BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF025B13

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003619702.1|  Ubiquitin-like protein                             318   1e-105   
gb|AGV54749.1|  ubiquitin 11                                            317   4e-105   Phaseolus vulgaris [French bean]
gb|AAZ32851.1|  pentameric polyubiquitin                                313   9e-105   Medicago sativa [alfalfa]
gb|AFC36452.1|  ubiquitin                                               314   1e-104   Anoectochilus roxburghii
gb|KJB69254.1|  hypothetical protein B456_011G016600                    312   1e-104   Gossypium raimondii
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    312   1e-104   Citrus sinensis [apfelsine]
gb|ABF06579.2|  polyubiquitin                                           312   1e-104   Gladiolus grandiflorus
emb|CBI22349.3|  unnamed protein product                                317   1e-104   Vitis vinifera
gb|ACA58351.1|  ubiquitin-like protein                                  313   2e-104   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AFP44113.1|  ubiquitin                                               312   2e-104   Lycoris longituba
gb|AAR32784.1|  polyubiquitin                                           313   2e-104   Clusia minor [cupey de monte]
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   314   2e-104   
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            312   2e-104   Phaseolus vulgaris [French bean]
gb|ABI84246.1|  polyubiquitin 10                                        312   3e-104   Arachis hypogaea [goober]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             316   3e-104   
gb|AEZ49160.1|  polyubiquitin                                           315   3e-104   Wolffia australiana
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    314   4e-104   
gb|AIZ74335.1|  polyubiquitin 3                                         313   5e-104   Pinus massoniana [Chinese red pine]
gb|ACT82769.1|  polyubiquitin                                           311   5e-104   Nicotiana tabacum [American tobacco]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             314   5e-104   Brachypodium distachyon [annual false brome]
ref|XP_003626479.1|  Ubiquitin-like protein                             314   7e-104   
gb|AFW66442.1|  putative ubiquitin family protein                       312   8e-104   
gb|AEW46688.1|  polyubiquitin                                           312   8e-104   Ulva linza
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             313   9e-104   
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             312   1e-103   Elaeis guineensis
gb|KJB36627.1|  hypothetical protein B456_006G167800                    312   1e-103   Gossypium raimondii
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      312   1e-103   Setaria italica
gb|ACJ85618.1|  unknown                                                 312   1e-103   Medicago truncatula
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   312   1e-103   Camelina sativa [gold-of-pleasure]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                312   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_002317213.1|  polyubiquitin family protein                       312   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             312   1e-103   
gb|AET06143.1|  ubiquitin                                               312   1e-103   Papaver somniferum
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             312   1e-103   
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          312   1e-103   Sorghum bicolor [broomcorn]
dbj|BAC57955.1|  polyubiquitin                                          312   1e-103   Tripolium pannonicum [sea starwort]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   312   1e-103   Citrus sinensis [apfelsine]
gb|AAO43307.1|  putative polyubiquitin                                  313   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                316   1e-103   
ref|NP_567286.1|  ubiquitin 11                                          312   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AAP31578.1|  ubiquitin                                               312   1e-103   Hevea brasiliensis [jebe]
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             312   1e-103   Citrus clementina [clementine]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   312   1e-103   Citrus sinensis [apfelsine]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             312   1e-103   Citrus clementina [clementine]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             312   1e-103   
emb|CAH59739.1|  polyubiquitin                                          312   1e-103   Plantago major [cart-track plant]
ref|NP_001232075.1|  putative ubiquitin C variant 2                     312   2e-103   Taeniopygia guttata
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             312   2e-103   Brachypodium distachyon [annual false brome]
emb|CDP08567.1|  unnamed protein product                                317   2e-103   Coffea canephora [robusta coffee]
gb|ABY60454.1|  putative polyubiquitin                                  313   2e-103   Adonis aestivalis var. palaestina
ref|XP_003627152.1|  Ubiquitin                                          313   2e-103   
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             318   2e-103   Phaseolus vulgaris [French bean]
gb|AFK41706.1|  unknown                                                 311   2e-103   Medicago truncatula
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    319   2e-103   
gb|AGZ15412.1|  fiber polyubiquitin                                     311   2e-103   Phaseolus vulgaris [French bean]
gb|AGV54228.1|  polyubiquitin-like protein                              317   3e-103   Phaseolus vulgaris [French bean]
gb|AAC35858.1|  polyubiquitin                                           312   3e-103   Capsicum chinense [bonnet pepper]
emb|CAC94926.1|  putative ubiquitin                                     311   3e-103   Pleurotus sp. 'Florida' [Florida oyster mushroom]
emb|CAD27944.1|  polyubiquitin-like                                     311   3e-103   Oryza sativa [red rice]
gb|AES89865.2|  polyubiquitin 3                                         313   3e-103   Medicago truncatula
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             313   3e-103   
gb|AAK68824.1|  Unknown protein                                         311   3e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AIY27743.1|  polyubiquitin Ubi10                                     315   3e-103   Betula luminifera [liang ye hua]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    311   3e-103   Gossypium raimondii
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            312   3e-103   Phaseolus vulgaris [French bean]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      314   3e-103   
prf||1604470A  poly-ubiquitin                                           312   4e-103
gb|AAO42469.1|  putative polyubiquitin                                  313   4e-103   Arabidopsis lyrata [lyrate rockcress]
ref|XP_007014924.1|  Polyubiquitin 3                                    313   4e-103   Theobroma cacao [chocolate]
gb|ACJ85643.1|  unknown                                                 310   4e-103   Medicago truncatula
emb|CAA40323.1|  polyubiquitin protein                                  314   5e-103   Helianthus annuus
ref|XP_007512209.1|  polyubiquitin                                      315   5e-103   Bathycoccus prasinos
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          313   5e-103   Sorghum bicolor [broomcorn]
gb|ABD96088.1|  polyubiquitin                                           312   5e-103   Malus domestica [apple tree]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             313   5e-103   
dbj|BAJ85978.1|  predicted protein                                      313   5e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      313   5e-103   Oryza brachyantha
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      313   5e-103   Brassica rapa
gb|ABK94002.1|  unknown                                                 313   5e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           313   5e-103   Fragaria vesca subsp. vesca
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                313   5e-103   Erythranthe guttata [common monkey flower]
ref|XP_003590494.1|  Ubiquitin                                          313   5e-103   
gb|AFW66439.1|  putative ubiquitin family protein                       313   5e-103   
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             313   5e-103   
ref|NP_851029.1|  polyubiquitin 3                                       313   5e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AES89866.2|  polyubiquitin 3                                         313   5e-103   Medicago truncatula
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  310   6e-103   Paxillus rubicundulus Ve08.2h10
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           313   6e-103   Nelumbo nucifera [Indian lotus]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             313   6e-103   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           313   6e-103   Brassica rapa
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      314   6e-103   Brachypodium distachyon [annual false brome]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             313   6e-103   Citrus clementina [clementine]
gb|EPS72031.1|  polyubiquitin                                           312   6e-103   Genlisea aurea
emb|CDP08569.1|  unnamed protein product                                313   6e-103   Coffea canephora [robusta coffee]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      313   6e-103   Citrus sinensis [apfelsine]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             313   6e-103   Citrus clementina [clementine]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             313   6e-103   Citrus clementina [clementine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      313   6e-103   Glycine max [soybeans]
ref|NP_849292.1|  polyubiquitin 14                                      313   7e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAH59740.1|  polyubiquitin                                          313   7e-103   Plantago major [cart-track plant]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    313   7e-103   Linum usitatissimum
emb|CAA48140.1|  ubiquitin                                              313   7e-103   Antirrhinum majus [garden snapdragon]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             313   7e-103   
emb|CBY46745.1|  polyubiquitin 10 protein                               313   7e-103   Lepidium appelianum [hairy whitetop]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             313   7e-103   
gb|KJB81823.1|  hypothetical protein B456_013G163500                    313   7e-103   Gossypium raimondii
gb|AIS71924.1|  polyubiquitin                                           310   7e-103   Mangifera indica
gb|KIY97324.1|  ubiquitin C                                             308   7e-103   Monoraphidium neglectum
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    310   7e-103   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    319   8e-103   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         313   8e-103   Jatropha curcas
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         313   8e-103   Jatropha curcas
gb|ACD31680.1|  ubiquitin                                               313   8e-103   Gossypium hirsutum [American cotton]
