BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025E13

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL00957.1|  sucrose synthase                                        193   5e-54   Ipomoea batatas [batate]
gb|AAA63685.1|  sucrose synthase                                        171   3e-50   Solanum tuberosum [potatoes]
dbj|BAP82380.1|  sucrose synthase                                       173   3e-50   Phelipanche aegyptiaca
ref|NP_001274911.1|  sucrose synthase 2                                 180   3e-49   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    180   3e-49   Solanum tuberosum [potatoes]
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           180   3e-49   
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             179   7e-49   
ref|NP_001234804.1|  sucrose synthase                                   179   8e-49   
gb|AEN79500.1|  sucrose synthase 1                                      178   2e-48   Phelipanche ramosa
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        177   3e-48   Sesamum indicum [beniseed]
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        176   8e-48   Nicotiana tomentosiformis
gb|AHL84158.1|  sucrose synthase                                        176   8e-48   Nicotiana tabacum [American tobacco]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        176   1e-47   Nicotiana tomentosiformis
gb|ABV02029.1|  sucrose sythase                                         176   1e-47   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        175   2e-47   Nicotiana sylvestris
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        174   4e-47   
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        174   5e-47   Nicotiana sylvestris
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    171   7e-46   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            171   8e-46   Solanum tuberosum [potatoes]
ref|NP_001275286.1|  sucrose synthase                                   171   8e-46   Solanum tuberosum [potatoes]
gb|AAA97571.1|  sucrose synthase                                        171   8e-46   Solanum tuberosum [potatoes]
gb|ABI17891.1|  sucrose synthase                                        170   1e-45   Coffea canephora [robusta coffee]
emb|CAI56307.1|  sucrose synthase                                       170   1e-45   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       170   1e-45   Coffea arabica [arabica coffee]
emb|CAA09681.1|  sucrose synthase                                       169   3e-45   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   169   3e-45   
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                166   7e-44   Erythranthe guttata [common monkey flower]
gb|ABD61653.1|  sucrose synthase                                        160   8e-42   Cichorium intybus [radicchio]
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    156   2e-40   Daucus carota [carrots]
gb|AFO84090.1|  sucrose synthase                                        155   3e-40   Actinidia chinensis
ref|XP_010107074.1|  Sucrose synthase                                   149   5e-38   Morus notabilis
gb|AHL29281.1|  sucrose synthase 1                                      148   1e-37   Camellia sinensis [black tea]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        143   5e-36   Malus domestica [apple tree]
gb|KDO73787.1|  hypothetical protein CISIN_1g003661mg                   141   7e-36   Citrus sinensis [apfelsine]
gb|KDO73786.1|  hypothetical protein CISIN_1g003661mg                   141   2e-35   Citrus sinensis [apfelsine]
dbj|BAM68526.1|  sucrose synthase                                       142   2e-35   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                       142   2e-35   Mangifera indica
dbj|BAM68521.1|  sucrose synthase                                       142   2e-35   Mangifera indica
dbj|BAM68520.1|  sucrose synthase                                       142   2e-35   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       142   2e-35   Mangifera indica
gb|AFY03624.1|  sucrose synthase                                        136   2e-35   Eucalyptus globulus [blue gum]
dbj|BAM05649.1|  sucrose synthase 3                                     142   2e-35   Eucalyptus globulus subsp. globulus
dbj|BAM05650.1|  sucrose synthase 3                                     142   2e-35   Eucalyptus pilularis
dbj|BAM05652.1|  sucrose synthase 3                                     142   2e-35   Eucalyptus globulus subsp. globulus
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             141   3e-35   Citrus clementina [clementine]
dbj|BAA89049.1|  sucrose synthase                                       141   3e-35   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        141   3e-35   Citrus sinensis [apfelsine]
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        141   3e-35   Eucalyptus grandis [rose gum]
gb|AAD09568.1|  sucrose synthase                                        139   3e-35   Gossypium hirsutum [American cotton]
emb|CAN82840.1|  hypothetical protein VITISV_024563                     141   4e-35   Vitis vinifera
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        141   4e-35   Vitis vinifera
gb|AIJ28960.1|  sucrose synthase                                        141   4e-35   Manihot esculenta subsp. flabellifolia
gb|KJB82966.1|  hypothetical protein B456_013G222400                    141   4e-35   Gossypium raimondii
gb|AEK81522.1|  sucrose synthase isoform D                              141   4e-35   Gossypium hirsutum [American cotton]
gb|AIJ28962.1|  sucrose synthase                                        141   4e-35   Manihot esculenta [manioc]
gb|AEV40460.1|  sucrose synthase 1                                      141   4e-35   Gossypium arboreum [tree cotton]
gb|AFR41747.1|  sucrose synthase                                        130   5e-35   Populus trichocarpa [western balsam poplar]
gb|KJB82967.1|  hypothetical protein B456_013G222400                    140   5e-35   Gossypium raimondii
gb|AFR41743.1|  sucrose synthase                                        130   5e-35   Populus trichocarpa [western balsam poplar]
gb|KHG00606.1|  Sucrose synthase                                        140   5e-35   Gossypium arboreum [tree cotton]
gb|AFR41749.1|  sucrose synthase                                        130   6e-35   Populus alba [abele]
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        140   6e-35   
ref|NP_001289655.1|  sucrose synthase                                   140   1e-34   Eucalyptus grandis [rose gum]
gb|AFY03626.1|  sucrose synthase                                        140   1e-34   Eucalyptus globulus [blue gum]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   140   1e-34   Pyrus x bretschneideri [bai li]
gb|AFR41760.1|  sucrose synthase                                        129   1e-34   Populus nigra [black poplar]
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   140   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   139   1e-34   
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   139   1e-34   
ref|NP_001289661.1|  sucrose synthase-like                              139   1e-34   Eucalyptus grandis [rose gum]
gb|AGQ57012.1|  sucrose synthase 1                                      139   1e-34   Hevea brasiliensis [jebe]
dbj|BAM05651.1|  sucrose synthase 3                                     139   1e-34   Eucalyptus pyrocarpa
gb|AGM14949.1|  sucrose synthase 4                                      139   1e-34   Hevea brasiliensis [jebe]
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   139   1e-34   Eucalyptus grandis [rose gum]
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     139   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        139   2e-34   Cucumis melo [Oriental melon]
gb|AFR41742.1|  sucrose synthase                                        129   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       139   2e-34   
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        139   2e-34   Pyrus x bretschneideri [bai li]
dbj|BAA89232.1|  wsus                                                   139   2e-34   Citrullus lanatus [wild melon]
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       139   2e-34   Theobroma cacao [chocolate]
gb|AFR41753.1|  sucrose synthase                                        128   3e-34   Populus alba [abele]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   139   3e-34   Pyrus x bretschneideri [bai li]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       138   3e-34   Cucumis sativus [cucumbers]
gb|AEN83999.1|  sucrose synthase                                        138   4e-34   Cucumis sativus [cucumbers]
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   138   4e-34   Cucumis sativus [cucumbers]
dbj|BAA88905.1|  sucrose synthase                                       138   4e-34   Citrus unshiu [satsuma mandarin]
gb|AFR41759.1|  sucrose synthase                                        128   4e-34   Populus fremontii
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        138   6e-34   
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   137   6e-34   
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    137   7e-34   Vicia faba [broad bean]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        137   8e-34   
gb|AEV40463.1|  sucrose synthase 4                                      137   8e-34   Gossypium arboreum [tree cotton]
gb|AEK81520.1|  sucrose synthase isoform B                              137   9e-34   Gossypium hirsutum [American cotton]
gb|KJB54540.1|  hypothetical protein B456_009G038000                    135   9e-34   Gossypium raimondii
gb|AFR41745.1|  sucrose synthase                                        127   9e-34   Populus trichocarpa [western balsam poplar]
gb|ADY68848.1|  sucrose synthase                                        137   1e-33   Gossypium hirsutum [American cotton]
gb|AEV40464.1|  sucrose synthase 5                                      137   1e-33   Gossypium arboreum [tree cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   137   1e-33   Gossypium mustelinum
gb|AEV40462.1|  sucrose synthase 3                                      137   1e-33   Gossypium arboreum [tree cotton]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        137   1e-33   Pisum sativum [garden pea]
gb|ADY68844.1|  sucrose synthase                                        137   1e-33   Gossypium barbadense [Egyptian cotton]
