BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024N23

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB38279.1|  hypothetical protein B456_006G246000                    102   6e-24   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                102   1e-23   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    102   2e-23   Gossypium raimondii
gb|KJB38278.1|  hypothetical protein B456_006G246000                    102   3e-23   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    100   5e-23   Gossypium arboreum [tree cotton]
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   100   5e-23   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...  99.0    2e-22   Populus euphratica
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...  99.0    2e-22   Populus euphratica
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like    97.1    4e-22   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                  97.8    8e-22   Gossypium arboreum [tree cotton]
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein               96.7    9e-22   Medicago truncatula
gb|AFK42031.1|  unknown                                               97.1    9e-22   Medicago truncatula
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein           96.7    2e-21   Medicago truncatula
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein               96.3    3e-21   Medicago truncatula
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14        96.3    3e-21   Prunus mume [ume]
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like   95.9    3e-21   
gb|KJB28413.1|  hypothetical protein B456_005G046500                  95.9    3e-21   Gossypium raimondii
gb|KDP40274.1|  hypothetical protein JCGZ_02272                       95.9    4e-21   Jatropha curcas
emb|CDO99148.1|  unnamed protein product                              95.9    4e-21   Coffea canephora [robusta coffee]
gb|AFK37379.1|  unknown                                               95.1    7e-21   Medicago truncatula
gb|AFZ78616.1|  hypothetical protein                                  94.0    1e-20   Populus tomentosa [Chinese white poplar]
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...  94.0    2e-20   Populus euphratica
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...  94.0    2e-20   Populus euphratica
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like   94.0    2e-20   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg           93.6    2e-20   
gb|AFZ78617.1|  hypothetical protein                                  94.0    2e-20   Populus tomentosa [Chinese white poplar]
ref|XP_002311658.1|  aux/IAA family protein                           93.6    2e-20   Populus trichocarpa [western balsam poplar]
ref|NP_001240213.1|  auxin-induced protein ali50                      93.2    4e-20   Glycine max [soybeans]
ref|NP_001280875.1|  auxin-responsive protein IAA14-like              92.4    6e-20   Malus domestica [apple tree]
gb|ADL70640.1|  indole-3-acetic acid inducible 14                     90.9    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14        92.4    7e-20   Nicotiana tomentosiformis
gb|ADL70642.1|  indole-3-acetic acid inducible 14                     90.9    8e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70639.1|  indole-3-acetic acid inducible 14                     90.9    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...  92.0    8e-20   Cicer arietinum [garbanzo]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...  92.0    1e-19   
gb|ADB93628.1|  indole-3-acetic acid inducible 14                     90.9    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315736.1|  aux/IAA family protein                           92.0    1e-19   Populus trichocarpa [western balsam poplar]
gb|ADB93625.2|  indole-3-acetic acid inducible 14                     90.9    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93627.2|  indole-3-acetic acid inducible 14                     90.9    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93629.2|  indole-3-acetic acid inducible 14                     90.5    1e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like    91.7    1e-19   Malus prunifolia
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100             91.3    2e-19   Arabis alpina [alpine rockcress]
dbj|BAH56942.1|  AT4G14550                                            90.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAC84710.1|  aux/IAA protein                                      91.3    3e-19   Populus tremula x Populus tremuloides
ref|NP_193191.2|  auxin-responsive protein IAA14                      90.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like   90.5    3e-19   Cucumis melo [Oriental melon]
gb|ADL70641.1|  indole-3-acetic acid inducible 14                     89.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAB46059.1|  IAA7 like protein                                    90.1    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like   90.1    4e-19   Populus euphratica
gb|AFK44393.1|  unknown                                               89.7    6e-19   Lotus japonicus
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like   89.0    9e-19   Nicotiana sylvestris
emb|CDY63072.1|  BnaCnng41350D                                        90.5    1e-18   Brassica napus [oilseed rape]
emb|CDX89832.1|  BnaA10g02500D                                        89.0    1e-18   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like   89.0    1e-18   Brassica rapa
gb|KHN30563.1|  Auxin-responsive protein IAA14                        89.0    1e-18   Glycine soja [wild soybean]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like   88.6    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14        88.6    2e-18   Sesamum indicum [beniseed]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17        88.2    2e-18   Brassica rapa
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14        88.2    2e-18   Tarenaya hassleriana [spider flower]
emb|CDY15493.1|  BnaA08g27770D                                        88.2    2e-18   Brassica napus [oilseed rape]
gb|ADB93635.1|  indole-3-acetic acid inducible 17                     86.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM21317.1|AF373100_1  auxin-regulated protein                     88.2    2e-18   Populus tremula x Populus tremuloides