gb|AFK43392.1|  unknown                                                 310   8e-103   Medicago truncatula
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             316   9e-103   
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           317   1e-102   Eucalyptus grandis [rose gum]
gb|AAO43308.1|  putative polyubiquitin                                  310   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ84316.1|  fiber polyubiquitin                                     310   1e-102   Gossypium barbadense [Egyptian cotton]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  310   1e-102   Pisolithus microcarpus 441
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  310   1e-102   Piloderma croceum F 1598
gb|AAB95250.1|  ubiquitin                                               312   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003082269.1|  polyubiquitin (ISS)                                311   1e-102   
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         313   1e-102   
gb|AHC00631.1|  polyubiquitin                                           313   1e-102   Ganoderma lucidum
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 309   1e-102   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          309   1e-102   Yamadazyma tenuis ATCC 10573
emb|CAA54603.1|  pentameric polyubiquitin                               313   1e-102   Nicotiana tabacum [American tobacco]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   309   1e-102   Piloderma croceum F 1598
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             312   1e-102   Capsella rubella
gb|EMS24129.1|  ubiquitin C                                             310   1e-102   Rhodotorula toruloides NP11
gb|KJB14874.1|  hypothetical protein B456_002G147600                    313   1e-102   Gossypium raimondii
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  309   2e-102   Hypholoma sublateritium FD-334 SS-4
ref|XP_011110054.1|  hypothetical protein H072_4094                     309   2e-102   
gb|AAM64530.1|  ubiquitin homolog                                       309   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           312   2e-102   Elaeis guineensis
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   312   2e-102   Amanita muscaria Koide BX008
gb|KDB11907.1|  ubiquitin                                               312   2e-102   Ustilaginoidea virens
gb|KJB62487.1|  hypothetical protein B456_009G418900                    312   2e-102   Gossypium raimondii
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     309   2e-102   Rhodotorula toruloides
ref|XP_003607659.1|  Ubiquitin                                          310   2e-102   
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   309   2e-102   Brassica rapa
dbj|BAC56573.1|  similar to polyubiquitin                               307   2e-102   Bos taurus [bovine]
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            311   2e-102   Phaseolus vulgaris [French bean]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      311   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_003619701.1|  Ubiquitin-like protein                             311   2e-102   
gb|ACJ85658.1|  unknown                                                 308   2e-102   Medicago truncatula
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                311   2e-102   Serpula lacrymans var. lacrymans S7.3
gb|AES89856.2|  polyubiquitin 3                                         309   2e-102   Medicago truncatula
emb|CEF99839.1|  Ubiquitin conserved site                               313   2e-102   Ostreococcus tauri
gb|AFY06654.1|  polyubiquitin                                           310   3e-102   Carica papaya [mamon]
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    311   3e-102   Phoenix dactylifera
dbj|GAK65396.1|  ubiquitin                                              312   3e-102   Moesziomyces antarcticus
gb|AFW66438.1|  putative ubiquitin family protein                       313   3e-102   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   313   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872109.1|  predicted protein                                  314   4e-102   
emb|CBY16339.1|  unnamed protein product                                306   4e-102   Oikopleura dioica
gb|EGA57707.1|  Ubi4p                                                   309   4e-102   Saccharomyces cerevisiae FostersB
emb|CCL99875.1|  predicted protein                                      311   4e-102   Fibroporia radiculosa
ref|XP_001755431.1|  predicted protein                                  308   4e-102   
ref|XP_006381473.1|  polyubiquitin family protein                       311   4e-102   
gb|AAO43309.1|  putative polyubiquitin                                  309   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      311   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             308   4e-102   Selaginella moellendorffii
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    313   4e-102   Nicotiana sylvestris
gb|EWZ40370.1|  ubiquitin C                                             308   5e-102   Fusarium oxysporum Fo47
ref|XP_001783045.1|  predicted protein                                  308   5e-102   
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  308   5e-102   Paxillus rubicundulus Ve08.2h10
ref|NP_001174480.1|  Os05g0504766                                       313   5e-102   
ref|NP_001105376.1|  polyubiquitin                                      313   5e-102   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    313   5e-102   Hebeloma cylindrosporum h7
gb|KJB62485.1|  hypothetical protein B456_009G418900                    311   5e-102   Gossypium raimondii
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         313   5e-102   Elaeis guineensis
ref|XP_003030030.1|  polyubiquitin                                      311   5e-102   Schizophyllum commune H4-8
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      313   5e-102   Tarenaya hassleriana [spider flower]
emb|CDP05795.1|  unnamed protein product                                313   5e-102   Coffea canephora [robusta coffee]
dbj|BAL61087.1|  polyubiquitin                                          308   5e-102   Dianthus caryophyllus [carnation]
gb|ACB87916.1|  polyubiquitin 1                                         307   5e-102   Malus domestica [apple tree]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   310   5e-102   Sphaerobolus stellatus SS14
ref|XP_001598085.1|  polyubiquitin                                      310   5e-102   Sclerotinia sclerotiorum 1980 UF-70
gb|ABU40645.1|  polyubiquitin                                           313   5e-102   Triticum aestivum [Canadian hard winter wheat]
emb|CCT70325.1|  UBI4-Ubiquitin                                         310   5e-102   Fusarium fujikuroi IMI 58289
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                313   5e-102   
gb|ACS68205.1|  ubiquitin 10.2                                          313   5e-102   Brassica napus [oilseed rape]
gb|KIY53974.1|  polyubiquitin                                           310   6e-102   Fistulina hepatica ATCC 64428
gb|KIY45417.1|  ubiquitin                                               310   6e-102   Fistulina hepatica ATCC 64428
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             313   6e-102   Eutrema salsugineum [saltwater cress]
gb|ADD52202.1|  ubiquitin                                               313   6e-102   Catharanthus roseus [chatas]
ref|XP_001828882.1|  ubiquitin C                                        310   6e-102   Coprinopsis cinerea okayama7#130
ref|XP_001555417.1|  polyubiquitin                                      310   6e-102   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             310   6e-102   Exserohilum turcica Et28A
gb|KIR29996.1|  polyubiquitin                                           311   6e-102   Cryptococcus gattii VGII LA55
ref|XP_002508175.1|  ubiquitin                                          313   6e-102   Micromonas commoda
gb|KIR63773.1|  polyubiquitin                                           310   6e-102   Cryptococcus gattii CA1873
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             313   6e-102   
gb|KEH31155.1|  polyubiquitin 3                                         313   6e-102   Medicago truncatula
gb|AAB68045.1|  polyubiquitin                                           313   6e-102   Fragaria x ananassa
ref|XP_001420612.1|  predicted protein                                  313   6e-102   Ostreococcus lucimarinus CCE9901
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         313   6e-102   Nicotiana tomentosiformis
gb|ADO60140.1|  ubiquitin                                               307   7e-102   Beauveria bassiana
gb|AAB95252.1|  ubiquitin                                               313   7e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      313   7e-102   Nicotiana tomentosiformis
ref|NP_001148453.1|  LOC100282068                                       313   7e-102   Zea mays [maize]
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  310   7e-102   Botryobasidium botryosum FD-172 SS1
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         313   7e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|AAQ07453.1|  ubiquitin                                               313   7e-102   Musa acuminata AAA Group [Cavendish banana]
ref|XP_007339454.1|  ubiquitin                                          310   7e-102   
ref|XP_007763327.1|  polyubiquitin                                      310   7e-102   Coniophora puteana RWD-64-598 SS2
gb|AAX40652.1|  polyubiquitin                                           313   7e-102   Oryza sativa Japonica Group [Japonica rice]
gb|AAB36545.1|  ubiquitin-like protein                                  314   7e-102   Phaseolus vulgaris [French bean]
ref|XP_002953480.1|  polyubiquitin                                      310   7e-102   Volvox carteri f. nagariensis
gb|KJB81825.1|  hypothetical protein B456_013G163500                    313   7e-102   Gossypium raimondii
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      313   7e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      313   7e-102   Nicotiana sylvestris
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                313   7e-102   Erythranthe guttata [common monkey flower]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        313   7e-102   
emb|CBY46746.1|  polyubiquitin 10 protein                               313   7e-102   Lepidium campestre [bastard cress]
ref|NP_568397.1|  ubiquitin 4                                           313   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAY86773.1|  polyubiquitin                                           313   7e-102   Noccaea caerulescens
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                313   7e-102   Pyrus x bretschneideri [bai li]
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    310   7e-102   Populus euphratica
gb|KJB81824.1|  hypothetical protein B456_013G163500                    313   7e-102   Gossypium raimondii
gb|AAL09741.1|  AT4g05320/C17L7_240                                     313   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  312   7e-102   Plicaturopsis crispa FD-325 SS-3
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    313   7e-102   Camelina sativa [gold-of-pleasure]
ref|XP_007366816.1|  polyubiquitin                                      310   7e-102   Dichomitus squalens LYAD-421 SS1
ref|NP_849300.4|  polyubiquitin 10                                      313   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 310   8e-102   Scleroderma citrinum Foug A