gb|ADY68846.1|  sucrose synthase                                        137   1e-33   Gossypium herbaceum subsp. africanum
gb|AAD28641.1|  sucrose synthase                                        137   1e-33   Gossypium hirsutum [American cotton]
emb|CAA09910.1|  sucrose synthase                                       137   1e-33   Pisum sativum [garden pea]
gb|AEF56625.1|  sucrose synthase                                        137   1e-33   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|KHN17754.1|  Sucrose synthase                                        137   1e-33   Glycine soja [wild soybean]
ref|NP_001237525.1|  sucrose synthase                                   137   1e-33   Glycine max [soybeans]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        137   1e-33   
gb|AFR41744.1|  sucrose synthase                                        125   4e-33   Populus trichocarpa [western balsam poplar]
gb|KJB54542.1|  hypothetical protein B456_009G038000                    135   4e-33   Gossypium raimondii
gb|AEN71075.1|  sucrose synthase Sus1                                   135   4e-33   Gossypium armourianum
gb|ADY68845.1|  sucrose synthase                                        135   4e-33   Gossypium barbadense [Egyptian cotton]
gb|AEN71061.1|  sucrose synthase Sus1                                   135   4e-33   Gossypium schwendimanii
gb|AEN71080.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium gossypioides
gb|AEN71059.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium thurberi
gb|ACV72640.1|  sucrose synthase 1                                      135   5e-33   Gossypium hirsutum [American cotton]
gb|AEN71079.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium aridum
gb|AEN71078.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium klotzschianum
gb|AEN71068.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium tomentosum
gb|AEN71060.1|  sucrose synthase Sus1                                   135   5e-33   Gossypium laxum
gb|KJB65375.1|  hypothetical protein B456_010G092300                    135   5e-33   Gossypium raimondii
gb|KJB54541.1|  hypothetical protein B456_009G038000                    135   5e-33   Gossypium raimondii
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        135   5e-33   Cicer arietinum [garbanzo]
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 135   5e-33   Tarenaya hassleriana [spider flower]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        135   5e-33   Cicer arietinum [garbanzo]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    135   6e-33   Gossypium raimondii
gb|KJB54539.1|  hypothetical protein B456_009G038000                    135   6e-33   Gossypium raimondii
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        135   6e-33   
dbj|BAH56282.1|  sucrose synthase                                       135   6e-33   Vigna angularis [azuki bean]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    135   7e-33   Vigna radiata var. radiata [golden gram]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    135   7e-33   Gossypium raimondii
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      134   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        134   2e-32   Nelumbo nucifera [Indian lotus]
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         134   2e-32   Jatropha curcas
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    134   2e-32   Medicago sativa [alfalfa]
gb|AIL23782.1|  sucrose synthase                                        133   2e-32   Prunus serrulata
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        133   3e-32   Prunus mume [ume]
gb|AFI57908.1|  sucrose synthase 1                                      133   3e-32   Prunus persica
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             133   3e-32   Prunus persica
gb|AII19313.1|  sucrose synthase 1                                      132   4e-32   Ricinus communis
ref|XP_002516210.1|  sucrose synthase, putative                         132   4e-32   
gb|AIJ28959.1|  sucrose synthase                                        132   4e-32   Manihot esculenta subsp. flabellifolia
gb|AES92143.2|  sucrose synthase                                        132   4e-32   Medicago truncatula
ref|XP_003609949.1|  Sucrose synthase                                   132   4e-32   Medicago truncatula
ref|XP_003609946.1|  Sucrose synthase                                   133   4e-32   
gb|AIJ28961.1|  sucrose synthase                                        132   4e-32   Manihot esculenta [manioc]
gb|ABD96570.1|  sucrose synthase                                        132   4e-32   Manihot esculenta [manioc]
emb|CAB40795.1|  sucrose synthase                                       132   4e-32   Medicago truncatula
gb|AEN71066.1|  sucrose synthase Sus1                                   132   5e-32   Gossypium darwinii
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        132   6e-32   Populus euphratica
gb|ADW80555.1|  sucrose synthase 1                                      132   7e-32   Populus tomentosa [Chinese white poplar]
gb|AGH29112.1|  sucrose synthase                                        132   7e-32   Jatropha curcas
gb|ADW80563.1|  sucrose synthase 1                                      132   8e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      132   8e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      132   8e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        131   9e-32   Nelumbo nucifera [Indian lotus]
gb|ADW80558.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80545.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      131   9e-32   Populus tomentosa [Chinese white poplar]
gb|AGM14948.1|  sucrose synthase 3                                      131   9e-32   Hevea brasiliensis [jebe]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             131   1e-31   Phaseolus vulgaris [French bean]
gb|AAN76498.1|AF315375_1  sucrose synthase                              131   1e-31   Phaseolus vulgaris [French bean]
gb|ADW80552.1|  sucrose synthase 1                                      131   1e-31   Populus tomentosa [Chinese white poplar]
gb|ABP88869.1|  sucrose synthase                                        131   2e-31   Medicago falcata [sickle alfalfa]
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        130   2e-31   Fragaria vesca subsp. vesca
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    130   2e-31   Alnus glutinosa
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        130   3e-31   Populus euphratica
gb|ADR81996.1|  sucrose synthase 1                                      130   3e-31   Populus trichocarpa [western balsam poplar]
gb|ADW80571.1|  sucrose synthase 1                                      130   4e-31   Populus tomentosa [Chinese white poplar]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             130   4e-31   Capsella rubella
gb|ADW80566.1|  sucrose synthase 1                                      130   4e-31   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      129   4e-31   Populus tomentosa [Chinese white poplar]
gb|AEN71067.1|  sucrose synthase Sus1                                   129   6e-31   Gossypium tomentosum
gb|AHA41509.1|  sucrose synthase                                        129   8e-31   Populus deltoides
ref|XP_002324136.2|  sucrose synthase family protein                    129   8e-31   
gb|AAR03498.1|  sucrose synthase                                        129   9e-31   Populus tremuloides
dbj|BAE99649.1|  sucrose synthase like protein                          125   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             128   2e-30   
gb|AAZ32907.1|  sucrose synthase                                        119   2e-30   Medicago sativa [alfalfa]
gb|AGV22112.1|  sucrose synthase 2                                      127   3e-30   Betula luminifera [liang ye hua]
emb|CAA57881.1|  sucrose synthase                                       127   4e-30   Oxybasis rubra [pigweed]
gb|ACR08725.1|  sucrose synthase                                        120   5e-30   Vigna luteola
gb|ADW80556.1|  sucrose synthase 1                                      126   6e-30   Populus tomentosa [Chinese white poplar]
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 126   6e-30   Camelina sativa [gold-of-pleasure]
gb|ADW80565.1|  sucrose synthase 1                                      126   6e-30   Populus tomentosa [Chinese white poplar]
gb|AAR19769.1|  sucrose synthase                                        126   7e-30   Beta vulgaris [beet]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    126   8e-30   Tulipa gesneriana
ref|NP_566865.2|  sucrose synthase 4                                    125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             125   1e-29   
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             125   2e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      125   2e-29   Camelina sativa [gold-of-pleasure]
dbj|BAM05645.1|  sucrose synthase 1                                     124   3e-29   Eucalyptus pilularis
gb|ABF50715.1|  sucrose synthase                                        124   3e-29   Viscum album subsp. album
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        124   3e-29   Glycine max [soybeans]
gb|KHN47619.1|  Sucrose synthase                                        124   3e-29   Glycine soja [wild soybean]
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        124   3e-29   
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        124   4e-29   
emb|CAA50317.1|  sucrose synthase                                       124   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        124   5e-29   
emb|CDX70945.1|  BnaC03g10290D                                          124   6e-29   
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      123   6e-29   Brassica rapa
gb|ADR81997.1|  sucrose synthase 2                                      123   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    123   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          123   7e-29   Amborella trichopoda
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        123   7e-29   Populus euphratica
gb|AGW23638.1|  sucrose synthase                                        123   7e-29   Lilium davidii
gb|AFS17277.1|  sucrose synthase 1                                      123   8e-29   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 123   9e-29   Elaeis guineensis
