP_176422.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE33953.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34616.1| hyperosmolality-gated Ca2+ permeable channel 1.4 [Arabidopsis 
thaliana]
Length=769

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAFV +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            I+NLD+RSYVRFLNWMP+ALKMPEPELIDHAGLDSAVYLRIYL+GLKIF PIALLSW++L
Sbjct  61   IMNLDFRSYVRFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLIGLKIFGPIALLSWSIL  120



>ref|XP_009601331.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+ V+A IN+L+A +FL+AFAI+RLQP NDRVYFPKWYLKG+R+SP  SGAFV +
Sbjct  1    MASVQDISVSAVINLLSALVFLLAFAIVRLQPINDRVYFPKWYLKGIRASPRSSGAFVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y+RFLNWMP ALKMPE ELIDHAGLDSAVY+RIYLLGLKIFVPI +LS+AVL
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELIDHAGLDSAVYIRIYLLGLKIFVPITMLSFAVL  120



>gb|KDO68802.1| hypothetical protein CISIN_1g015063mg [Citrus sinensis]
Length=414

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+AAIN+L+AF FLV FAILR+QP NDRVYFPKWY KG+RSSP+ SG F  +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP+ALKMPE EL+DHAGLDS  YLRIYLLGLKIFVP+A+L++ VL
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVL  120



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TAF FL+AFAI R+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKGLRS+P  SGAFV +
Sbjct  1    MATLADIGVAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGLRSNPVTSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVN D+RSY+RFLNW+P ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW++L
Sbjct  61   IVNFDFRSYIRFLNWIPGALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSIL  120



>ref|XP_009771290.1| PREDICTED: CSC1-like protein At4g02900, partial [Nicotiana sylvestris]
Length=654

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+  D+ ++A +N+L+AF FLVAFAILRLQPFNDRVYF KWYLKG+R+SP  SGAFV++
Sbjct  1    MASSDDILLSAVLNLLSAFAFLVAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYLLGLKIFVPIAL S+ VL
Sbjct  61   FVNLDCRTYIRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPIALFSFGVL  120



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RS+P  SGAFV +
Sbjct  1    MATLSDIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSNPLTSGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIY++GLKIFVPIALLSW+VL
Sbjct  61   VVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYMIGLKIFVPIALLSWSVL  120



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+AFA LR+QP NDRVYFPKWYLKGLR SP  SG  V +
Sbjct  1    MATLSDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLKGLRGSPLHSGTIVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA ++++V+
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFIAFSVM  120



>emb|CDY09064.1| BnaC08g10180D [Brassica napus]
Length=761

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ ++GVAAAINI+T+  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MATINEIGVAAAINIVTSIAFLIAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G++A IN+L+AF FL AFA+LRLQPFNDR+YFPKWYLKG+RSSP+ S +FVK+
Sbjct  1    MATLADIGISAGINLLSAFTFLFAFAMLRLQPFNDRIYFPKWYLKGIRSSPTNSRSFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+ +Y+RFLNWMP AL MPEPELIDHAGLDSAVY+RIY+LG KIF PI LL++ VL
Sbjct  61   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVYIRIYVLGFKIFAPITLLAFMVL  120



>ref|XP_009107840.1| PREDICTED: CSC1-like protein At4g15430 [Brassica rapa]
 emb|CDY22738.1| BnaA08g05680D [Brassica napus]
Length=755

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ ++GVAAAINI+T+  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MATINEIGVAAAINIVTSIAFLIAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTM  120



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++GD+GV AAINIL+AF F V FA+LR+QP NDRVYFPKWY+KGLR SP  SGA V R
Sbjct  1    MASIGDIGVGAAINILSAFAFFVVFALLRIQPVNDRVYFPKWYIKGLRGSPLSSGAIVGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLD+RSY++FLNWM  AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L++ ++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAFTIM  120



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+AAINIL+A  FLVAFA++RLQPFNDRVYFPKWYLKG+R SP+ SGAFVK+
Sbjct  1    MATLQDISVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGAFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD ++Y++FLNWMP AL+MPEPELIDHAGLDSA Y+RIY+LGLKIFVPI  L+  VL
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIDHAGLDSAAYIRIYILGLKIFVPITALALIVL  120



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+AFA LR+QP NDRVYFPKWYL GLRSSP  SG  V +
Sbjct  1    MATLTDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLNGLRSSPLHSGTIVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA ++++V+
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFIAFSVM  120



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAF  +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVN D+R+Y+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALLSWAVL
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWAVL  120



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G++AAIN+L+A  FL+AFAILRLQP NDRVYFPKWYLKG+R SP +S   V R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLK+FVPI++L++ VL
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVL  120



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G++AAIN+L+A  FL+AFAILRLQP NDRVYFPKWYLKG+R SP +S   V R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLK+FVPI++L++ VL
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVL  120



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G++AAIN+L+A  FL+AFAILRLQP NDRVYFPKWYLKG+R SP +S   V R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLDWR+Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLK+FVPI++L++ VL
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVL  120