dbj|BAK61738.1|  ubiquitin                                              306   8e-102   Larcopyle butschlii
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    313   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             313   8e-102   
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    313   8e-102   Oryza sativa Japonica Group [Japonica rice]
emb|CAA60629.1|  unnamed protein product                                305   8e-102   Acanthamoeba sp. 4b3
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      310   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    313   8e-102   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             313   8e-102   Capsella rubella
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      313   8e-102   Nelumbo nucifera [Indian lotus]
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              307   8e-102   Pseudocercospora fijiensis CIRAD86
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          306   9e-102   
gb|KJB13592.1|  hypothetical protein B456_002G083000                    313   9e-102   Gossypium raimondii
ref|XP_001764949.1|  predicted protein                                  310   9e-102   
ref|XP_001931824.1|  ubiquitin                                          307   9e-102   Pyrenophora tritici-repentis Pt-1C-BFP
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                313   1e-101   Erythranthe guttata [common monkey flower]
gb|EPX74297.1|  ubiquitin                                               307   1e-101   Schizosaccharomyces octosporus yFS286
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  307   1e-101   Naumovozyma dairenensis CBS 421
emb|CEP60563.1|  LALA0S01e13784g1_1                                     307   1e-101   Lachancea lanzarotensis
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           310   1e-101   Nicotiana tomentosiformis
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    304   1e-101   Setaria italica
ref|XP_719867.1|  hypothetical protein CaO19.6771                       307   1e-101   Candida albicans SC5314
gb|AFK47245.1|  unknown                                                 307   1e-101   Medicago truncatula
ref|NP_001053957.1|  Os04g0628100                                       313   1e-101   
gb|EMS65864.1|  Polyubiquitin                                           313   1e-101   Triticum urartu
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      312   2e-101   Nicotiana tomentosiformis
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    307   2e-101   Parastagonospora nodorum SN15
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    304   2e-101   Phoenix dactylifera
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             309   2e-101   
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           304   2e-101   Prunus mume [ume]
ref|XP_001755307.1|  predicted protein                                  309   2e-101   
ref|XP_003052575.1|  predicted protein                                  309   2e-101   [Nectria] haematococca mpVI 77-13-4
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    312   2e-101   Setaria italica
gb|KJB62483.1|  hypothetical protein B456_009G418900                    312   2e-101   Gossypium raimondii
emb|CAB81074.1|  polyubiquitin (ubq10)                                  315   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                312   2e-101   
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      313   2e-101   Camelina sativa [gold-of-pleasure]
gb|AHI85710.1|  stress-induced protein 5                                304   2e-101   Capsicum annuum
pir||PS0380  ubiquitin precursor - rice (fragment)                      305   2e-101
ref|XP_002891806.1|  predicted protein                                  312   2e-101   
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             304   2e-101   Bipolaris oryzae ATCC 44560
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      312   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    303   2e-101   Cicer arietinum [garbanzo]
ref|NP_001190681.1|  ubiquitin 11                                       303   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           303   2e-101   Nicotiana sylvestris
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    304   2e-101   Hordeum vulgare [barley]
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           314   3e-101   Nicotiana sylvestris
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          314   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006372519.1|  polyubiquitin family protein                       309   3e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           303   3e-101   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             311   3e-101   Phaseolus vulgaris [French bean]
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    303   3e-101   Cicer arietinum [garbanzo]
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              307   3e-101   Poecilia formosa
gb|AFJ04519.1|  ubiquitin                                               304   3e-101   
ref|XP_002551324.1|  ubiquitin                                          308   3e-101   
gb|AAO43306.1|  putative polyubiquitin                                  309   3e-101   
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           304   3e-101   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            307   3e-101   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        306   3e-101   
gb|ACX46987.1|  ubiquitin                                               313   3e-101   
ref|XP_002839703.1|  hypothetical protein                               308   3e-101   
gb|AAP80689.1|  polyubiquitin                                           306   4e-101   
ref|XP_002494205.1|  Ubiquitin                                          308   4e-101   
dbj|BAP70433.1|  Ubiquitin                                              308   4e-101   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                311   4e-101   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      308   4e-101   
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    313   4e-101   
ref|XP_001210780.1|  ubiquitin                                          308   4e-101   
ref|XP_001830230.1|  ubiquitin                                          308   4e-101   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  305   4e-101   
gb|KIW56414.1|  polyubiquitin                                           308   4e-101   
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    313   4e-101   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         308   4e-101   
ref|XP_001227036.1|  polyubiquitin                                      308   4e-101   
gb|AAV65292.1|  polyubiquitin                                           308   4e-101   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  311   5e-101   
ref|XP_003196661.1|  ATP-dependent protein binding protein              311   5e-101   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   305   5e-101   
gb|AAH08661.1|  Ubc protein                                             304   5e-101   
gb|AAB95251.1|  ubiquitin                                               313   5e-101   
gb|EJU00136.1|  ubiquitin                                               311   5e-101   
gb|EUC59758.1|  polyubiquitin                                           311   5e-101   
ref|XP_001880135.1|  ubiquitin                                          311   5e-101   
gb|EEQ88150.1|  ubiquitin                                               308   5e-101   
ref|NP_001045980.1|  Os02g0161900                                       313   5e-101   
dbj|BAK03691.1|  predicted protein                                      313   5e-101   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      313   5e-101   
gb|AFR98116.1|  polyubiquitin                                           311   5e-101   
ref|XP_010756991.1|  polyubiquitin                                      308   5e-101   
dbj|GAA27344.2|  polyubiquitin-A                                        307   5e-101   
gb|EEH20847.2|  polyubiquitin                                           308   5e-101   
gb|AAB36546.1|  polyubiquitin                                           305   5e-101   
emb|CAA40324.1|  hexaubiquitin protein                                  313   5e-101   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          313   5e-101   
gb|EXX74853.1|  ubiquitin                                               303   6e-101   
gb|AIS40894.1|  polyubiquitin                                           313   6e-101   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  311   6e-101   
gb|KEZ40313.1|  Polyubiquitin                                           308   6e-101   
ref|XP_002419618.1|  ubiquitin, putative                                308   6e-101   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                313   6e-101   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             311   6e-101   
dbj|BAK02501.1|  predicted protein                                      313   6e-101   
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           302   6e-101   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      313   6e-101   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 311   6e-101   
gb|AAZ82816.1|  ubiquitin monomer protein                               302   6e-101   
ref|XP_007864655.1|  ubiquitin                                          310   6e-101   
dbj|BAJ91912.1|  predicted protein                                      313   6e-101   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  310   6e-101   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  310   6e-101   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     308   6e-101   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   313   6e-101   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             313   6e-101   
gb|AAD03343.1|  ubiquitin                                               313   6e-101   
tpg|DAA34466.1|  TPA: ubiquitin                                         304   6e-101   
gb|EEH07231.1|  ubiquitin                                               308   6e-101   
gb|EMS60894.1|  Polyubiquitin                                           313   6e-101   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                313   6e-101   
gb|ACN40936.1|  unknown                                                 313   7e-101   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    313   7e-101   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           313   7e-101   
ref|XP_659604.1|  hypothetical protein AN2000.2                         308   7e-101   
emb|CAA52290.1|  polyubiquitin                                          310   7e-101   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           313   7e-101   
emb|CCG34086.1|  Polyubiquitin                                          308   7e-101   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           313   7e-101   
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         313   7e-101   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           313   7e-101   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             313   7e-101   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    313   7e-101   
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    305   7e-101   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    313   7e-101   
ref|NP_849299.4|  polyubiquitin 10                                      313   7e-101   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      313   7e-101   