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14        87.4    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like   87.8    4e-18   Populus euphratica
ref|XP_010087762.1|  Auxin-responsive protein IAA7                    87.8    4e-18   
emb|CDY18214.1|  BnaC05g02370D                                        87.0    5e-18   Brassica napus [oilseed rape]
gb|AFS44507.1|  auxin repressor                                       86.7    6e-18   Fragaria x ananassa
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like   87.4    6e-18   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg           87.0    6e-18   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g           87.0    7e-18   Phaseolus vulgaris [French bean]
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g           86.7    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like    86.3    1e-17   Nicotiana tomentosiformis
gb|ABH01143.1|  auxin-regulated protein                               86.7    1e-17   Populus tomentosa [Chinese white poplar]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451           86.3    1e-17   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g           86.3    1e-17   Populus trichocarpa [western balsam poplar]
gb|KHN05057.1|  Auxin-responsive protein IAA14                        86.3    1e-17   Glycine soja [wild soybean]
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg           85.9    1e-17   Capsella rubella
gb|ADL70685.1|  indole-3-acetic acid inducible 17                     84.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like   85.5    2e-17   Fragaria vesca subsp. vesca
ref|NP_171921.1|  auxin-responsive protein IAA17                      85.1    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70684.1|  indole-3-acetic acid inducible 17                     83.6    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401           84.7    3e-17   
emb|CDY10068.1|  BnaC08g43830D                                        84.7    3e-17   Brassica napus [oilseed rape]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14        84.7    4e-17   Vitis vinifera
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like   84.3    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17        84.3    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg           84.3    5e-17   Eutrema salsugineum [saltwater cress]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                  84.3    5e-17   Arabis alpina [alpine rockcress]
emb|CDY32537.1|  BnaA09g50590D                                        83.6    8e-17   Brassica napus [oilseed rape]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like   83.6    9e-17   Brassica rapa
gb|KJB82526.1|  hypothetical protein B456_013G200700                  83.2    9e-17   Gossypium raimondii
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like   83.6    9e-17   Camelina sativa [gold-of-pleasure]
emb|CDY63910.1|  BnaC01g43640D                                        83.6    1e-16   Brassica napus [oilseed rape]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like   83.2    1e-16   Camelina sativa [gold-of-pleasure]
emb|CBI26357.3|  unnamed protein product                              83.2    1e-16   Vitis vinifera
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1          83.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg              82.4    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like   82.4    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg           82.8    3e-16   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16        82.4    3e-16   Fragaria vesca subsp. vesca
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg           82.0    3e-16   Capsella rubella
ref|NP_974355.1|  auxin-responsive protein IAA7                       81.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7         82.0    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  81.6    4e-16   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like   81.6    4e-16   Solanum tuberosum [potatoes]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...  81.6    5e-16   Cucumis sativus [cucumbers]
gb|KJB82525.1|  hypothetical protein B456_013G200700                  81.6    5e-16   Gossypium raimondii
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)         81.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                       81.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like   81.3    7e-16   Cucumis melo [Oriental melon]
gb|ADJ68049.1|  auxin responsive protein                              81.3    7e-16   Catharanthus roseus [chatas]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like    80.9    8e-16   Camelina sativa [gold-of-pleasure]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                  80.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                  80.5    1e-15   Gossypium arboreum [tree cotton]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16        80.1    2e-15   Nicotiana tomentosiformis
gb|AEE25654.1|  auxin-responsive protein                              80.1    2e-15   Gossypium hirsutum [American cotton]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg           80.1    2e-15   Eutrema salsugineum [saltwater cress]
ref|NP_001288823.1|  auxin-responsive protein IAA7                    80.1    2e-15   Brassica rapa
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg           80.1    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like   80.1    2e-15   Cicer arietinum [garbanzo]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2      79.7    2e-15   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like   79.7    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like    79.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative         79.3    3e-15   Ricinus communis
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like    79.0    4e-15   Brassica rapa
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024           79.0    5e-15   Arabidopsis lyrata subsp. lyrata
emb|CDY47148.1|  BnaA08g05350D                                        78.6    5e-15   Brassica napus [oilseed rape]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14        78.6    5e-15   Brassica rapa