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GVAAAINI+TA  FL+AFAI R+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MATINDIGVAAAINIVTALAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMPEALKMPEPEL+DHAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL A  FLVAFAILRLQP NDRVYFPKWYLKG+RSSP+ SGAFV++
Sbjct  1    MATLTDIGLAAAINILVAIAFLVAFAILRLQPINDRVYFPKWYLKGVRSSPTCSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+  SY+RFL WMP AL+MPEPELI+HAGLDS VYLRIYL+GLKIFVP+A+L++AVL
Sbjct  61   FVNLNLSSYLRFLGWMPAALRMPEPELINHAGLDSVVYLRIYLIGLKIFVPMAILAFAVL  120



>emb|CDY08641.1| BnaC04g19500D [Brassica napus]
Length=214

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSP-SQSGAFVK  348
            MATL D+GVAA INILTA IFL+ FAILR+QPFNDRVYFPKWYLKGLRSSP    GA V 
Sbjct  1    MATLADIGVAAGINILTALIFLLLFAILRIQPFNDRVYFPKWYLKGLRSSPLVNPGALVS  60

Query  349  RIVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
            +IVNLD+RSY+RFL+WMP ALKMPE ELIDHAG DSAVYLRIYL+GLKIFVPIALLSW++
Sbjct  61   KIVNLDFRSYIRFLSWMPAALKMPESELIDHAGFDSAVYLRIYLIGLKIFVPIALLSWSI  120

Query  529  L  531
            L
Sbjct  121  L  121



>ref|XP_009625807.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
 ref|XP_009625808.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
Length=750

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+  D+ ++A +N+L+AF FLVAFAILRLQPFNDRVYF KWYLKG+R+SP  SGAFV++
Sbjct  1    MASSDDILLSAVLNLLSAFAFLVAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYLLGLKIFVPIAL S+ VL
Sbjct  61   FVNLDCRTYIRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPIALFSFGVL  120



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAF  +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVN D+R+Y+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW+VL
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSVL  120



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+A IFL+ FAILR+QPFNDRVYFPKWYLKG+RSSP  SGAF  +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVN D+R+Y+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW+VL
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSVL  120



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++GD+GV AAINIL+AF F + FA+LR+QP NDRVYFPKWY+KGLR SP  SGA V R
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALVGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLD+RSY++FLNWM  AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L++ ++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAFTIM  120



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++GD+GV AAINIL+AF F + FA+LR+QP NDRVYFPKWY+KGLR SP  SGA V R
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALVGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            IVNLD+RSY++FLNWM  AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L++ ++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAFTIM  120



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+ V+AAINIL+A  FLVAFAILRLQP NDRVYFPKWYLKG+R SP++SG F   
Sbjct  1    MASLQDISVSAAINILSAIAFLVAFAILRLQPINDRVYFPKWYLKGIRGSPTRSGGFAST  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y+RFL+WMP AL+MPEPELIDHAGLDSA Y+RIYLLGLKIFVPI  L++AVL
Sbjct  61   FVNLDFRTYIRFLSWMPAALRMPEPELIDHAGLDSAAYIRIYLLGLKIFVPITFLAFAVL  120



>emb|CDY49293.1| BnaC01g22480D [Brassica napus]
Length=756

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLRSS  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+ HAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>emb|CDY22920.1| BnaA01g18580D [Brassica napus]
Length=756

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+ HAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M TL D+GVAAAINI +A +F VAFAILRLQP+NDRVYFPKWYLKGLR+ P      V +
Sbjct  1    MTTLSDIGVAAAINISSALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRPLVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLDWR+Y+  LNWMPEAL+MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L+W VL
Sbjct  61   FINLDWRAYLGSLNWMPEALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWIVL  120



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+ HAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+ HAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_009147369.1| PREDICTED: CSC1-like protein At4g15430 isoform X3 [Brassica rapa]
Length=756

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+GVAAAINI+TA  FL+AFAILR+QP NDRVYFPKWYLKGLR+S  Q+G F  +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSYVRFLNWMPEALKMPEPEL+ HAGLDS VYLRIYLLGLKIF PIA +++  +
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAFTAM  120



>ref|XP_010278611.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Nelumbo nucifera]
Length=607

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+A IN+L+A  FLVAFA+LRLQPFNDRVYFPKWYLKG+RS P+ SGAF  +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y  F NWMP ALKMPEPELIDHAGLDSAVY+RIYLLGLKIFVP+ +L++A+L
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAFAIL  120



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+AAIN+L+AF FLV FAILR+QP NDRVYFPKWY KG+RSSP+ SG F  +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP+ALKMPE EL+DHAGLDS  YLRIYLLGLKIFVP+A+L++ VL
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVL  120



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+  D+ ++A +N+L+AF FLVAFAILRLQP NDRVYF KWYLKG+R+SP  SG F+K+
Sbjct  1    MASSEDIILSAVLNLLSAFAFLVAFAILRLQPMNDRVYFSKWYLKGIRASPRTSGTFMKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELIDHAGLDSAVY+RIYLLGLKIFVP+ALLS+AVL
Sbjct  61   FVNLDCRTYLRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLALLSFAVL  120



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GV+AAINIL+A IFL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MATIEDIGVSAAINILSAIIFLLAFAFLRLQPINDRVYFPKWYLKGARQSPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP AL+MPE ELI HAGLDSAVYLRIYL+GLKIFVPI +L++ VL
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLIGLKIFVPITILAFVVL  120



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+AAIN+L+AF FLV FAILR+QP NDRVYFPKWY KG+RSSP+ SG F  +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP+ALKMPE EL+DHAGLDS  YLRIYLLGLKIFVP+A+L++ VL
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVL  120



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+A IN+L+A  FLVAFA+LRLQPFNDRVYFPKWYLKG+RS P+ SGAF  +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y  F NWMP ALKMPEPELIDHAGLDSAVY+RIYLLGLKIFVP+ +L++A+L
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAFAIL  120



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F  AFAILR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+RSYVRFLNWMP AL MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L++ +L
Sbjct  61   VVNLDFRSYVRFLNWMPAALHMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAFTIL  120



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+A IN+L+A  FLVAFA+LRLQPFNDRVYFPKWYLKG+RS P+ SGAF  +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y  F NWMP ALKMPEPELIDHAGLDSAVY+RIYLLGLKIFVP+ +L++A+L
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAFAIL  120



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+AAINIL+A  FLVAFA++RLQPFNDRVYFPKWYLKG+R SP+ SGA VK+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD ++Y++FLNWMP AL+MPEPELI+HAGLDSA Y+RIY+LGLKIFVPI  L+  VL
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAAYIRIYILGLKIFVPITALALIVL  120



>ref|XP_008234908.1| PREDICTED: uncharacterized protein RSN1 isoform X2 [Prunus mume]
Length=749

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V+AAINIL+A  FLVAFA++RLQPFNDRVYFPKWYLKG+R SP+ SGA VK+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD ++Y++FLNWMP AL+MPEPELI+HAGLDSA Y+RIY+LGLKIFVPI  L+  VL
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAAYIRIYILGLKIFVPITALALIVL  120



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF F +AFAILR+QP NDRVYFPKWYLKGLRSSP ++GAFV +
Sbjct  1    MATLNDIGIAAAINILSAFAFFIAFAILRIQPVNDRVYFPKWYLKGLRSSPHRTGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMPEAL+MPEPELIDHAGLDS VYLRIYLLG+KIF PIALL++ V+
Sbjct  61   FVNLDFRSYVRFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLLGIKIFFPIALLAFTVM  120



>ref|XP_006355875.1| PREDICTED: uncharacterized protein C354.08c-like [Solanum tuberosum]
Length=751

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+  D+ ++A +N+L+AF FLVAFAILRLQP NDRVYF KWYLKG+R+SP  SG FVK+
Sbjct  1    MASSEDIILSAVLNLLSAFAFLVAFAILRLQPINDRVYFSKWYLKGIRASPRSSGTFVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP AL+MPEPELI HAGLDSAVY+RIYLLGLKIFVP+ALLS+AVL
Sbjct  61   FVNLDCRTYIRFLNWMPAALRMPEPELIGHAGLDSAVYIRIYLLGLKIFVPLALLSFAVL  120



>ref|XP_006352784.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=766

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+ V+A IN+++A +FL+AFAI RLQP NDRVYFPKWYLKG+R+SP  SG+FV +
Sbjct  1    MASVQDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSFVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMP ALKMPE ELI HAGLDSAVY+RIYLLGLKIFVPI LLS+AVL
Sbjct  61   FVNLDLRTYIRFLNWMPAALKMPEQELIGHAGLDSAVYIRIYLLGLKIFVPITLLSFAVL  120



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GV+AAINIL+A IFL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MATIQDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGTRQSPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP AL+MPE ELI HAGLDSAVYLRIYL GLKIFVPI +L++ VL
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAFLVL  120



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G++AAINIL A IFL+AFA LRLQP NDRVYFPKWYLKG R SPS  G FV++
Sbjct  1    MATIKDIGLSAAINILGAIIFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP ALKMPE ELI HAGLDSAVYLRIYL+GLKIFVPI +L++AVL
Sbjct  61   FVNLDMRSYLKFLSWMPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFVPITILAFAVL  120



>ref|XP_006413690.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
 gb|ESQ55143.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
Length=771

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FAILRLQPFNDRVYF KWYLKGLRSSP++ GAFV+R
Sbjct  1    MATLQDIGVSAGINILSAFIFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPARGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMPEALKMPEPELI+HAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELINHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL  120



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F  AFAILR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP AL MPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L++ +L
Sbjct  61   FVNLDFRSYVRFLNWMPAALHMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAFTIL  120



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GV+AAINIL+A IFL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP AL+MPE ELI HAGLDSAVYLRIYL GLKIFVPI +L++ VL
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAFLVL  120



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+ V+A IN+++A +FL+AFAI RLQP NDRVYFPKWYLKG+R+SP  SG++V +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y+RFLNWMP ALKMPE ELI HAGLDSAVY+R+YLLGLKIFVPI LLS+AVL
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSFAVL  120



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 5/120 (4%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INI+TAFIF + FA+LRLQPFNDRVYF KWYLKGLRSSP+ SG F+  
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPA-SGGFL--  57

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
              NLD R+Y++FL+WMPEALKMPE ELIDHAGLDS VYLRIYLLGLKIF PIA+L+WAVL
Sbjct  58   --NLDLRAYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYLLGLKIFAPIAILAWAVL  115