emb|CDY16569.1|  BnaC09g37040D                                          123   9e-29   Brassica napus [oilseed rape]
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      123   1e-28   Elaeis guineensis
gb|ADW80579.1|  sucrose synthase 2                                      122   1e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      122   1e-28   Populus tomentosa [Chinese white poplar]
emb|CDX92432.1|  BnaA10g14710D                                          122   1e-28   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      122   2e-28   Phoenix dactylifera
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      122   2e-28   Phoenix dactylifera
dbj|BAM05648.1|  sucrose synthase 1                                     122   2e-28   Eucalyptus globulus subsp. globulus
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    122   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197583.1|  sucrose synthase 1                                    122   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80586.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80603.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|KHN49081.1|  Sucrose synthase                                        122   2e-28   Glycine soja [wild soybean]
gb|ADW80611.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        122   2e-28   
gb|ADW80601.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80577.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    122   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80605.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80596.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      122   2e-28   Populus tomentosa [Chinese white poplar]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   122   3e-28   Eucalyptus grandis [rose gum]
gb|ADW80607.1|  sucrose synthase 2                                      122   3e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      122   3e-28   Populus tomentosa [Chinese white poplar]
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             121   3e-28   Eutrema salsugineum [saltwater cress]
gb|ADW80583.1|  sucrose synthase 2                                      121   4e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80602.1|  sucrose synthase 2                                      121   4e-28   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      121   5e-28   Populus tomentosa [Chinese white poplar]
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 120   8e-28   
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    120   1e-27   Brassica rapa
gb|ADY02961.1|  sucrose synthase                                        120   1e-27   Dendrobium officinale
gb|ACP17902.1|  sucrose synthase                                        119   1e-27   Phaseolus vulgaris [French bean]
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      119   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             119   1e-27   
gb|ADW80600.1|  sucrose synthase 2                                      119   2e-27   
gb|ABW76422.1|  sucrose synthase                                        119   2e-27   
gb|ADW80590.1|  sucrose synthase 2                                      119   2e-27   
dbj|BAE06059.1|  sucrose synthase                                       119   3e-27   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 118   5e-27   
gb|KEH37657.1|  sucrose synthase                                        117   6e-27   
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      117   7e-27   
gb|AAM95944.1|  sucrose synthase                                        117   1e-26   
gb|AFW88072.1|  sucrose synthase1                                       115   2e-26   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 116   2e-26   
gb|AEO09338.2|  sucrose synthase                                        116   2e-26   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 116   2e-26   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          116   2e-26   
gb|AGI56230.1|  sucrose synthase 1                                      116   2e-26   
gb|KCW81856.1|  hypothetical protein EUGRSUZ_C03207                     116   2e-26   
gb|AEA76429.1|  sucrose synthase 1                                      116   2e-26   
gb|AAM95943.1|  sucrose synthase                                        116   2e-26   
gb|AFW88071.1|  sucrose synthase1                                       115   2e-26   
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    116   2e-26   
prf||2008300A  sucrose synthase:ISOTYPE=2                               115   4e-26
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 115   4e-26   
emb|CAC32462.1|  sucrose synthase isoform 3                             115   4e-26   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           115   5e-26   
ref|NP_001105323.1|  sucrose synthase 2                                 115   5e-26   
gb|AAA68209.1|  sus1                                                    115   5e-26   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 115   6e-26   
gb|AIS75087.1|  sus1                                                    115   6e-26   
gb|AAV64256.2|  sucrose synthase                                        115   6e-26   
ref|XP_010049329.1|  PREDICTED: sucrose synthase-like                   115   6e-26   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          115   7e-26   
ref|NP_001060278.1|  Os07g0616800                                       115   7e-26   
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    114   8e-26   
gb|AIL88517.1|  sucrose synthase type 2-2                               114   1e-25   
gb|AIL88516.1|  sucrose synthase type 2-1                               114   1e-25   
gb|EMS65561.1|  Sucrose synthase 2                                      114   1e-25   
gb|EMT20174.1|  Sucrose synthase 2                                      113   2e-25   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      113   2e-25   
gb|AAC41682.1|  sucrose synthase 3                                      113   3e-25   
gb|AAL50570.1|AF412037_1  sucrose synthase                              113   3e-25   
ref|XP_009601288.1|  PREDICTED: sucrose synthase 2-like                 110   3e-25   
gb|ABF96469.1|  Sucrose synthase 2, putative, expressed                 111   5e-25   
emb|CAA03935.1|  sucrose synthase type 2                                112   5e-25   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      112   6e-25   
ref|XP_006650176.1|  PREDICTED: sucrose synthase 1-like isoform X1      111   1e-24   
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 111   1e-24   
ref|NP_001050319.1|  Os03g0401300                                       111   1e-24   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      111   1e-24   
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      111   1e-24   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    111   1e-24   
ref|XP_010558842.1|  PREDICTED: sucrose synthase 3-like                 105   1e-24   
ref|XP_010088308.1|  Sucrose synthase 2                                 103   2e-24   
emb|CAA75793.1|  sucrose synthase 2                                     110   2e-24   
gb|AAL50572.2|AF412039_1  sucrose synthase                              110   2e-24   
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           110   2e-24   
ref|NP_001266691.1|  sucrose synthase 1                                 110   2e-24   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 110   2e-24   
ref|NP_001105411.1|  sucrose synthase 1                                 110   2e-24   
gb|AFW85475.1|  shrunken1 isoform 1                                     110   2e-24   
gb|AAL50571.1|AF412038_1  sucrose synthase                              110   2e-24   
ref|XP_007050987.1|  Sucrose synthase 3 isoform 4                       110   3e-24   
gb|EAY90371.1|  hypothetical protein OsI_11950                          110   3e-24   
gb|AIO11845.1|  sucrose synthase                                        110   3e-24   
emb|CAA04543.1|  sucrose synthase type I                                110   3e-24   
dbj|BAJ99820.1|  predicted protein                                      110   3e-24   
gb|AEX98033.1|  sucrose synthase                                        110   3e-24   
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            110   3e-24   
gb|ACM69042.1|  sucrose synthase                                        110   3e-24   
ref|NP_001057047.1|  Os06g0194900                                       110   4e-24   
emb|CAA78747.1|  sucrose synthase                                       110   4e-24   
gb|AEX32875.1|  sucrose synthase 2                                      110   4e-24   
gb|ABL74568.1|  sucrose synthase 2                                      110   4e-24   
gb|AAQ18911.1|  sucrose synthase                                        104   4e-24   
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 109   4e-24   
ref|XP_007050986.1|  Sucrose synthase 3 isoform 3                       109   5e-24   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      109   5e-24   
gb|AAM68126.1|  sucrose synthase                                        109   5e-24   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      109   6e-24   
ref|XP_007050985.1|  Sucrose synthase 3 isoform 2                       108   9e-24   
gb|AEN71088.1|  sucrose synthase SusA1                                  108   9e-24   
gb|AEN71096.1|  sucrose synthase SusA1                                  108   9e-24   
gb|AEN71083.1|  sucrose synthase SusA1                                  108   9e-24   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       108   1e-23   
gb|AEN71090.1|  sucrose synthase SusA1                                  108   1e-23   
gb|AEN71092.1|  sucrose synthase SusA1                                  108   1e-23   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    108   1e-23   
gb|AEN71101.1|  sucrose synthase SusA1                                  108   1e-23   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 108   1e-23   
gb|AEV40895.1|  sucrose synthase                                        108   1e-23   
gb|KJB24381.1|  hypothetical protein B456_004G142700                    108   1e-23   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      108   1e-23   
gb|EMT33394.1|  Sucrose synthase 1                                      108   1e-23   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 108   1e-23   