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16             78.6    6e-15   
ref|NP_001288939.1|  auxin-responsive protein IAA16                   78.2    7e-15   Brassica rapa
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              78.2    8e-15   Erythranthe guttata [common monkey flower]
gb|AFK44192.1|  unknown                                               78.2    9e-15   Medicago truncatula
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like   77.8    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY50750.1|  BnaAnng10570D                                        78.2    1e-14   Brassica napus [oilseed rape]
emb|CDY62130.1|  BnaC08g47390D                                        77.8    1e-14   Brassica napus [oilseed rape]
emb|CDY41894.1|  BnaC05g47100D                                        77.4    1e-14   Brassica napus [oilseed rape]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        77.4    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   77.0    2e-14   Camelina sativa [gold-of-pleasure]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                  77.0    2e-14   Arabis alpina [alpine rockcress]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like   77.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg           77.0    2e-14   
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                 76.6    2e-14   Citrus sinensis [apfelsine]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg              77.0    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg           76.6    3e-14   Eutrema salsugineum [saltwater cress]
dbj|BAJ34138.1|  unnamed protein product                              76.6    3e-14   Eutrema halophilum
gb|EPS64756.1|  hypothetical protein M569_10024                       76.3    3e-14   Genlisea aurea
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg           76.3    3e-14   Citrus clementina [clementine]
emb|CDY30017.1|  BnaC01g39910D                                        75.9    5e-14   Brassica napus [oilseed rape]
emb|CDY10349.1|  BnaC05g29300D                                        75.1    9e-14   Brassica napus [oilseed rape]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16        75.1    9e-14   Nicotiana sylvestris
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like   75.1    9e-14   Brassica rapa
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg           74.7    1e-13   Capsella rubella
gb|ADL70689.1|  indole-3-acetic acid inducible 17                     73.6    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187124.1|  auxin-responsive protein IAA16                      74.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268036.1|  uncharacterized protein LOC100250231             74.7    1e-13   Vitis vinifera
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17        74.3    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14        74.3    2e-13   Sesamum indicum [beniseed]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like              73.9    2e-13   Solanum tuberosum [potatoes]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16        74.3    2e-13   Prunus mume [ume]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16             74.3    2e-13   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                       74.3    2e-13   Jatropha curcas
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like   74.3    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1         73.9    2e-13   Nelumbo nucifera [Indian lotus]
ref|NP_001280973.1|  auxin-responsive protein IAA16                   73.9    2e-13   Malus domestica [apple tree]
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like   73.9    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like   73.9    3e-13   Nicotiana sylvestris
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16        73.6    3e-13   Pyrus x bretschneideri [bai li]
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein               73.6    4e-13   Medicago truncatula
gb|KJB44872.1|  hypothetical protein B456_007G276900                  73.2    4e-13   Gossypium raimondii
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein               73.6    4e-13   Medicago truncatula
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like    73.2    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg           73.6    4e-13   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  73.2    5e-13   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like   73.2    5e-13   
gb|KJB44873.1|  hypothetical protein B456_007G276900                  72.8    6e-13   Gossypium raimondii
emb|CAN72026.1|  hypothetical protein VITISV_014421                   73.2    7e-13   Vitis vinifera
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like      72.4    8e-13   Sesamum indicum [beniseed]
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like   72.0    1e-12   Nelumbo nucifera [Indian lotus]
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                    71.2    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like   71.2    2e-12   Vitis vinifera
emb|CAN63268.1|  hypothetical protein VITISV_013635                   70.9    3e-12   Vitis vinifera
gb|ABR08758.1|  auxin-resistance protein 3                            69.7    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2      70.9    3e-12   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                     70.9    3e-12   Solanum tuberosum [potatoes]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1      70.9    5e-12   
ref|NP_001266070.1|  IAA14                                            69.7    6e-12   Solanum lycopersicum
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...  69.7    6e-12   Elaeis guineensis
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...  69.7    7e-12   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760        69.7    8e-12   Amborella trichopoda
ref|NP_001266049.1|  IAA9 protein                                     69.7    8e-12   Solanum lycopersicum
ref|XP_002299625.1|  auxin-induced protein IAA4                       69.3    9e-12   Populus trichocarpa [western balsam poplar]
gb|ABR08763.1|  auxin-resistance protein 3                            67.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78621.1|  hypothetical protein                                  68.6    1e-11   Populus tomentosa [Chinese white poplar]