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 5/120 (4%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INI+TAFIF + FA+LRLQPFNDRVYF KWYLKGLRSSP+ SG F+  
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPA-SGGFL--  57

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
              NLD R+Y++FL+WMPEALKMPE ELIDHAGLDS VYLRIYLLGLKIF PIA+L+WAVL
Sbjct  58   --NLDVRAYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYLLGLKIFAPIAILAWAVL  115



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FAILRLQPFNDRVYF KWYLKGLRSSP++ GAFV+R
Sbjct  1    MATLQDIGVSAGINILSAFIFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y++FLNWMP+ALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDFRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_010323041.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Solanum lycopersicum]
Length=688

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+ V+A IN+++A +FL+AFAI RLQP NDRVYFPKWYLKG+R+SP  SG++V +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y+RFLNWMP ALKMPE ELI HAGLDSAVY+R+YLLGLKIFVPI LLS+AVL
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSFAVL  120



>gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFA+LR+QP NDRVYFPKWY+KGLRSSP  +GAFV +
Sbjct  1    MATLSDIGVAAAINILTAFAFFLAFAVLRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             +NLD+RSY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA L++ +L
Sbjct  61   FMNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAFTIL  120



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G+AAAIN+L+A +FLVAFA+LRLQP NDRVYF KWYLKG RSSP+ SG FV +
Sbjct  1    MATITDIGLAAAINLLSALVFLVAFAVLRLQPINDRVYFSKWYLKGARSSPNHSGTFVHK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+ RSY+RFL WMP ALKMPE ELIDHAGLDSAV+LRIYL+GLKIF+PI +L+++VL
Sbjct  61   FVNLNLRSYLRFLEWMPAALKMPELELIDHAGLDSAVFLRIYLIGLKIFIPITILAFSVL  120



>ref|XP_010323040.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Solanum lycopersicum]
Length=704

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+ V+A IN+++A +FL+AFAI RLQP NDRVYFPKWYLKG+R+SP  SG++V +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+R+Y+RFLNWMP ALKMPE ELI HAGLDSAVY+R+YLLGLKIFVPI LLS+AVL
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSFAVL  120



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 5/120 (4%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INI+TAFIF + FA+LRLQPFNDRVYF KWYLKGLRSSP+ SG F+  
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPA-SGGFL--  57

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
              NLD R+Y++FL+WMPEALKMPE ELIDHAGLDS VYLRIYLLGLKIF PIA+L+WAVL
Sbjct  58   --NLDLRAYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYLLGLKIFAPIAILAWAVL  115



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINIL+AF+F V FA+LRLQPFNDRVYFPKWYLKGLR+SP++ G F ++
Sbjct  1    MATLADIGLAAAINILSAFVFFVVFAVLRLQPFNDRVYFPKWYLKGLRTSPARGGPFARK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMP+ALKMPE ELI+HAGLDSAVYLRIYLLGLK+FVP+ALL+W +L
Sbjct  61   FVNLDFRSYIKFLNWMPDALKMPEQELIEHAGLDSAVYLRIYLLGLKVFVPMALLAWTIL  120



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INI+TA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INI+TA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATLGD+GVAA INI+TA IFL+AFAILR+QPFNDRVYFPKWYLKG+RSSP  SGA V +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN++  SY+RFLNWMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIALL+W++L
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL  120



>emb|CDX76386.1| BnaA08g10140D [Brassica napus]
Length=699

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INIL+AFIF + FAILRLQPFNDRVYF KWYLKGLRSSP++ GAFV+R
Sbjct  1    MATLQDIGVSAGINILSAFIFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y++FLNWMP+ALKMPEPELIDHAGLDS VYLRIY LGLKIF PIA+L+WAVL
Sbjct  61   FVNLDLRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAWAVL  120



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+G+AAAINIL+AF F +AFA+LRLQP NDRVYFPKWYLKG+RSSP+ SG FV++
Sbjct  1    MASLTDIGLAAAINILSAFAFFLAFAVLRLQPINDRVYFPKWYLKGVRSSPTHSGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY+RFL WMP ALKMPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA+L++AVL
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIAILAFAVL  120



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSG-AFVK  348
            MATL D+GVAAAINILTA  F +AFA+LR+QP NDRVYFPKWY+KGLRSSP  +G AF  
Sbjct  1    MATLNDIGVAAAINILTALAFFLAFAMLRIQPVNDRVYFPKWYIKGLRSSPLVNGSAFAS  60

Query  349  RIVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
            + VNLD RSY RFLNWMP AL+MPEPELIDHAGLDSAVYLRIY LGLKIF PI L ++ V
Sbjct  61   KFVNLDLRSYTRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYFLGLKIFGPIELTAFTV  120

Query  529  L  531
            +
Sbjct  121  M  121



>gb|KEH23730.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=764

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A IN+ +A +FL+AFA+LRLQPFNDRVYFPKWYLKG+RSSP+ S + VK+
Sbjct  1    MATLVDIGVSAGINLFSATMFLLAFAVLRLQPFNDRVYFPKWYLKGIRSSPTNSRSIVKK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+ +Y+RFLNWMP AL MPEPELIDHAGLDSAV++RIY+LG+KIF P  LL++ VL
Sbjct  61   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVFIRIYILGVKIFAPTTLLAFMVL  120