ref|XP_002791169.1|  ubiquitin                                          308   7e-101   
ref|XP_007049060.1|  Polyubiquitin 10                                   313   7e-101   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    310   7e-101   
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    305   7e-101   
gb|KHJ83418.1|  ubiquitin family protein                                304   7e-101   
emb|CAI51312.2|  polyubiquitin                                          302   8e-101   
ref|XP_002888365.1|  polyubiquitin                                      313   8e-101   
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  305   8e-101   
gb|AAC67552.1|  polyubiquitin                                           310   8e-101   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    313   8e-101   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           313   8e-101   
gb|AAC16012.1|  polyubiquitin                                           313   8e-101   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  308   8e-101   
emb|CAX71218.1|  polyubiquitin                                          303   8e-101   
tpd|FAA00317.1|  TPA: polyubiquitin                                     307   9e-101   
ref|XP_005644220.1|  polyubiquitin                                      307   9e-101   
gb|AAF31707.1|AF221858_1  polyubiquitin                                 304   9e-101   
gb|KIY97628.1|  ubiquitin C                                             307   9e-101   
dbj|BAK61744.1|  ubiquitin                                              305   9e-101   
gb|AFW70219.1|  polyubiquitin-like protein                              314   9e-101   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    307   9e-101   
gb|ABH08753.1|  ubiquitin                                               304   9e-101   
dbj|GAC94856.1|  ubiquitin                                              305   9e-101   
ref|XP_004934049.1|  PREDICTED: polyubiquitin-A-like                    302   9e-101   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    305   1e-100   
gb|AAL91103.1|  ubiquitin                                               306   1e-100   
ref|XP_002888394.1|  hexaubiquitin protein                              313   1e-100   
dbj|BAN21697.1|  ubiquitin                                              303   1e-100   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    305   1e-100   
gb|ABH08755.1|  ubiquitin                                               304   1e-100   
ref|XP_001731772.1|  hypothetical protein MGL_1040                      301   1e-100   
gb|AAV84265.1|  ubiquitin                                               302   1e-100   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      307   1e-100   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                313   1e-100   
emb|CCO30833.1|  Polyubiquitin                                          311   1e-100   
ref|XP_008278997.1|  PREDICTED: polyubiquitin                           302   1e-100   
gb|AAM78180.1|  putative polyubiquitin                                  303   1e-100   
gb|EPS29015.1|  hypothetical protein PDE_03961                          307   1e-100   
gb|AGT38457.1|  polyubiquitin                                           313   1e-100   
gb|ABH08754.1|  ubiquitin                                               304   1e-100   
gb|EEC81189.1|  hypothetical protein OsI_24195                          304   1e-100   
gb|EZF98642.1|  polyubiquitin                                           304   1e-100   
gb|AFD53810.1|  ubiquitin                                               306   1e-100   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      307   1e-100   
dbj|GAA55031.1|  ubiquitin C                                            304   1e-100   
ref|XP_002957068.1|  polyubiquitin                                      301   1e-100   
gb|ACZ69386.1|  polyubiquitin UBQ14                                     303   1e-100   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  307   1e-100   
gb|KDR10312.1|  Ubiquitin                                               304   1e-100   
ref|XP_002842034.1|  hypothetical protein                               307   1e-100   
ref|XP_011390959.1|  putative polyubiquitin                             304   1e-100   
ref|XP_004341200.1|  polyubiquitin, putative                            304   1e-100   
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           303   1e-100   
gb|AEH41483.1|  ubiquitin                                               307   1e-100   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      310   1e-100   
gb|KFK38370.1|  hypothetical protein AALP_AA3G105100                    305   1e-100   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          304   1e-100   
gb|ETN78467.1|  ubiquitin family protein                                304   2e-100   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          304   2e-100   
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         301   2e-100   
gb|AAO43310.1|  putative polyubiquitin                                  305   2e-100   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     304   2e-100   
ref|XP_009099257.1|  PREDICTED: polyubiquitin                           303   2e-100   
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    303   2e-100   
dbj|BAH71115.1|  ACYPI006410                                            304   2e-100   
gb|AAA82978.1|  polyubiquitin                                           310   2e-100   
dbj|GAA87419.1|  polyubiquitin                                          307   2e-100   
ref|XP_002955196.1|  polyubiquitin                                      304   2e-100   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             309   2e-100   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             309   2e-100   
gb|ACB87918.1|  polyubiquitin 3                                         302   2e-100   
ref|XP_001246797.1|  polyubiquitin                                      306   2e-100   
gb|ADD24466.1|  Ubiquitin                                               304   2e-100   
ref|XP_007808982.1|  ubiquitin                                          308   2e-100   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   304   2e-100   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    309   2e-100   
emb|CDI53149.1|  probable Polyubiquitin protein                         306   2e-100   
ref|XP_005850582.1|  hypothetical protein CHLNCDRAFT_48528              304   2e-100   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      312   2e-100   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       304   2e-100   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    308   2e-100   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    309   2e-100   
ref|XP_001538486.1|  polyubiquitin                                      306   2e-100   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         303   2e-100   
ref|XP_002389222.1|  hypothetical protein MPER_11681                    301   2e-100   
ref|XP_002083532.1|  GD13313                                            302   2e-100   
ref|XP_001777816.1|  predicted protein                                  309   3e-100   
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          301   3e-100   
dbj|BAL61084.1|  polyubiqutin                                           309   3e-100   
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        300   3e-100   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    320   3e-100   
gb|AFK46460.1|  unknown                                                 300   3e-100   
gb|AAM63271.1|  unknown                                                 300   3e-100   
gb|ACH45557.1|  putative ubiquitin C variant 4                          302   3e-100   
ref|XP_008510526.1|  PREDICTED: polyubiquitin-B                         307   3e-100   
dbj|BAK61751.1|  ubiquitin                                              303   3e-100   
gb|AGH70140.1|  ubiquitin family protein                                302   3e-100   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    313   4e-100   
emb|CCA16073.1|  polyubiquitin putative                                 313   4e-100   
gb|AAY33920.2|  polyubiquitin                                           308   4e-100   
gb|EXX74854.1|  ubiquitin                                               303   4e-100   
ref|XP_005831810.1|  ubiquitin                                          303   4e-100   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           313   4e-100   
dbj|BAO38900.1|  ubiquitin                                              308   4e-100   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              304   4e-100   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           313   4e-100   
ref|XP_004365491.1|  polyubiquitin 5                                    303   4e-100   
emb|CAA51679.1|  ubiquitin                                              313   4e-100   
ref|XP_005016327.1|  PREDICTED: polyubiquitin-C isoform X3              302   4e-100   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      313   4e-100   
gb|AFW66445.1|  ubiquitin2                                              313   4e-100   
tpg|DAA34473.1|  TPA: ubiquitin                                         303   4e-100   
ref|XP_958803.1|  ubiquitin                                             306   4e-100   
ref|XP_008632241.1|  PREDICTED: polyubiquitin-C isoform X10             302   4e-100   
ref|NP_983342.1|  ACL062Cp                                              308   4e-100   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                309   4e-100   
gb|ABD32351.2|  Ubiquitin                                               313   4e-100   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          313   4e-100   
tpd|FAA00316.1|  TPA: polyubiquitin                                     308   5e-100   
tpd|FAA00319.1|  TPA: polyubiquitin                                     311   5e-100   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    313   5e-100   
ref|XP_011275993.1|  ubiquitin C                                        308   5e-100   
ref|XP_003627151.1|  Ubiquitin                                          313   5e-100   
ref|XP_567862.1|  ATP-dependent protein binding protein                 311   5e-100   
ref|XP_003608276.1|  Ubiquitin                                          313   5e-100   
ref|XP_003607670.1|  Ubiquitin                                          313   5e-100   
ref|XP_007307433.1|  polyubiquitin                                      311   5e-100   
gb|ELR08709.1|  polyubiquitin                                           308   5e-100   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      313   5e-100   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    313   5e-100   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              313   5e-100   
ref|XP_002627625.1|  ubiquitin                                          308   5e-100   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           313   5e-100   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             304   5e-100   
ref|NP_595409.1|  ubiquitin                                             308   5e-100   
gb|ABV22331.1|  ubiquitin                                               305   5e-100   
gb|AEP96154.1|  ubiquitin C-like protein                                303   5e-100   
ref|NP_013061.1|  ubiquitin                                             308   5e-100   
dbj|BAK62072.1|  ubiquitin                                              301   5e-100   
ref|XP_007861169.1|  polyubiquitin                                      311   5e-100   