gb|AEN71094.1|  sucrose synthase SusA1                                  108   2e-23   
gb|AFM52237.1|  putative sucrose synthase 6                             108   2e-23   
gb|AEV40893.1|  sucrose synthase                                        107   2e-23   
gb|AEV40894.1|  sucrose synthase                                        107   2e-23   
gb|AEZ00746.1|  SusA1                                                   107   2e-23   
gb|AEN71087.1|  sucrose synthase SusA1                                  107   2e-23   
dbj|BAJ10424.1|  sucrose synthase                                       107   2e-23   
gb|EMS59092.1|  Sucrose synthase 1                                      107   2e-23   
gb|AEN71105.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AEN71084.1|  sucrose synthase SusA1                                  107   3e-23   
dbj|BAK02964.1|  predicted protein                                      107   3e-23   
gb|AEN71106.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AEN71104.1|  sucrose synthase SusA1                                  107   3e-23   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      107   3e-23   
gb|AEN71093.1|  sucrose synthase SusA1                                  107   3e-23   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      107   3e-23   
gb|EMS66266.1|  Sucrose synthase 1                                      107   3e-23   
gb|AEN71103.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AEN71085.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AEN71099.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AEN71086.1|  sucrose synthase SusA1                                  107   3e-23   
gb|AGM14950.1|  sucrose synthase 5                                      107   3e-23   
ref|NP_001275237.1|  sucrose synthase                                   107   4e-23   
gb|AEN71089.1|  sucrose synthase SusA1                                  107   5e-23   
gb|AEN71091.1|  sucrose synthase SusA1                                  107   5e-23   
gb|AEZ00745.1|  SusA1                                                   107   5e-23   
emb|CAZ64535.1|  sucrose synthase                                       106   5e-23   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    106   5e-23   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      106   7e-23   
dbj|BAE79815.1|  sucrose synthase                                       106   8e-23   
gb|ADP88918.1|  sucrose synthase                                        106   8e-23   
gb|ACR78192.1|  sucrose synthase                                      99.8    1e-22   
ref|NP_192137.1|  sucrose synthase 3                                    105   1e-22   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      105   2e-22   
gb|EAZ00002.1|  hypothetical protein OsI_22003                          105   2e-22   
gb|AAC28175.1|  T2H3.8                                                  105   2e-22   
emb|CAB38022.1|  sucrose synthase                                       105   2e-22   
gb|AEH27530.1|  putative sucrose synthase                               104   2e-22   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 105   2e-22   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      104   3e-22   
gb|AHL29282.1|  sucrose synthase 2                                      104   3e-22   
ref|XP_004247973.1|  PREDICTED: sucrose synthase 2-like                 104   4e-22   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      104   4e-22   
gb|AEV40896.1|  sucrose synthase                                        103   4e-22   
gb|AGV22111.1|  sucrose synthase 1                                      103   4e-22   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      103   6e-22   
gb|AEN79501.1|  sucrose synthase 2                                      103   6e-22   
ref|XP_002874924.1|  hypothetical protein ARALYDRAFT_490342             103   6e-22   
gb|AFO84091.1|  sucrose synthase                                        103   6e-22   
gb|KDO87155.1|  hypothetical protein CISIN_1g003492mg                   103   7e-22   
gb|KDO87157.1|  hypothetical protein CISIN_1g003492mg                   102   8e-22   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             103   9e-22   
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   103   9e-22   
emb|CDY52781.1|  BnaCnng23260D                                          103   9e-22   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   103   9e-22   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   103   1e-21   
dbj|BAA88904.1|  sucrose synthase                                       103   1e-21   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             103   1e-21   
dbj|BAA88981.1|  sucrose synthase                                       103   1e-21   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 102   1e-21   
ref|XP_008784779.1|  PREDICTED: sucrose synthase 4-like                 102   1e-21   
gb|AGM14947.1|  sucrose synthase 2                                      102   1e-21   
gb|AGQ57013.1|  sucrose synthase 2                                      102   1e-21   
gb|AHM02468.1|  sucrose synthase                                        102   2e-21   
gb|AFP23359.1|  sucrose synthase                                        102   2e-21   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         101   3e-21   
gb|ACR78193.1|  sucrose synthase                                      95.9    3e-21   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 101   3e-21   
gb|ABI81471.1|  sucrose synthase                                      94.4    4e-21   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    101   4e-21   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      100   5e-21   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 100   5e-21   
ref|XP_002523115.1|  sucrose synthase, putative                         100   5e-21   
emb|CAL60213.1|  sucrose synthase                                     92.0    6e-21   
gb|AAK65960.1|AF273253_1  sucrose synthase                              100   7e-21   
gb|EPS61046.1|  hypothetical protein M569_13754                       93.6    7e-21   
gb|KCW81853.1|  hypothetical protein EUGRSUZ_C03204                     100   7e-21   
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                      100   7e-21   
emb|CDY22042.1|  BnaA09g00710D                                          100   7e-21   
ref|XP_010684343.1|  PREDICTED: sucrose synthase                        100   8e-21   
gb|ABR87939.1|  sucrose synthase 1                                      100   8e-21   
gb|EPS70967.1|  sucrose synthase                                      97.4    8e-21   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       100   8e-21   
ref|XP_009414138.1|  PREDICTED: sucrose synthase 4-like                 100   9e-21   
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                      100   1e-20   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    100   1e-20   
dbj|BAP47501.1|  sucrose synthase                                       100   1e-20   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      100   1e-20   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...  99.8    1e-20   
ref|NP_001268888.1|  sucrose synthase 2-like                          99.8    1e-20   
gb|KEH24408.1|  sucrose synthase                                      99.8    1e-20   
dbj|BAJ88274.1|  predicted protein                                    96.7    2e-20   
gb|EYU46748.1|  hypothetical protein MIMGU_mgv1a001481mg              99.4    2e-20   
ref|XP_006396435.1|  hypothetical protein EUTSA_v10028435mg           99.4    2e-20   
gb|AES61743.2|  sucrose synthase                                      99.4    2e-20   
ref|XP_003591492.1|  Sucrose synthase                                 99.4    2e-20   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg           99.4    2e-20   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                    99.0    2e-20   
gb|EMT16287.1|  Sucrose synthase 2                                    96.3    3e-20   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                    99.0    3e-20   
emb|CAJ32597.1|  sucrose synthase                                     98.6    3e-20   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like               98.6    3e-20   
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1    98.6    4e-20   
emb|CDP17108.1|  unnamed protein product                              98.2    5e-20   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2    97.8    5e-20   
tpg|DAA45275.1|  TPA: hypothetical protein ZEAMMB73_631953            92.0    7e-20   
gb|KFK36302.1|  hypothetical protein AALP_AA4G104600                  97.8    7e-20   
gb|KJB07349.1|  hypothetical protein B456_001G017700                  97.4    8e-20   
dbj|BAB20799.1|  sucrose synthase 1                                   97.1    1e-19   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like               97.1    1e-19   
emb|CAZ65725.1|  sucrose synthase                                     96.3    2e-19   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like               96.3    2e-19   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                    95.9    2e-19   
gb|AIL88515.1|  sucrose synthase type 3                               95.9    3e-19   
gb|AFS17278.1|  sucrose synthase 2                                    95.9    3e-19   
ref|XP_010092252.1|  Sucrose synthase 2                               95.5    4e-19   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg           95.1    6e-19   
ref|XP_007163137.1|  hypothetical protein PHAVU_001G209600g           94.7    6e-19   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g           94.7    7e-19   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                    94.7    7e-19   
ref|NP_001280838.1|  sucrose synthase 3                               94.7    7e-19   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2    94.7    7e-19   
gb|AFM52233.1|  putative sucrose synthase 2                           94.7    7e-19   
gb|ABF95855.1|  Sucrose synthase 2, putative, expressed               94.0    1e-18   
tpg|DAA45276.1|  TPA: hypothetical protein ZEAMMB73_631953            91.3    1e-18   
ref|XP_011006464.1|  PREDICTED: sucrose synthase 2                    94.0    1e-18   
ref|NP_001050064.1|  Os03g0340500                                     94.0    1e-18   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like               93.6    2e-18   