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP +SG F  +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKSGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSG-AFVK  348
            MATL D+GVAAAINILTA  F +AFA+LR+QP NDRVYFPKWY+KGLRSSP  +G AF  
Sbjct  1    MATLNDIGVAAAINILTALAFFLAFAMLRIQPVNDRVYFPKWYIKGLRSSPLVNGSAFAS  60

Query  349  RIVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAV  528
            + VNLD RSY RFLNWMP AL+MPEPELIDHAGLDSAVYLRIY LGLKIF PI L ++ V
Sbjct  61   KFVNLDLRSYTRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYFLGLKIFGPIELTAFTV  120

Query  529  L  531
            +
Sbjct  121  M  121



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF F +AFAILR+QP NDRVYFPKWYLKGLR SP  +GAFV +
Sbjct  1    MATLSDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRCSPLANGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY RFLNWMP AL+MPEPELIDHAGLDSAVYLRIYLLGLKIFVPIA L++ ++
Sbjct  61   FVNLDFRSYARFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAFTIM  120



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA++ D+G++AAIN L+A  FLVAFA+LRLQP NDRVYF KWYLK +RSSP++SG FV++
Sbjct  1    MASISDIGLSAAINFLSALAFLVAFAVLRLQPINDRVYFSKWYLKRIRSSPTRSGTFVQK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+ RSY++FL WMP ALKMPEPELIDHAGLDSAV+LRIYL+GLKIF+PI +L+++VL
Sbjct  61   FVNLNLRSYLKFLEWMPAALKMPEPELIDHAGLDSAVFLRIYLIGLKIFIPITILAFSVL  120



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G F  +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFA LRLQP NDRVYFPKWYLKGLRSSP ++G F  +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAFLRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+ FAILR+QP NDRVYFPKWYLKGLRSSP  SGAFV +
Sbjct  1    MATLSDIGVAAAINILSALIFLLLFAILRIQPINDRVYFPKWYLKGLRSSPVTSGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            I N D+ SY+RFLNW+P ALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW+VL
Sbjct  61   IANFDFGSYLRFLNWIPAALKMPEAELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSVL  120



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+ FAILR+QP NDRVYFPKWYLKGLRSSP  SGAFV +
Sbjct  1    MATLSDIGVAAAINILSALIFLLLFAILRIQPINDRVYFPKWYLKGLRSSPVTSGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            I N D+ SY+RFLNW+P ALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW+VL
Sbjct  61   IANFDFGSYLRFLNWIPAALKMPEAELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSVL  120



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+A IFL+ FAILR+QP NDRVYFPKWYLKGLRSSP  SGAFV +
Sbjct  1    MATLSDIGVAAAINILSALIFLLLFAILRIQPINDRVYFPKWYLKGLRSSPVTSGAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            + N D+ SY+RFLNW+P ALKMPE ELIDHAGLDSAVYLRIYL+GLKIFVPIALLSW++L
Sbjct  61   VANFDFGSYIRFLNWIPAALKMPEAELIDHAGLDSAVYLRIYLIGLKIFVPIALLSWSIL  120



>ref|XP_002533077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29316.1| conserved hypothetical protein [Ricinus communis]
Length=756

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+G +AA+N+L+A  FL+AFAILRLQP NDRVYFPKWYLKG+R+SP+ S AFV +
Sbjct  1    MANLQDIGYSAAVNLLSAIAFLIAFAILRLQPINDRVYFPKWYLKGIRASPTHSRAFVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD ++Y+RFLNWMP AL+MPE ELIDHAGLDS VY+RIYLLGLKIFVPI +L++ VL
Sbjct  61   FVNLDAKTYIRFLNWMPAALRMPELELIDHAGLDSVVYIRIYLLGLKIFVPITVLAFGVL  120



>ref|XP_008386531.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=757

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA   D+ ++AAINIL+AF FLVAF +LRLQPFNDRVYFPKWYLKG+R SP+ SGA V++
Sbjct  1    MANFQDIMMSAAINILSAFGFLVAFGLLRLQPFNDRVYFPKWYLKGMRGSPTSSGATVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD ++Y +FLNWMP AL+MPEPELIDHAGLDSA Y+RIY+LGLKIFVPI  L+  VL
Sbjct  61   FVNLDAKTYFKFLNWMPAALRMPEPELIDHAGLDSAAYIRIYVLGLKIFVPITALALGVL  120



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINIL+AF F +AFAILR+QP NDRVYFPKWYLKGLRSSP  +GAFV +
Sbjct  1    MATLNDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRSSPLANGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSYVRFLNWMP AL+MPEPELIDHAGLDSAVYLRIY+LGLKIF PIA L++ ++
Sbjct  61   FVNLDLRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYMLGLKIFGPIAFLAFTIM  120



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G AAAINILTAF F +AFA+LRLQP NDRVYFPKWY+KGLRSSP ++G F  +
Sbjct  1    MATLSDIGFAAAINILTAFAFFIAFAVLRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>ref|XP_010684236.1| PREDICTED: CSC1-like protein At4g02900 [Beta vulgaris subsp. 
vulgaris]
Length=755