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +1

Query  46   RHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  225
            +H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   QHRSFQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  163

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  164  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  207


 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 119/129 (92%), Gaps = 5/129 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  382  KIQDKEGIP  408
            KIQDKEGIP
Sbjct  232  KIQDKEGIP  240


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  55   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  89


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  131  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  165


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXS  646
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP  S
Sbjct  207  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQTS  243



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 164/177 (93%), Gaps = 4/177 (2%)
 Frame = +1

Query  19   CSLNL----FYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  186
            C+ NL    +    HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  187  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  366
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  139

Query  367  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  140  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  196


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  44   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  78


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  120  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  154


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  196  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  230



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   313 bits (803),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  11   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  65

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  66   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  125

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  126  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  178


 Score =   207 bits (526),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  102


 Score = 62.8 bits (151),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  102  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  136


 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 97/108 (90%), Gaps = 5/108 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  87   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  141

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  342
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  142  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  189


 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  26   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  20   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  74

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  75   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  134

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  135  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  187


 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  384
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  385  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  111


 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  150

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  151  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  210

Query  379  AKIQ  390
            AKI+
Sbjct  211  AKIR  214


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  35   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  69


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  111  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  145



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 89/100 (89%), Gaps = 5/100 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  318
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  159


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 94/105 (90%), Gaps = 5/105 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  333
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  164


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 92/103 (89%), Gaps = 5/103 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  327
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = +1

Query  25   LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  132  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  183


 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  92   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  146

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  147  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  206

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  207  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  259


 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 118/129 (91%), Gaps = 5/129 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  168  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  222

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  223  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  282

Query  379  AKIQDKEGI  405
            AKIQDKEG+
Sbjct  283  AKIQDKEGM  291


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  31   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  65


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  107  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  141


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  183  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  217


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGI  634
            FVKTLTGK ITLE ESSDTIDNV  K QDKEG+
Sbjct  259  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 119/130 (92%), Gaps = 5/130 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIP  408
            AKIQDKEGIP
Sbjct  180  AKIQDKEGIP  189


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIP  637
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  159


 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVK  182

Query  379  AKIQD  393
            AKIQD
Sbjct  183  AKIQD  187


 Score =   169 bits (429),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIF  537
            DYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIF  83


 Score = 62.4 bits (150),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  83   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  117


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  7    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  41



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 166/183 (91%), Gaps = 5/183 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFRQDPDRQ  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF +    +
Sbjct  132  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  191

Query  559  XHH  567
             HH
Sbjct  192  DHH  194


 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  214  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  393
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  394  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  108


 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 108/131 (82%), Gaps = 6/131 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL-EVESSDTIDNV  375
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK      V +   +  V
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKDHHFWXVRTPIPLIMV  207

Query  376  KAKIQDKEGIP  408
            KAKIQDKEGIP
Sbjct  208  KAKIQDKEGIP  218


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  66


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  142



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/158 (99%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  158


 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV 
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVX  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
                        QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  182  XXXXXXXXXXXXQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  6    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  40


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  82   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  116


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNV  604
            FVKTLTGK ITLE ESSDTIDNV
Sbjct  158  FVKTLTGKTITLEVESSDTIDNV  180


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  645  QXXLIFXXKQLEDGRTXADYNXPK  716
            Q  LIF  KQLEDGRT ADYN  K
Sbjct  194  QQRLIFAGKQLEDGRTLADYNIQK  217



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 123/134 (92%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  180  AKIQDKEGIPPDQQ  193


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E+SDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  190



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 122/133 (92%), Gaps = 5/133 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQ  417
            AKIQDKEGIPPDQ
Sbjct  180  AKIQDKEGIPPDQ  192


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 116/127 (91%), Gaps = 5/127 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKE  399
            AKIQDK+
Sbjct  256  AKIQDKK  262


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKE  628
            FVKTLTGK ITLE ESSDTIDNV  K QDK+
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 159/163 (98%), Gaps = 2/163 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  134  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176


 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  252


 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 114/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVK  275

Query  379  AKIQDK  396
            AKIQDK
Sbjct  276  AKIQDK  281


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   314 bits (805),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 109/122 (89%), Gaps = 5/122 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVK  255

Query  379  AK  384
            AK
Sbjct  256  AK  257


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   313 bits (803),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  54   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  108

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  109  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  168

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  169  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  221


 Score =   290 bits (742),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  282
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  283  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  462
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  463  LADYNIQKESTLHLVLRLRGGMQIF  537
            LADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  LADYNIQKESTLHLVLRLRGGMQIF  145


 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 109/120 (91%), Gaps = 5/120 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  130  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  184

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  185  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  69   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  103


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  145  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  179



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   311 bits (798),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  11   STLHLVLRLRGG-----LQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  65

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  66   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  125

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  126  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  178


 Score =   203 bits (516),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TL DYNIQKESTLHLVLRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  102


 Score = 62.8 bits (151),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  102  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  136


 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 96/107 (90%), Gaps = 5/107 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  87   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  141

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  339
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  142  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  188


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  23   LQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   314 bits (805),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 161/174 (93%), Gaps = 5/174 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +C L  F   R       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  12   MCDLEDFLECRKM-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  66

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  67   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  126

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  127  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  180


 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  28   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  62


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  104  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  180  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  214



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   314 bits (805),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 157/158 (99%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  204


 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  52   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  86


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  128  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  162


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  204  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  238