gb|ADL70687.1|  indole-3-acetic acid inducible 17                     67.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14        67.8    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_002302075.1|  auxin-induced protein aux28                      67.8    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1         67.8    3e-11   Populus euphratica
gb|KDP21369.1|  hypothetical protein JCGZ_21840                       67.8    4e-11   Jatropha curcas
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg           67.4    4e-11   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg           67.4    4e-11   Citrus clementina [clementine]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g           67.4    5e-11   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like      67.4    5e-11   Populus euphratica
ref|XP_010102292.1|  Auxin-responsive protein IAA16                   67.4    5e-11   Morus notabilis
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g           67.8    5e-11   Phaseolus vulgaris [French bean]
ref|XP_006383686.1|  auxin-induced protein aux28                      67.0    6e-11   Populus trichocarpa [western balsam poplar]
gb|EPS60474.1|  hypothetical protein M569_14329                       67.0    6e-11   Genlisea aurea
gb|ABD98055.1|  auxin-regulated protein                               67.0    7e-11   Striga asiatica [witchweed]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                 66.6    9e-11   Citrus sinensis [apfelsine]
emb|CAC84711.1|  aux/IAA protein                                      65.5    2e-10   Populus tremula x Populus tremuloides
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                  65.1    2e-10   Arabis alpina [alpine rockcress]
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like   65.1    2e-10   Sesamum indicum [beniseed]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like      64.7    3e-10   Populus euphratica
gb|ACU19136.1|  unknown                                               64.7    4e-10   Glycine max [soybeans]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   64.7    4e-10   Glycine max [soybeans]
ref|NP_001266055.1|  IAA10 protein                                    64.7    4e-10   Solanum lycopersicum
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like   64.3    4e-10   Nicotiana sylvestris
gb|KHN31465.1|  Auxin-responsive protein IAA16                        64.7    4e-10   Glycine soja [wild soybean]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   64.7    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11142.1|  hypothetical protein B456_001G242900                  64.3    5e-10   Gossypium raimondii
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like   64.3    5e-10   Phoenix dactylifera
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...  63.9    8e-10   Glycine max [soybeans]
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  63.5    9e-10   Tarenaya hassleriana [spider flower]
gb|AEE25650.1|  auxin-responsive protein                              63.9    9e-10   Gossypium hirsutum [American cotton]
gb|ACU19616.1|  unknown                                               63.5    9e-10   Glycine max [soybeans]
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member          63.5    9e-10   Ipomoea nil [qian niu]
gb|KJB11145.1|  hypothetical protein B456_001G242900                  63.9    1e-09   Gossypium raimondii
gb|KJB11141.1|  hypothetical protein B456_001G242900                  63.9    1e-09   Gossypium raimondii
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   63.9    1e-09   Elaeis guineensis
emb|CAH59413.1|  auxin resistance protein                             63.5    1e-09   Plantago major [cart-track plant]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like   63.2    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP37176.1|  hypothetical protein JCGZ_06232                       62.8    2e-09   Jatropha curcas
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...  62.8    2e-09   Elaeis guineensis
emb|CBI36106.3|  unnamed protein product                              63.5    2e-09   Vitis vinifera
gb|KJB11146.1|  hypothetical protein B456_001G242900                  63.5    2e-09   Gossypium raimondii
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...  63.2    2e-09   Elaeis guineensis
emb|CDP06818.1|  unnamed protein product                              62.8    2e-09   Coffea canephora [robusta coffee]
ref|NP_001290520.1|  auxin-responsive protein IAA1                    62.4    2e-09   Elaeis guineensis
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like   62.4    2e-09   Solanum tuberosum [potatoes]
ref|NP_001239753.1|  uncharacterized protein LOC100781847             62.4    3e-09   Glycine max [soybeans]
gb|KHG04941.1|  Auxin-induced AUX28                                   62.4    3e-09   Gossypium arboreum [tree cotton]
gb|KJB42200.1|  hypothetical protein B456_007G141900                  62.0    3e-09   Gossypium raimondii
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like   62.4    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237212.1|  uncharacterized protein LOC100499872             62.0    3e-09   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   62.0    4e-09   Cucumis sativus [cucumbers]
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...  61.6    4e-09   
ref|XP_007013279.1|  Indoleacetic acid-induced protein 16, putative   61.6    5e-09   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative            61.6    6e-09   Ricinus communis
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...  60.8    7e-09   
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                 60.5    8e-09   Citrus sinensis [apfelsine]
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...  60.8    8e-09   Theobroma cacao [chocolate]
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      60.5    8e-09   
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg           60.8    8e-09   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg           60.5    1e-08   Citrus clementina [clementine]
gb|ACJ83896.1|  unknown                                               60.5    1e-08   Medicago truncatula