>gb|ACL00957.1| sucrose synthase [Ipomoea batatas]
Length=727

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPH+LLAEFEAICKEDQE
Sbjct  1    MAERALTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHELLAEFEAICKEDQE  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAFQQVLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|AAA63685.1| sucrose synthase, partial [Solanum tuberosum]
Length=158

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>dbj|BAP82380.1| sucrose synthase, partial [Orobanche aegyptiaca]
Length=243

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEF+ IC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFKVICQADKA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEFEAIC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFEAICQADKA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IE+HGKGILKPHQL+AEFEAIC  D+E
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIEAHGKGILKPHQLMAEFEAICAADKE  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL DHAF++VLKSTQEAIV PPWVALAIRL PGVWE
Sbjct  61   KLQDHAFKEVLKSTQEAIVFPPWVALAIRLRPGVWE  96



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVL PWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWE  96



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVL PWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWE  96



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF++I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDSIHKEDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF++VLKSTQEAIVL PWVALAIRL PGVWE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWE  96



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+ VLTRVHSLRERLDATL AHRNEILLF+S+IE HGKGILKPHQLL+EFEAIC+ D+E
Sbjct  1    MADPVLTRVHSLRERLDATLAAHRNEILLFLSRIEGHGKGILKPHQLLSEFEAICEADKE  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL DHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLQDHAFKEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERALTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLNDHAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K++DHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K++DHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K++DHAF++VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWE  96



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLCAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KLN+HAF+++LKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWE  96



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  267  TAMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKED  446
            + M ERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQL+ EFEAI + D
Sbjct  59   STMPERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLVPEFEAIFESD  118

Query  447  QE-KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            ++ KL DHAF+Q+LK+TQEAIVLPPWVALAIRL PGVWE
Sbjct  119  KKPKLQDHAFKQLLKTTQEAIVLPPWVALAIRLRPGVWE  157



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAE+V TRVHSLRERLD+TL  HRNEIL+ +S+IESHGKGILKPHQL+AEF+AI KED  
Sbjct  1    MAEKVFTRVHSLRERLDSTLATHRNEILMVLSRIESHGKGILKPHQLMAEFDAISKEDN-  59

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VLKSTQEAIVLPPWVALAIRL PGVWE
Sbjct  60   KLHDGAFHEVLKSTQEAIVLPPWVALAIRLRPGVWE  95



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M E VLTRVHSLRER+D+TL  HRNEIL+F+S+IESHGKGILKPHQLLAE+EAI KED+ 
Sbjct  1    MGEPVLTRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAISKEDKL  60

Query  453  KLND--HAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D   AF +V+KSTQEAIV PPWVALAIRL PGVWE
Sbjct  61   KLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRPGVWE  98