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   312 bits (799),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 146/157 (93%), Gaps = 5/157 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  489
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   312 bits (800),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 156/167 (93%), Gaps = 5/167 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  519
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   313 bits (803),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 107/118 (91%), Gaps = 5/118 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIP  637
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   203 bits (516),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100


 Score = 62.8 bits (151),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 163/174 (94%), Gaps = 4/174 (2%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +  + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  21   VGRVELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  76

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  77   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  136

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  137  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  190


 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  266


 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  38   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  72


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  114  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  148


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  190  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  224


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  266  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  300



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (775),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 154/166 (93%), Gaps = 5/166 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  516
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRF  225


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|NP_001232075.1| putative ubiquitin C variant 2 [Taeniopygia guttata]
 gb|ACH45554.1| putative ubiquitin C variant 2 [Taeniopygia guttata]
Length=248

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 167/186 (90%), Gaps = 5/186 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFRQDPDRQ  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQ   +DPD Q
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQXLCEDPDWQ  239

Query  559  XHHTGG  576
             HH+ G
Sbjct  240  DHHSRG  245


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/156 (96%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTI+NV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  38


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTI+NV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  114


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTI+NV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  190



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +    L  +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  36   LTHWQLRSYLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  95

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  96   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  155

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  156  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  209


 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  233  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  285


 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 143/154 (93%), Gaps = 5/154 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  194  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  248

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  249  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  308

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  480
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  309  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  57   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  91


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  133  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  167


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  209  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  243


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  285  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  319



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  243


 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 5/172 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  116  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  167


 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 124/135 (92%), Gaps = 5/135 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQR  423
            AKIQDKEGIPPDQQR
Sbjct  267  AKIQDKEGIPPDQQR  281


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  15   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  49


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  91   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  167  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  201


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  243  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  277



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 123/170 (72%), Gaps = 40/170 (24%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT             
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT-------------  242

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
                                  LEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  243  ----------------------LEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 164/175 (94%), Gaps = 1/175 (1%)
 Frame = +1

Query  16   ICSLNLFYHLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
              +L    H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  30   FIALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  89

Query  193  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  90   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  149

Query  373  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  150  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  204


 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  228  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  280


 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  189  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  303

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  304  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  356


 Score =   304 bits (779),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  265  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  379

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  380  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  86


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  162


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  238


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  314


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  353  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  390



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  375


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  223  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  257


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  299  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  333


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  375  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  409



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 152/169 (90%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ES DTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPP  190



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 161/165 (98%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  222
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  223  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  402
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  263

Query  403  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIF  156


 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   312 bits (800),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  140  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  192


 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  369
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  116


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  40   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  74


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  116  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  192  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  226



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  46   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  100

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  101  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  160

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  161  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  213


 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/137 (99%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  127  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  306
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  307  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  486
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  487  ESTLHLVLRLRGGMQIF  537
            ESTLHLVLRLRGGMQIF
Sbjct  121  ESTLHLVLRLRGGMQIF  137


 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 111/122 (91%), Gaps = 5/122 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  122  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  176

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  177  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  236

Query  379  AK  384
            A+
Sbjct  237  AR  238


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  95


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  137  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  171



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = +1

Query  73   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  252
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  62   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  121

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  122  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 145/160 (91%), Gaps = 5/160 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            AKIQDKEGI    +RLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  180  AKIQDKEGIHQTSKRLIFAGKQLEDGRTLADYNIQKESTL  219


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXS  646
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGI   S
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIHQTS  192



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 5/172 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 98/108 (91%), Gaps = 5/108 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  345
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (800),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 147/158 (93%), Gaps = 5/158 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  492
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEN  293


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   311 bits (797),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVK L GK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 163/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  63   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  117

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK
Sbjct  118  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  178  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  230


 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  139  STLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  193

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  194  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  253

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  254  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  306


 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 148/156 (95%), Gaps = 2/156 (1%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  154


 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 110/121 (91%), Gaps = 5/121 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  215  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  269

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  270  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  329

Query  379  A  381
            A
Sbjct  330  A  330


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  78   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  112


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  230  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  264


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FV+TLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  154  FVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  188



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   312 bits (800),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (800),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 123/134 (92%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  256  AKIQDKEGIPPDQQ  269


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E+SDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  190



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/157 (100%), Positives = 157/157 (100%), Gaps = 0/157 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  238


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 139/162 (86%), Gaps = 6/162 (4%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  238  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  162


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  86   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  162  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  196


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  238  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  272



>prf||1604470A poly-ubiquitin
Length=272

 Score =   312 bits (800),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  32   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  86

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  87   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  146

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  147  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  199


 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = +1

Query  172  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  351
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  352  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  531
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  532  IF  537
            IF
Sbjct  122  IF  123


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  47   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  81


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  123  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  157


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  199  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  233



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  171  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  223


 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIF  537
            RTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIF  147


 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 150/169 (89%), Gaps = 13/169 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+      
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE------  240

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  241  --IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  71   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  105


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  147  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  181


 Score = 42.0 bits (97),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 8/35 (23%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESS+         QDKEGIPP
Sbjct  223  FVKTLTGKTITLEVESSEI--------QDKEGIPP  249


 Score = 42.0 bits (97),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  633  FPPXQXXLIFXXKQLEDGRTXADYNXPK  716
             PP Q  LIF  KQLEDGRT ADYN  K
Sbjct  247  IPPDQQRLIFAGKQLEDGRTLADYNIQK  274


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  554  GKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            GK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPP  29



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K Q+KEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPP  38



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 112/123 (91%), Gaps = 5/123 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKI  387
            AKI
Sbjct  332  AKI  334


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   315 bits (808),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  231  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  283


 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  192  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  246

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  247  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  306

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 156/207 (75%), Gaps = 51/207 (25%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  174
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  175  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIF  537
            RTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIF  207


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  131  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  165


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  207  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  241


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  283  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  317


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEG  631
            FVKTLTGK ITLE ESSDTIDNV  K QDKEG
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  35



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   312 bits (799),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  197


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  F  537
            F
Sbjct  121  F  121


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  45   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  197  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIP  637
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  37



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  38



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   313 bits (801),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 150/169 (89%), Gaps = 13/169 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD      
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD------  249

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  250  --IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296


 Score = 43.9 bits (102),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 24/35 (69%), Gaps = 8/35 (23%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSD         QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDI--------QDKEGIPP  258


 Score = 42.0 bits (97),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  633  FPPXQXXLIFXXKQLEDGRTXADYNXPK  716
             PP Q  LIF  KQLEDGRT ADYN  K
Sbjct  256  IPPDQQRLIFAGKQLEDGRTLADYNIQK  283


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KIK81924.1| hypothetical protein PAXRUDRAFT_736824 [Paxillus rubicundulus 
Ve08.2h10]
Length=235

 Score =   310 bits (795),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +1

Query  37   YHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  216
            Y  R   +  +MQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  25   YQTRKPHASTRMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQ  84

Query  217  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  396
            LEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDK
Sbjct  85   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDK  144

Query  397  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            EGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  145  EGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  191


 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 127/141 (90%), Gaps = 5/141 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+ SDTI NVK
Sbjct  155  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDPSDTIGNVK  214

Query  379  AKIQDKEGIPPDQQRLIFAGK  441
            AKIQDKEGIPPDQQRLIFA K
Sbjct  215  AKIQDKEGIPPDQQRLIFARK  235


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE +SSD+IDNV  K QDKEGIPP
Sbjct  39   FVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPP  73


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE +SSD+IDNV  K QDKEGIPP
Sbjct  115  FVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPP  149


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE + SDTI NV  K QDKEGIPP
Sbjct  191  FVKTLTGKTITLEVDPSDTIGNVKAKIQDKEGIPP  225



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (794),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   314 bits (805),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            S    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  31   SPRLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  90

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  91   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  151  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  192


 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  268


 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  291

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  292  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  40   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  74


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  116  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  192  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  226