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M  L  +G++AA+N+L+A +FL+ FAILRLQP NDRVYFPKWYLKG+R++P+ S   V +
Sbjct  1    MTDLQGIGISAAVNLLSALVFLIVFAILRLQPINDRVYFPKWYLKGIRATPTHSRGLVNK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+RFLNWMPEAL+MPEPELI+HAGLDS  Y+RIYLLGLKIFVPIA+L++AVL
Sbjct  61   FVNLDLRTYLRFLNWMPEALRMPEPELIEHAGLDSVAYIRIYLLGLKIFVPIAVLAFAVL  120



>gb|KHG17938.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=756

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+  +A+IN+L+AF FL+AFAILR+QPFNDRVYFP+WY KG RSSP++SGA+  +
Sbjct  1    MASLRDIVTSASINLLSAFGFLMAFAILRIQPFNDRVYFPRWYKKGTRSSPTRSGAYASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD R+Y+ FLNWMP AL+MPEPELIDHAGLDS  Y+RIYLLGLKIFVP+A+LS+ VL
Sbjct  61   FVNLDCRTYLNFLNWMPAALRMPEPELIDHAGLDSVAYIRIYLLGLKIFVPLAVLSFMVL  120



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+GV+AAINIL+A  FL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MATIQDIGVSAAINILSAITFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++ L+WMP ALKMPE ELI HAGLDSAVYLRIYL+GLKIF PI +L++ +L
Sbjct  61   FVNLDMRSYLKVLSWMPAALKMPEDELISHAGLDSAVYLRIYLIGLKIFAPITVLAFIIL  120



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+ VAA+INIL+AF F VAFAILR+QP NDRVYFPKWYLKGLRSSP QSGAFV +
Sbjct  1    MATIADISVAASINILSAFAFFVAFAILRIQPINDRVYFPKWYLKGLRSSPLQSGAFVHK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+ SY+RFLNWMP A++MPEPELIDHAGLDSAVYLRIYL GLKIFVPIA++++ V+
Sbjct  61   FVNLDFHSYLRFLNWMPAAMRMPEPELIDHAGLDSAVYLRIYLTGLKIFVPIAVIAFTVM  120



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAA INILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G F  +
Sbjct  1    MATLTDIGVAATINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G++AAINIL A +FL+AFA LRLQP NDRVYFPKWYLKG R SPS  G FV++
Sbjct  1    MATIQDIGLSAAINILGAVVFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMP ALKMPE ELI H+GLDSAVYLRIYL+GLKIF PI++L++ VL
Sbjct  61   FVNLDMRSYLKFLSWMPAALKMPEDELISHSGLDSAVYLRIYLVGLKIFAPISVLAFIVL  120



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G++AAINI+ A +FLVAFA LRLQP NDRVYFPKWYLKG R SPS  G FV++
Sbjct  1    MATIQDIGLSAAINIMGAVVFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+W+P ALKMPE ELI HAGLDSAVYLRIYL+GLKIF PI++L++ VL
Sbjct  61   FVNLDMRSYLKFLSWVPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFAPISVLAFIVL  120



>ref|XP_004292602.1| PREDICTED: CSC1-like protein At4g02900 [Fragaria vesca subsp. 
vesca]
Length=759

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L  +  +AAIN+LTAF FLVAFA+LRLQPFNDRVYFPKWYLKG+R SP+ SG  V++
Sbjct  1    MANLTAILTSAAINLLTAFGFLVAFALLRLQPFNDRVYFPKWYLKGIRGSPTSSGTVVQK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD  +YV+FLNWMP AL+MPEPELI+HAGLDSA Y+RIYLLGLKIF PI ++S AVL
Sbjct  61   FVNLDIMTYVKFLNWMPAALRMPEPELIEHAGLDSAAYIRIYLLGLKIFFPITIVSLAVL  120



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AAAINILTAF F VAFAILRLQP NDRVYFPKWYLKGLR+SP   GAFV +
Sbjct  1    MATLSDIGMAAAINILTAFAFFVAFAILRLQPVNDRVYFPKWYLKGLRASP-LGGAFVSK  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY+RFLNWMP AL+MPEPEL+DHAGLDSAVYLRIYL GLKIFVPI LL+++V+
Sbjct  60   FVNLDYRSYMRFLNWMPAALQMPEPELVDHAGLDSAVYLRIYLTGLKIFVPITLLAFSVM  119



>gb|AFW78070.1| hypothetical protein ZEAMMB73_829601 [Zea mays]
Length=748

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M +L D+GV+A +NIL+A  FL+AFA+LR+QP NDRVYFPKWYLKG RSSP Q G    +
Sbjct  1    MGSLTDIGVSAGLNILSAVGFLLAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGNVFLK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN D+ +Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLKIFVPIALL++AVL
Sbjct  61   FVNADFSTYIRFLNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFAVL  120



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G AAAINILTAF F +AFAILRLQP NDRVYFPKWY+KGLRSSP ++G F  +
Sbjct  1    MATLSDIGFAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>gb|AAM74515.1| hv711N16.16 [Hordeum vulgare subsp. vulgare]
Length=234