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA +VLTRVHSLRERLD TL+AHRNEILLF+SKIESHGKGILKPHQ+ AE EA+ KE Q+
Sbjct  1    MAGQVLTRVHSLRERLDGTLSAHRNEILLFLSKIESHGKGILKPHQIEAEIEALSKEVQQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LKS QEAIVLPPW+A A+RL PGVWE
Sbjct  61   KLYDGAFGELLKSAQEAIVLPPWIAFAVRLRPGVWE  96



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVHSLRERLDETLSAHRNEILAFLSRIEAKGKGFLQPHQLTAEFEAIPEANRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  VLTRVHSLR+RLD TL+ HRNE+LL +S IE HGKGILKPHQ+ AEFEA+ K  Q+
Sbjct  1    MASHVLTRVHSLRDRLDGTLSTHRNELLLLLSNIEKHGKGILKPHQIEAEFEALPKHAQQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D  F +VLKS QEAIVLPPWVALAIRL PGVWE
Sbjct  61   KLHDGPFGEVLKSAQEAIVLPPWVALAIRLRPGVWE  96



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IES GKG L+PHQLLAEFE I + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIESKGKGFLQPHQLLAEFEEIPEANRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK+TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWE  96



>gb|KDO73787.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=562

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWE  96



>gb|KDO73786.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=700

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFY03624.1| sucrose synthase, partial [Eucalyptus globulus]
Length=274

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+R+LTR HSLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWE  96



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>dbj|BAM05650.1| sucrose synthase 3, partial [Eucalyptus pilularis]
Length=795

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>dbj|BAM05652.1| sucrose synthase 3, partial [Eucalyptus globulus subsp. globulus]
Length=795

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAI+LPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIILPPWIALAVRPRPGVWE  96



>gb|AAD09568.1| sucrose synthase [Gossypium hirsutum]
Length=454

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E++ 
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENER  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QE IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILKASQEXIVLPPWVALAVRPRPGVWE  96



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D  F  +LKS QEAIVLPPW+A A+R  PGVWE
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWE  96



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL+D  F  +LKS QEAIVLPPW+A A+R  PGVWE
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWE  96



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFR41747.1| sucrose synthase, partial [Populus trichocarpa]
 gb|AFR41748.1| sucrose synthase, partial [Populus trichocarpa]
Length=113

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>gb|KJB82967.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=815

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFR41743.1| sucrose synthase, partial [Populus trichocarpa]
 gb|AFR41754.1| sucrose synthase, partial [Populus alba]
Length=113

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  9    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  68

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++LK++QEAIVLPPWVALA+R  PGVWE
Sbjct  69   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWE  104



>gb|AFR41749.1| sucrose synthase, partial [Populus alba]
 gb|AFR41752.1| sucrose synthase, partial [Populus alba]
Length=112

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>ref|XP_009359754.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=837

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IE  GKG L+PHQLLAEFE I + ++ 
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIEKKGKGFLQPHQLLAEFEEIPETNRR  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK+TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWE  96



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M ER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MPERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>gb|AFY03626.1| sucrose synthase, partial [Eucalyptus globulus]
Length=796

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA R+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAXRLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFR41760.1| sucrose synthase, partial [Populus nigra]
 gb|AFR41761.1| sucrose synthase, partial [Populus nigra]
 gb|AFR41762.1| sucrose synthase, partial [Populus nigra]
 gb|AFR41763.1| sucrose synthase, partial [Populus nigra]
 gb|AFR41764.1| sucrose synthase, partial [Populus nigra]
 gb|AFR41765.1| sucrose synthase, partial [Populus nigra]
Length=113

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPWVALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWVALALRPRPGVWE  95



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWE  96



>ref|NP_001289661.1| sucrose synthase-like [Eucalyptus grandis]
 gb|ABB53601.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWE  96



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAM05651.1| sucrose synthase 3, partial [Eucalyptus pyrocarpa]
Length=795

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAE +LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAESLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL++ AF ++L+S+QEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWE  96



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_010049327.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
 ref|XP_010049328.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
Length=805

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWE  96



>gb|KCW81848.1| hypothetical protein EUGRSUZ_C03199 [Eucalyptus grandis]
Length=820

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWE  96



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQE+IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWE  96



>gb|AFR41742.1| sucrose synthase, partial [Populus trichocarpa]
 gb|AFR41746.1| sucrose synthase, partial [Populus trichocarpa]
 gb|AFR41755.1| sucrose synthase, partial [Populus fremontii]
 gb|AFR41756.1| sucrose synthase, partial [Populus fremontii]
 gb|AFR41757.1| sucrose synthase, partial [Populus fremontii]
 gb|AFR41758.1| sucrose synthase, partial [Populus fremontii]
Length=113

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIV PPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEILRASQEAIVFPPWVALAVRPRPGVWE  96



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDQTLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEA+VLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWE  96



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ HQL+AEFEAI +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHQLIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL++TQE+IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGDFGEVLRATQESIVLPPWVALAVRPRPGVWE  96



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  47   MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  106

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIV PPWVALA+R  PGVWE
Sbjct  107  KLADGAFFEILRASQEAIVFPPWVALAVRPRPGVWE  142



>gb|AFR41753.1| sucrose synthase, partial [Populus alba]
Length=112

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER  TRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERAXTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEA+VLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWE  96



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQE+IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWE  96



>gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQE+IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWE  96



>ref|XP_004144053.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
 ref|XP_004159357.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
Length=806

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQE+IVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWE  96



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L + AF +VL++TQEAIVL PWVALA+R  PGVWE
Sbjct  61   HLTEGAFGEVLRATQEAIVLAPWVALAVRPRPGVWE  96



>gb|AFR41759.1| sucrose synthase, partial [Populus fremontii]
Length=113

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  455
            AER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ+ AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIXAEFEAIPEDTRKT  60

Query  456  LNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  95



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEA+VLPPWVA A+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWE  96



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEA+VLPPWVA A+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWE  96



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATERLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLFTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK TQEA+VLPPWVA A+R  PGVWE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWE  96



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB54540.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=562

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFR41745.1| sucrose synthase, partial [Populus trichocarpa]
Length=111

 Score =   127 bits (318),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  461
            R LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ L 
Sbjct  1    RALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKTLA  60

Query  462  DHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
              AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   GGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  93



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAADRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AFR41744.1| sucrose synthase, partial [Populus trichocarpa]
Length=111

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  461
            R LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++ L 
Sbjct  1    RALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRKTLA  60

Query  462  DHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
              AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   GGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  93



>gb|KJB54542.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=750

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB65375.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=750

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB54541.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=819

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS RERLD TL A RNE+L  +S++E+ GKGIL+ HQ++AEFE++ +E Q+
Sbjct  1    MAERVITRVHSQRERLDETLAAQRNEVLALLSRVEAKGKGILQHHQIIAEFESLPEETQK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL   AF +VL+STQEAIVLPPWVALAIR  PGVWE
Sbjct  61   KLEGGAFFEVLRSTQEAIVLPPWVALAIRPRPGVWE  96



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB54539.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=833

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_004508033.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004508034.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
Length=811