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  268  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  302



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K Q KEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPP  38



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  149  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  201


 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  110  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  164

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  165  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  224

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  225  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +1

Query  163  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  342
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  523  GMQIF  537
            GMQIF
Sbjct  121  GMQIF  125


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  49   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  83


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  125  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  159


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  201  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  235



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  273


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  197


 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  F  537
            F
Sbjct  121  F  121


 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 118/129 (91%), Gaps = 5/129 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGI  405
            AKIQDKEGI
Sbjct  297  AKIQDKEGI  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  197  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            F+KTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  45   FLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGI  634
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGI
Sbjct  273  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  171  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  223


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  246

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIF  537
            RTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIF  147


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  71   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  105


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  147  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  181


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  223  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  257


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  554  GKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            GK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPP  29



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  183  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  235


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  159


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  144  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  258

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  259  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   169 bits (428),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIF  537
            DYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIF  83


 Score = 62.4 bits (150),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  83   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  117


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  7    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  41


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  159  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  193


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  235  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  269



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  430  FAGKQLEDGRT  462
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 39/72 (54%), Gaps = 5/72 (7%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXS-----AXAYLXXKTAGGWAHSCX  700
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP       A   L     G    +  
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTGEVKETKS  215

Query  701  LQHXKRSRLFXW  736
             +  +R R   W
Sbjct  216  CRLPERCRFLRW  227


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   308 bits (790),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 116/127 (91%), Gaps = 5/127 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKE  399
            +KIQDKE
Sbjct  180  SKIQDKE  186


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  38


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  114


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKE  628
            FVKTLTGK ITLE ESSDTI+NV  K QDKE
Sbjct  156  FVKTLTGKTITLEVESSDTIENVKSKIQDKE  186



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  375


 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  451


 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  372  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  431

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  345
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  432  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  223  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  257


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  299  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  333


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  375  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  409



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   311 bits (796),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   313 bits (801),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   313 bits (801),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDN   K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPP  38



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   316 bits (810),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 164/172 (95%), Gaps = 4/172 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  130  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  181


 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  204

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  205  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  257


 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  166  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  280

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  281  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  333


 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  242  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  356

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  357  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  29   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  63


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  105  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  139


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  181  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  215


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  257  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  291


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  333  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            + +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  27   LGALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  86

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  87   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  146

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  147  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  200


 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  224  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  276


 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  185  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVK
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVK  299

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  300  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  352


 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  261  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  375

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  376  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  124  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  158


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  200  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  234


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  352  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  386


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  48   FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  82


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  276  FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  310



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKE IPP
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPP  134



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  62   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  122  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  174


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  138  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  197

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  198  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   197 bits (502),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/98 (99%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  98


 Score = 62.8 bits (151),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  98   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  132


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  22   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  56


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  174  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  208



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 5/172 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  96

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  156

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  208


 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 135/145 (93%), Gaps = 5/145 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  118  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDG  456
            KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  233  KIQDKEGIPPDQQRLIFAGKQLEDG  257


 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +1

Query  169  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  348
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  349  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  529  QIF  537
            QIF
Sbjct  130  QIF  132


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXSAXAYLXXKTAGGWAHS  694
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP         K      H+
Sbjct  208  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGVHA  260


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  56   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  90


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  132  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  166



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  132  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  184


 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  207

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  208  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  260


 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  169  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  283

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  284  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   192 bits (487),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +1

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  108


 Score = 62.8 bits (151),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  108  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  142


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  32   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  66


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  184  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  218


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  260  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  294



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 159/163 (98%), Gaps = 2/163 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  127

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  128  PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  170


 Score =   311 bits (797),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  79   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  193

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  194  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  246


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  155  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  269

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  270  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  524  ACKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            + + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  14   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  52


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  94   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  128


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  170  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  204


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  246  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  280



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (800),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 119/130 (92%), Gaps = 5/130 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIP  408
            AKIQDKEGIP
Sbjct  332  AKIQDKEGIP  341


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXS  646
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP  S
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPRIS  344



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K Q+KEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPP  190



>gb|EMS24129.1| ubiquitin C [Rhodosporidium toruloides NP11]
Length=238

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIF  156


 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 157/177 (89%), Gaps = 13/177 (7%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT--------ITLEVES  354
            IFAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKT        ITLEVES
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSITLEVES  179

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  180  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  236


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 30/43 (70%), Gaps = 8/43 (19%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESS--------DTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESS        DTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSITLEVESSDTIDNVKAKIQDKEGIPP  198



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  197


 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  273


 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  297  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   225 bits (573),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 121/156 (78%), Gaps = 35/156 (22%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  121


 Score = 62.8 bits (151),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  45   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  197  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  273  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  307



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            F+KTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  266



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  266



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|XP_003607659.1| Ubiquitin [Medicago truncatula]
Length=259

 Score =   310 bits (794),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/157 (98%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            +MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADY
Sbjct  28   QMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADY  87

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  88   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIF
Sbjct  148  IFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIF  184


 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFV TLTGKTITL+VESSDTI +VK
Sbjct  148  IFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVK  207

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              +++K GIP DQ R++ AGKQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  208  LTLEEKVGIPLDQVRVVIAGKQLKDSYTLAHYNIQKESTLHMVLQVFGG  256


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  521  EACKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            E  + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  27   EQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  66


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  142



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (767),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   TNLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEDIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVK LTGK ITLE ESSDTIDNV  K QDKE IPP
Sbjct  156  FVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPP  190



>dbj|BAC56573.1| similar to polyubiquitin [Bos taurus]
Length=171

 Score =   307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  219
            HLR   S +KMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  1    HLR-IHSQVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL  59

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  399
            EDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct  60   EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE  119

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            GIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  120  GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  165


 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 91/103 (88%), Gaps = 5/103 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  74   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL  128

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  327
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  129  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  171


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTI+NV  K QDKEGIPP
Sbjct  13   FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  47


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTI+NV  K QDKEGIPP
Sbjct  89   FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  123



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E+SDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  190



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ES+DTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPP  114



>ref|XP_003619701.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES75919.1| pentameric polyubiquitin [Medicago truncatula]
Length=290

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 145/173 (84%), Gaps = 20/173 (12%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE         
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE---------  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
                   G PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  171  ------RGYPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  217


 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 141/170 (83%), Gaps = 20/170 (12%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE                G PPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVE---------------RGYPPDQQRL  180

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  181  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  240

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  241  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  290


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  214  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  251


 Score = 42.7 bits (99),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  633  FPPXQXXLIFXXKQLEDGRTXADYNXPK  716
            +PP Q  LIF  KQLEDGRT ADYN  K
Sbjct  173  YPPDQQRLIFAGKQLEDGRTLADYNIQK  200


 Score = 27.3 bits (59),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGE  580
             + FVKTLTGK ITLE E
Sbjct  153  MQIFVKTLTGKTITLEVE  170



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   308 bits (790),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 141/163 (87%), Gaps = 6/163 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  120  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  507
            AKIQDKEGIPPDQQRLIFAG  L  G  L+   IQKESTLHLV
Sbjct  180  AKIQDKEGIPPDQQRLIFAGNNLRMG-GLSLIYIQKESTLHLV  221


 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK I LE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVK LTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  153  MQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 152/164 (93%), Gaps = 5/164 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  510
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|AES89856.2| polyubiquitin 3 [Medicago truncatula]
Length=231

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFV TLTGKTITL+VESSDTI +VK
Sbjct  120  IFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              +++K GIP DQ R++ AGKQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  180  LTLEEKVGIPLDQVRVVIAGKQLKDSYTLAHYNIQKESTLHMVLQVFGG  228


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  266


 Score =   311 bits (798),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  190


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  38   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  72


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  114  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  148


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  190  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  224


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  266  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  300



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   310 bits (793),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  191