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G+ A  NIL A IFL+ FA LRLQP NDR++FPKWYLKG+R SPS +GA V +
Sbjct  1    MATIYDIGLGAGFNILMATIFLLIFAFLRLQPINDRIFFPKWYLKGMRDSPSSAGAAVTK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNL+ RSY++FL+WMP ALKMPE ELI+HAGLDS VYLRIYL GLKIFVPI +L++AVL
Sbjct  61   YVNLNVRSYLKFLSWMPAALKMPEEELIEHAGLDSVVYLRIYLTGLKIFVPITILAFAVL  120



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G    +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA L++ V+
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAFTVM  120



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G    +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA L++ V+
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAFTVM  120



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G AA INILTAF F +AFA+LRLQP NDRVYFPKWY+KGLRSSP ++G F  +
Sbjct  1    MATLSDIGFAATINILTAFAFFIAFAVLRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA +++ V+
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM  120



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+ D+G++AAINI+ A +FLVAFA LRLQP NDRVYFPKWYLKG R SPS  G FV++
Sbjct  1    MATIQDIGLSAAINIMGAVLFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+W+P ALKMPE ELI HAGLDSAVYLRIYL+GLKIF PI++L++ VL
Sbjct  61   FVNLDMRSYLKFLSWVPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFAPISVLAFIVL  120



>gb|KHN19872.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=716

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+GD+ V+A+IN+L+A  FL AF ILRLQPFNDRVYFPKWYLKG+R SP+ S   VK+
Sbjct  1    MATIGDICVSASINLLSALAFLFAFGILRLQPFNDRVYFPKWYLKGIRGSPTGSNR-VKK  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+ +Y+RFLNWMP AL MPEPELIDHAGLDSAVY+RIYLLG+KIF PI LL++ VL
Sbjct  60   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVYIRIYLLGVKIFAPITLLAFMVL  119



>ref|XP_008649660.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Zea mays]
Length=768

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M +L D+GV+A +NIL+A  FL+AFA+LR+QP NDRVYFPKWYLKG RSSP Q G    +
Sbjct  1    MGSLTDIGVSAGLNILSAVGFLLAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGNVFLK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN D+ +Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLKIFVPIALL++AVL
Sbjct  61   FVNADFSTYIRFLNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFAVL  120



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GVAAAINILTAF F +AFAILRLQP NDRVYFPKWYLKGLRSSP ++G    +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSY++FLNWMP+AL+MPEPELIDHAGLDS VYLRIYLLGLKIF PIA L++ V+
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAFTVM  120



>ref|XP_003520558.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=756

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MAT+GD+ V+A+IN+L+A  FL AF ILRLQPFNDRVYFPKWYLKG+R SP+ S   VK+
Sbjct  1    MATIGDICVSASINLLSALAFLFAFGILRLQPFNDRVYFPKWYLKGIRGSPTGSNR-VKK  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+ +Y+RFLNWMP AL MPEPELIDHAGLDSAVY+RIYLLG+KIF PI LL++ VL
Sbjct  60   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVYIRIYLLGVKIFAPITLLAFMVL  119



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AA INI TAFIF V FA LRLQPFNDRVYF KWYL+GLRSSP+ SG F  R
Sbjct  1    MATLEDIGLAAGINIFTAFIFFVIFAFLRLQPFNDRVYFSKWYLRGLRSSPASSGGFAGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMPEALKMPE ELIDHAGLDS VYLRIYLLGLKIF PIA+L+WAVL
Sbjct  61   FVNLDVRSYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYLLGLKIFAPIAILAWAVL  120



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M +L D+GV+A +NIL+A  FL+AFA+LR+QP NDRVYFPKWYLKG RSSP Q G    +
Sbjct  1    MGSLTDIGVSAGLNILSAVGFLLAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGTAFSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN D  +Y+RFLNWMP ALKMPEPELI+HAGLDSAVY+RIYLLGLKIFVPIALL+++VL
Sbjct  61   FVNADLSTYIRFLNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFSVL  120



>ref|XP_008451393.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X3 [Cucumis melo]
Length=745

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+A IN+L+A  FLVAFA+LRLQP NDRVYFPKWYLKG+R SP +SG  V  
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSGH-VHD  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+  Y+RFLNWMP ALKMPEPEL++HAGLDSAV++RIYLLGLKIFVPI  L++AVL
Sbjct  60   VVNLDFNMYIRFLNWMPAALKMPEPELVEHAGLDSAVFVRIYLLGLKIFVPITFLAFAVL  119



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+A IN+L+A  FLVAFA+LRLQP NDRVYFPKWYLKG+R SP +SG  V  
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG-HVHD  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+  Y+RFLNWMP ALKMPEPEL++HAGLDSAV++RIYLLGLKIFVPI  L++AVL
Sbjct  60   VVNLDFNMYIRFLNWMPAALKMPEPELVEHAGLDSAVFVRIYLLGLKIFVPITFLAFAVL  119