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF ++L+++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS RERLD TL+A RNE+L  +S++E+ GKGIL+ HQ++AEFEA+ +E ++
Sbjct  1    MAERVITRVHSQRERLDGTLSAQRNEVLSLLSRVEAKGKGILQHHQIIAEFEALPEETRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL   AF ++L+S+QEAIVLPPWVALAIR  PGVWE
Sbjct  61   KLEGSAFFEILRSSQEAIVLPPWVALAIRPRPGVWE  96



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVL RVHSLRERL  TL A RNE+L+ +S+IE HGKGI++PH LL E E I + D++
Sbjct  1    MAERVLARVHSLRERLGETLAAQRNELLILLSRIEGHGKGIMQPHHLLEELEKIPEGDRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F  V++STQEAIVLPPWVALA+R  PGVW+
Sbjct  61   KLVDGVFGDVIRSTQEAIVLPPWVALAVRPRPGVWD  96



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL AHRNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAHRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L D  F +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEESRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  96



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+R LTRVHSLRERLD TL+AHRNEI   +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MADRALTRVHSLRERLDVTLSAHRNEIAALLSRIINKGKGFMQPHELVAEFEAIPESNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL  TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWE  96



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL  TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWE  96



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL  TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWE  96



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL  TQE IVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWE  96



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L D  F +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L D  F +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL +  F +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>gb|AES92143.2| sucrose synthase [Medicago truncatula]
Length=750

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  96



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  96



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            +MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ +
Sbjct  88   SMATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSR  147

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  148  QKLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  184



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL +  F +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL +  F +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  96



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA  V+TRVHSLRERLD TL AH NEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHGNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VLK++QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            AMAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ +
Sbjct  7    AMAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTR  66

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            + L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  67   KTLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  103



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQMVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS+RERLD TL A+RNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAYRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L D  F +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER L RVHSLRERL  TL+AHRNE+L  +S+IE HGKGIL+PH LL E  AI + D++
Sbjct  1    MAERALARVHSLRERLGETLSAHRNELLHLLSRIEYHGKGILQPHHLLEELGAISEGDRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F  V++STQE IVLPPWVALA+R  PGVW+
Sbjct  61   KLLDGVFGDVIRSTQEIIVLPPWVALAVRPRPGVWD  96



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERV+TRVHS RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSFRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+S QEAIVLPP VA A+R  PGVWE
Sbjct  61   KLLDSVFGEVLRSAQEAIVLPPCVAFAVRPRPGVWE  96



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTR+HS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRIHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  461
            R LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ H+++AEFE I +E ++KL 
Sbjct  3    RRLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHRVIAEFEEIPEESRQKLT  62

Query  462  DHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            D AF +VL+STQEAIVLPPWVALA+R  PG+WE
Sbjct  63   DGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWE  95



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  461
            R L R HSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL+ EFEAI +  ++ L 
Sbjct  5    RALNRAHSLRERLDDTLSAHRNEILAFLSRIEAKGKGFLQPHQLIDEFEAIPEASRKNLL  64

Query  462  DHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +  F +VLK+TQEAIVLPPWVALA+R  PGVWE
Sbjct  65   ESEFGEVLKNTQEAIVLPPWVALAVRPRPGVWE  97



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGI + HQL+AE EAI +  ++
Sbjct  1    MAERVLTRVHSLRERLDETLVANRNEIVALLSRIIGKGKGICRNHQLIAEVEAIPEATRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D AF +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+S QEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWE  96



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AERVLTRVHS RERLD TL AH+NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVLTRVHSQRERLDETLVAHKNEVLALLSRVEAKGKGILQHHQIIAEFEAMPVEAQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF ++L+STQEAIVLPP VALA+R  PGVWE
Sbjct  62   KKLQGGAFFEILRSTQEAIVLPPLVALAVRPRPGVWE  98



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+S QEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWE  96



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+S QEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWE  96



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA+RV+TRVHSLRERLD TL A RNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLADRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VLK++QEAIVLPP VALA+R  PGVWE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPCVALAVRPRPGVWE  96



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M ER LTRVHS+RE +D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI +++++
Sbjct  1    MTERALTRVHSIREHVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDNRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PPW+ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWE  96



>dbj|BAE99649.1| sucrose synthase like protein [Arabidopsis thaliana]
Length=395

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF + L+S QEAIVLPP+VALA+R  PGVWE
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWE  98



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AERV+TRVHS RERLDATL A +NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLIAQKNEVLALLSRVEAKGKGILQYHQIIAEFEAMPLETQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF ++L+S QEAIVLPP+VALA+R  PGVWE
Sbjct  62   KKLQGGAFFEILRSAQEAIVLPPFVALAVRPRPGVWE  98



>gb|AAZ32907.1| sucrose synthase [Medicago sativa]
Length=153

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTR  SLRER D +LTAHR EIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++KL + 
Sbjct  4    LTRSTSLRERFDGSLTAHRIEILALLSRIEAKGKGILQHHQVIAEFEEIPEEKRQKLVNG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEA+VLPP+VALA+R  PGVWE
Sbjct  64   AFGEVLRSTQEAVVLPPFVALAVRPRPGVWE  94



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGIL+ H L+AE EAI +   +
Sbjct  1    MAERVLTRVHSLRERLDDTLAANRNEIVALLSRIVGKGKGILQHHHLIAEVEAIPEATSK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VL+S QEAIVLPPWVALA+R  PGVWE
Sbjct  61   KLLEGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWE  96



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA R LTRV SL+ERLD TLTA RNEIL F+S+I SHGKGIL+PH+LL+EFEA+   D+ 
Sbjct  1    MAGR-LTRVPSLKERLDETLTAQRNEILSFLSRIVSHGKGILQPHELLSEFEAVS--DKH  57

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +V + TQEAIVLPPW+ LA+R  PGVWE
Sbjct  58   KLADGPFGEVFRHTQEAIVLPPWITLAVRPRPGVWE  93



>gb|ACR08725.1| sucrose synthase, partial [Vigna luteola]
Length=221

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  306  LRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQVL  485
            LRERLD TL+A RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++KL D AF +VL
Sbjct  1    LRERLDETLSASRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQKLTDGAFGEVL  60

Query  486  KSTQEAIVLPPWVALAIRLXPGVWE  560
            +STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   RSTQEAIVLPPWVALAVRPRPGVWE  85



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PP +ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWE  96



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGAFFNLLKSTQEAIVLPPWVALAVRPSPGVWE  98



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             L   AF +VL+STQEAIV+PP +ALA+R  PGVWE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWE  96



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA R LTRV SL+ERLD TLTA RNEI+ F+SKI SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1    MASR-LTRVPSLKERLDETLTAQRNEIISFLSKIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+ TQE IVLPPW+ LA+R  PG+WE
Sbjct  58   KLADGPFGEVLRHTQETIVLPPWITLAVRPRPGIWE  93



>sp|Q41607.1|SUS2_TULGE RecName: Full=Sucrose synthase 2; AltName: Full=Sucrose-UDP glucosyltransferase 
2 [Tulipa gesneriana]
 emb|CAA65640.1| sucrose-synthase 21 [Tulipa gesneriana]
Length=820