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  155  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   203 bits (516),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  115


 Score = 61.6 bits (148),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  115  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  149


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  39   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  73


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  191  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  225



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (794),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ES DTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPP  114



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   312 bits (800),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 163/174 (94%), Gaps = 6/174 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +CS  LF  L+       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  18   LCSSALFPLLQ------AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  71

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  72   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  131

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  132  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  185


 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  94   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  209  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  261


 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  224

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  225  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  284

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  285  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  521  EACKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            +A + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  28   QAMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  67


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  109  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  143


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  185  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  219


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  261  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  295



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 162/218 (74%), Gaps = 50/218 (23%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYN-------------------------------------------  249
            IFAGKQLEDGRTLADYN                                           
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  250  --IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
              IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  180  AKIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  239

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  240  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  277


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  201  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  235


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  277  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  311



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   313 bits (801),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 162/218 (74%), Gaps = 50/218 (23%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYN-------------------------------------------  249
            IFAGKQLEDGRTLADYN                                           
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  250  --IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
              IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  180  AKIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  239

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  240  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  277


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  201  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  235


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  277  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  311



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  120

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  180

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  181  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  233


 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  196

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  197  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  256

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  257  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  309


 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  157


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  218  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  272

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  273  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  332

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEG+PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  AKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  81   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  115


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  157  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  191


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  233  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  267


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEG+PP
Sbjct  309  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPP  343


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIP  637
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIP
Sbjct  5    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  38



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   306 bits (785),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 5/128 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVK  179

Query  379  AKIQDKEG  402
            AKIQDKE 
Sbjct  180  AKIQDKEA  187


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E+SDTI+NV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPP  38


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E+SDTI+NV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPP  114


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEG  631
            FVKTLTGK ITLE E+SDTI+NV  K QDKE 
Sbjct  156  FVKTLTGKTITLEVEASDTIENVKAKIQDKEA  187



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 102/113 (90%), Gaps = 5/113 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  357
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  72   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  126

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  127  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  186

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  187  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  239


 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  122  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  163


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  148  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  262

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  263  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  11   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  45


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  87   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  163  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  197


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  239  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  273



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 155/168 (92%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTG  ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  153  MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE E+SDTIDNV  K QDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPP  38



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQ+RLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  200  AKIQDKEGIPPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   202 bits (513),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100


 Score = 58.2 bits (139),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKE IPP
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPP  134


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE +SSDTIDNV  K QDKEGIPP
Sbjct  24   FVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPP  58



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   311 bits (796),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   308 bits (789),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  61   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  115

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  116  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  175

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  176  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  228


 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  137  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  191

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  192  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  251

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  252  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  304


 Score =   305 bits (781),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  213  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  267

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  268  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  327

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  328  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  261
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  262  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  441
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  442  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  152


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  76   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  110


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  152  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  186


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  228  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  262


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  304  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  338


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  539  VKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            VKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  34



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 163/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  308


 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K Q+KEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPP  114



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  229


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190



>gb|ACB87916.1| polyubiquitin 1 [Malus domestica]
Length=208

 Score =   307 bits (786),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGR+LADYNIQKESTLHLVLRLRGGM IF
Sbjct  121  FAGKQLEDGRSLADYNIQKESTLHLVLRLRGGMHIF  156


 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 5/140 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR+LADYNIQKESTLHLVLRLRGGM IFVK+LTGKTITLEVESS+TIDNV+
Sbjct  120  IFAGKQLEDGRSLADYNIQKESTLHLVLRLRGGMHIFVKSLTGKTITLEVESSETIDNVQ  179

Query  379  AKIQDKEGIPPDQQRLIFAG  438
            AKIQDKEGIPPDQQRLIFAG
Sbjct  180  AKIQDKEGIPPDQQRLIFAG  199


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXSAXAYLXXKTAGGWA  688
            FVK+LTGK ITLE ESS+TIDNV  K QDKEGIPP            GG A
Sbjct  156  FVKSLTGKTITLEVESSETIDNVQAKIQDKEGIPPDQQRLIFAGTVRGGLA  206


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTG+ ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPP  114



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  41   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  95

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  96   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  155

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  156  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  208


 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  117  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  171

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  172  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  231

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  232  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 132/156 (85%), Gaps = 24/156 (15%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  132


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  56   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  90


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  132  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  166


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  208  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  242



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  182  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  234


 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  257

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  258  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  310


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/158 (99%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  158


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  219  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  273

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  333

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  6    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  40


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  82   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  116


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  158  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  192


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  234  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  268


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  310  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  344



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (782),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   308 bits (788),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXSAXAYLXXK  670
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP      L  K
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGK  352


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPPXSAXAYLXXKTA--GGWAHSCXLQ  706
            FVKTLTGK ITLE ESSDT DNV  K QDKEGIPP         K    G     C +Q
Sbjct  80   FVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQ  138



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  266



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  308


 Score =   308 bits (790),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 89/100 (89%), Gaps = 5/100 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  318
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  308


 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K  DKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPP  114



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  381


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   307 bits (786),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 145/156 (93%), Gaps = 5/156 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  486
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ L
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  342



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITL+ ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE E SDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPP  38



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  91   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  145

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  146  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  205

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  206  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  258


 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  167  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  222  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  281

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  282  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  334


 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  243  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  297

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  298  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  357

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   221 bits (563),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = +1

Query  115  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  294
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  295  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  474
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  475  NIQKESTLHLVLRLRGGMQIF  537
            NIQKESTLHLVLRLRGGMQIF
Sbjct  162  NIQKESTLHLVLRLRGGMQIF  182


 Score = 62.8 bits (151),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  182  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  216


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  106  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  140


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  258  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  292


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  334  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  368



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  38


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  114


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  190


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTI+NV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  266



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ES+DTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPP  114



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK +TLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPP  342



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  38



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  252


 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  275

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  276  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  328


 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 160/166 (96%), Gaps = 3/166 (2%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  219
            +L  S S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  14   YLESSTS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  70

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  399
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  71   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  130

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  131  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176


 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  237  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  291

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  292  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  351

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  352  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  524  ACKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            + + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  20   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  252  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  286


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  328  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  362



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIF  156


 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   303 bits (775),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 5/172 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 5/172 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 148/159 (93%), Gaps = 5/159 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ L
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLSLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   310 bits (795),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIF  156


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   312 bits (799),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 161/170 (95%), Gaps = 3/170 (2%)
 Frame = +1

Query  28   NLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  207
            N F    H+ S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  33   NPFKPTLHTPS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  89

Query  208  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  387
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  90   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  149

Query  388  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            QDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  150  QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  199


 Score =   311 bits (796),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  275


 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  239  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  298

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  299  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  524  ACKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            + + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  43   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  81


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  123  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  157


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  199  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  233


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  275  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  309



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   307 bits (786),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   302 bits (774),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   310 bits (794),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232


 Score =   305 bits (782),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K Q KEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPP  38



>dbj|BAK61738.1| ubiquitin [Larcopyle butschlii]
Length=188

 Score =   306 bits (783),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 116/129 (90%), Gaps = 5/129 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTI NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVESSDTISNVK  179

Query  379  AKIQDKEGI  405
            AKIQDKEGI
Sbjct  180  AKIQDKEGI  188


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITL+ ESSDTI NV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPP  38


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITL+ ESSDTI NV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPP  114


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGI  634
            FVKTLTGK ITL+ ESSDTI NV  K QDKEGI
Sbjct  156  FVKTLTGKTITLDVESSDTISNVKAKIQDKEGI  188



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDT+DNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  114



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  527  CKSFVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
             + FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232


 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 162/173 (94%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308


 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156


 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  FVKTLTGKXITLEGESSDTIDNVXGKXQDKEGIPP  640
            FVKTLTGK ITLE ESSDTIDNV  K QDKEGIPP
Sbjct