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+G+AA INI TAFIF V FA LRLQPFNDRVYF KWYL+GLRSSP+ SG F  R
Sbjct  1    MATLRDIGLAAGINIFTAFIFFVIFAFLRLQPFNDRVYFSKWYLRGLRSSPASSGGFAGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMPEALKMPE ELIDHAGLDS VYLRIYLLGLKIF PIA+L+WAVL
Sbjct  61   FVNLDVRSYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYLLGLKIFAPIAILAWAVL  120



>ref|XP_004293316.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=734

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV AAINIL+AF+F + FA LRLQP NDRVYF KWYLKG R SP+ SG F  +
Sbjct  1    MATLWDIGVGAAINILSAFVFFIIFAFLRLQPCNDRVYFAKWYLKGERGSPTSSGTFGSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNW+PEALKMPEPELIDHAGLDSAVYLRIYL+GLKIFVPIA ++W +L
Sbjct  61   FVNLDYRSYVRFLNWVPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFVAWVIL  120



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+A IN+L+A  FLVAFA+LRLQP NDRVYFPKWYLKG+R SP +SG  V  
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG-HVHD  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+  Y+RFLNWMP ALKMPEPEL++HAGLDSAV++RIYLLGLKIFVPI  L++AVL
Sbjct  60   VVNLDFNMYIRFLNWMPAALKMPEPELVEHAGLDSAVFVRIYLLGLKIFVPITFLAFAVL  119



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA+L D+  +A  N+L+AF+FL+AFA+LR+QPFNDRVYFPKWYLKGLRSSP  +GAFV +
Sbjct  1    MASLSDIAFSAGFNLLSAFVFLLAFALLRIQPFNDRVYFPKWYLKGLRSSPLHTGAFVSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIF  498
            +VNLD++SY+RFLNWMP+A+KMPE ELI+HAGLDSAVYLRIYL+GLKIF
Sbjct  61   VVNLDFKSYLRFLNWMPDAMKMPESELIEHAGLDSAVYLRIYLIGLKIF  109



>ref|XP_004136187.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN44866.1| hypothetical protein Csa_7G392390 [Cucumis sativus]
Length=756

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+A IN+L+A  FLVAFA+LRLQP NDRVYFPKWYLKG+R SP +SG  V  
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG-HVHN  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+  Y+RFLNWMP ALKMP+PELI+HAGLDSAV++RIYLLGLKIFVPI  L++AVL
Sbjct  60   VVNLDFNMYIRFLNWMPAALKMPQPELIEHAGLDSAVFVRIYLLGLKIFVPITFLAFAVL  119



>ref|XP_004164564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
Length=755

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA L D+GV+A IN+L+A  FLVAFA+LRLQP NDRVYFPKWYLKG+R SP +SG  V  
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG-HVHN  59

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
            +VNLD+  Y+RFLNWMP ALKMP+PELI+HAGLDSAV++RIYLLGLKIFVPI  L++AVL
Sbjct  60   VVNLDFNMYIRFLNWMPAALKMPQPELIEHAGLDSAVFVRIYLLGLKIFVPITFLAFAVL  119



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+GV+A INILTAFIF + FA LRLQPFNDRVYF KWYLKGLRSSP+  G F  R
Sbjct  1    MATLQDIGVSAGINILTAFIFFIIFAFLRLQPFNDRVYFSKWYLKGLRSSPASGGGFAGR  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++FL+WMPEALKMPE ELIDHAGLDS VYLRIY LGLKIF PIA+L+WA+L
Sbjct  61   FVNLDLRSYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAMLAWAIL  120



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            M +L D+GVAA INIL+A  FL+AFA+LR+QP NDRVYFPKWYLKG RSSP   G  + +
Sbjct  1    MGSLNDIGVAAGINILSALGFLLAFAVLRIQPINDRVYFPKWYLKGTRSSPRSIGTVLSK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VN D  +Y+RFLNWMP AL+MPEPELI+HAGLDSAVY+RIYLLGLKIFVPIA+L++ VL
Sbjct  61   FVNADLSTYIRFLNWMPAALQMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIAVLAFIVL  120



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MATL D+ V AAINIL+AF F +AFAILR+QP NDRVYFPKWYLKGLR SP + GAF+ +
Sbjct  1    MATLNDIAVGAAINILSAFAFFIAFAILRIQPVNDRVYFPKWYLKGLRFSPLRGGAFINK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD+RSYVRFLNWMP AL+MPEPELIDHAGLDSAVYLRIYL GLKIF PIA LS+A++
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLTGLKIFTPIAFLSFAIM  120



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  172  MATLGDMGVAAAINILTAFIFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPSQSGAFVKR  351
            MA + D+G++AAINIL+A  FL+AFA LRLQP NDRVYFPKWYLKG R SPS  GAFV++
Sbjct  1    MANIQDIGLSAAINILSAITFLLAFAFLRLQPINDRVYFPKWYLKGSRESPSHGGAFVRK  60

Query  352  IVNLDWRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIALLSWAVL  531
             VNLD RSY++ L+WMP ALKMPE ELI HAGLDSAVYLRIYL+GLKIF PI +L++ +L
Sbjct  61   FVNLDMRSYLKVLSWMPAALKMPEDELISHAGLDSAVYLRIYLIGLKIFAPITILAFIIL  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200