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAIC-KEDQ  449
            MA+R +TRVHS+RERL  TL+AH+NE+L   S+    G+G+L+PHQLL E+EA+    D+
Sbjct  1    MADRAMTRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIPAADR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIV+PPWVALAIR  PGVWE
Sbjct  61   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWE  97



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF + L+S QEAIVLPP+VALA+R  PGVWE
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWE  98



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  44   ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  103

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  104  KKLEGGAFFDLLKSTQEAIVLPPWVALAVRPRPGVWE  140



>ref|XP_002874016.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50275.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL    F  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWE  98



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + +NE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  2    ANAERMITRVHSQRERLNETLVSEKNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL   AF  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGAFFDLLKSTQEAIVLPPWVALAVRPSPGVWE  98



>dbj|BAM05645.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05646.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05647.1| sucrose synthase 1, partial [Eucalyptus pyrocarpa]
Length=786

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  303  SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  482
            SLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1    SLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  483  LKSTQEAIVLPPWVALAIRLXPGVWE  560
            LKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   LKSTQEAIVSPPWVALAVRPRPGVWE  86



>gb|ABF50715.1| sucrose synthase [Viscum album subsp. album]
Length=810

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
             MA+R LTRV+SLRERLD TL  HRNEIL  +S+IE++GKGIL+ H +++E EA+ K D 
Sbjct  22   GMADRALTRVYSLRERLDETLADHRNEILALLSRIENNGKGILQHHHIVSELEALPKADM  81

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             KL D AF  V++S QEAIV  PWVALA+R  PGVW+
Sbjct  82   LKLTDGAFGDVIRSAQEAIVFSPWVALAVRPRPGVWD  118



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+STQEAIVLPP+VALA+R  PGVWE
Sbjct  61   KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWE  96



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+STQEAIVLPP+VALA+R  PGVWE
Sbjct  61   KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWE  96



>ref|XP_004488141.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004488142.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
 ref|XP_004488143.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
 ref|XP_004488144.1| PREDICTED: sucrose synthase-like isoform X4 [Cicer arietinum]
 ref|XP_004488145.1| PREDICTED: sucrose synthase-like isoform X5 [Cicer arietinum]
Length=824

 Score =   124 bits (312),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VL+STQEAIVLPP+VALA+R  PGVWE
Sbjct  61   KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWE  96



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA R LTRV SL+ERLD TLTA RNEI+ F+ +I SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1    MASR-LTRVPSLKERLDETLTAQRNEIISFLKRIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +VL+ TQE IVLPPW+ LA+R  PGVWE
Sbjct  58   KLADGPFGEVLRHTQETIVLPPWITLAVRPRPGVWE  93



>emb|CAA50317.1| sucrose synthase [Arabidopsis thaliana]
Length=807

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL    F  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWE  98



>ref|XP_004488146.1| PREDICTED: sucrose synthase-like isoform X6 [Cicer arietinum]
Length=806

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL + AF +VL+STQEAIVLPP+VALA+R  PGVWE
Sbjct  61   KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWE  96



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M   VLTRVHS RERL+ TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K+   AF  +LK+TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M   VLTRVHS RERL+ TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K+   AF  +LK+TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWE  96



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  464
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  465  HAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  464
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  465  HAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>ref|XP_006838088.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
 gb|ERN00657.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
Length=810

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFE-AICKEDQ  449
            MA R LTRV S+RER++ TL+AHRNE++  +S+    GKGIL+PHQLL EFE  I +ED+
Sbjct  1    MATRRLTRVLSMRERVEDTLSAHRNELVCLLSRYVEQGKGILQPHQLLDEFEKVIAEEDR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL+   F  VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  61   QKLSQGLFGDVLRSTQEAIVLPPWVALAVRPRPGVWE  97



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  464
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  465  HAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
             AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|AGW23638.1| sucrose synthase [Lilium davidii]
Length=846

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  449
            MA+R LTR H+ R+RL  TL+AH+NE+L   S+    G+G+L+PHQLLAE+EA+  E ++
Sbjct  4    MADRGLTRNHTFRDRLSDTLSAHKNELLALFSRFVKQGQGMLQPHQLLAEYEAVIPEAER  63

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIV+PPWVALAIR  PGVWE
Sbjct  64   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWE  100



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA R LTRV SL+ERLD TL+A RNEI+ F+S+I SHGKGIL+PHQLL+E EA+   D++
Sbjct  1    MAAR-LTRVPSLKERLDETLSAQRNEIISFLSRIVSHGKGILQPHQLLSELEAVS--DKQ  57

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL D  F +V + TQE IVLPPW+ LA+R  PGVWE
Sbjct  58   KLYDGPFGEVFRHTQEVIVLPPWITLAVRPRPGVWE  93



>ref|XP_010937277.1| PREDICTED: sucrose synthase 2-like [Elaeis guineensis]
Length=816

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  449
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPALSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEVDR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIVLPPWVALAIR  PGVWE
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWE  97



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M   VLTRVHS RERL+ TL A RNE+L  +S++E  GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEGKGKGILQQNQIIAEFEALPEETQK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K+   AF  +LK+TQEAIVLPPW+ALA+R  PGVWE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWIALAVRPRPGVWE  96



>ref|XP_010939862.1| PREDICTED: sucrose synthase 1 [Elaeis guineensis]
Length=815

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  449
            MA   L+RVHS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPALSRVHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIVLPPWVALAIR  PGVW+
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQ  97



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKTLAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ+LAEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQILAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            M   VLTRVHS RERL  TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLSETLVAQRNEVLALLSRVEAKGKGILQQNQIVAEFEALPEETQK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            K+   AF  +LK+TQEAIVLPPWVALA+R  PGVWE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWE  96



>ref|XP_008783098.1| PREDICTED: sucrose synthase 1 [Phoenix dactylifera]
Length=816

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  449
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPPLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEGDR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIVLPPWVALAIR  PGVWE
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWE  97



>ref|XP_008800466.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
 ref|XP_008800467.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
Length=815

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  449
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPTLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            EKL D  F+ VLK+ QEAIVLPPWVALAIR  PGVW+
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQ  97



>dbj|BAM05648.1| sucrose synthase 1, partial [Eucalyptus globulus subsp. globulus]
Length=786

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  303  SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  482
            SLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1    SLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  483  LKSTQEAIVLPPWVALAIRLXPGVWE  560
            LKSTQEAIV PPWVALA+R  PGVWE
Sbjct  61   LKSTQEAIVSPPWVALAVRPRPGVWE  86



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ +
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTR  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL    F  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWE  98



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  449
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ +
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTR  61

Query  450  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            +KL    F  +LKSTQEAIVLPPWVALA+R  PGVWE
Sbjct  62   KKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWE  98



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  273  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  452
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  453  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            KL    F +VL+STQEAIVLPP+VALA+R  PGVWE
Sbjct  61   KLQGGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWE  96



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  467
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  468  AFQQVLKSTQEAIVLPPWVALAIRLXPGVWE  560
            AF +VL+STQEAIVLPPWVALA+R  PGVWE
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWE  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840