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14        59.7    1e-08   Sesamum indicum [beniseed]
ref|XP_009395806.1|  PREDICTED: auxin-responsive protein IAA1-like    60.1    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg           60.5    2e-08   Citrus clementina [clementine]
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like      59.7    2e-08   
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like    59.7    2e-08   Phoenix dactylifera
gb|KHN22078.1|  Auxin-responsive protein IAA16                        59.7    2e-08   Glycine soja [wild soybean]
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                 59.7    2e-08   Citrus sinensis [apfelsine]
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      59.7    2e-08   
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                 59.3    2e-08   Citrus sinensis [apfelsine]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                 59.3    3e-08   Citrus sinensis [apfelsine]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like   60.1    3e-08   Eucalyptus grandis [rose gum]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                 59.3    3e-08   Cucumis sativus [cucumbers]
gb|AFK45766.1|  unknown                                               59.7    3e-08   Medicago truncatula
gb|KEH27147.1|  auxin response factor                                 59.7    3e-08   Medicago truncatula
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                 58.9    5e-08   Citrus sinensis [apfelsine]
ref|XP_008811586.1|  PREDICTED: auxin-responsive protein IAA1-like    58.5    5e-08   Phoenix dactylifera
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like    58.2    7e-08   Elaeis guineensis
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...  58.2    7e-08   Cucumis melo [Oriental melon]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like   58.5    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  58.2    9e-08   Cucumis melo [Oriental melon]
gb|AEA86335.1|  auxin-responsive protein IAA                          56.6    1e-07   Solanum nigrum
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like    57.4    1e-07   Sesamum indicum [beniseed]
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like      57.8    1e-07   Cicer arietinum [garbanzo]
gb|AFK43673.1|  unknown                                               58.2    1e-07   Lotus japonicus
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative          57.0    2e-07   Ricinus communis
gb|EYU24679.1|  hypothetical protein MIMGU_mgv1a023210mg              56.2    2e-07   
ref|XP_010110305.1|  Auxin-responsive protein IAA17                   56.6    2e-07   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like      56.6    3e-07   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like   56.6    3e-07   
ref|NP_001266077.1|  IAA15                                            56.6    4e-07   
gb|KJB56687.1|  hypothetical protein B456_009G132200                  55.5    4e-07   
emb|CBI28126.3|  unnamed protein product                              55.8    5e-07   
ref|XP_009782640.1|  PREDICTED: auxin-responsive protein IAA17-like   55.8    5e-07   
ref|XP_002284861.1|  PREDICTED: auxin-responsive protein IAA1-like    55.8    5e-07   
gb|EPS59988.1|  auxin-regulated protein                               57.0    5e-07   
emb|CBW30571.1|  auxin-responsive protein iaa27                       55.8    6e-07   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like      56.2    6e-07   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g           55.8    7e-07   
emb|CAD30274.1|  IAA16 protein                                        55.1    7e-07   
gb|KJB56686.1|  hypothetical protein B456_009G132200                  55.1    8e-07   
ref|NP_001266039.1|  IAA7 protein                                     55.1    1e-06   
emb|CDY25617.1|  BnaA04g13090D                                        55.5    1e-06   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  55.5    1e-06   
ref|XP_009587946.1|  PREDICTED: auxin-induced protein 22E-like        53.5    2e-06   
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like      53.1    2e-06   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like      54.7    2e-06   
ref|XP_007201398.1|  hypothetical protein PRUPE_ppa010342mg           52.8    4e-06   
ref|XP_002520979.1|  Auxin-induced protein 22E, putative              53.1    4e-06   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   53.5    5e-06   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                     53.5    5e-06   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  53.5    5e-06   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg              53.1    6e-06   
ref|XP_010278166.1|  PREDICTED: auxin-responsive protein IAA4-like    52.4    7e-06   
ref|XP_006298679.1|  hypothetical protein CARUB_v10014772mg           52.0    7e-06   
gb|AGG19163.1|  auxin-responsive Aux/IAA protein                      52.4    8e-06   
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    53.5    8e-06   
ref|XP_003568720.1|  PREDICTED: auxin-responsive protein IAA17-like   52.8    8e-06   
ref|XP_010512011.1|  PREDICTED: auxin-responsive protein IAA2-like    51.6    9e-06   
ref|XP_010274202.1|  PREDICTED: auxin-induced protein 22B             52.0    9e-06   
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8         53.1    9e-06   
dbj|BAI94494.1|  Aux/IAA protein                                      52.8    1e-05   
ref|XP_010466600.1|  PREDICTED: auxin-responsive protein IAA2 iso...  51.6    1e-05   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   52.8    1e-05   
ref|XP_010532598.1|  PREDICTED: auxin-responsive protein IAA1         51.6    1e-05   
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like        51.6    1e-05   
gb|AFK36684.1|  unknown                                               51.6    1e-05   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like      52.4    1e-05   
gb|AFK36086.1|  unknown                                               52.4    2e-05   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like   52.4    2e-05   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg           52.0    2e-05   
ref|XP_008377585.1|  PREDICTED: auxin-responsive protein IAA1         51.6    2e-05   
dbj|BAK05607.1|  predicted protein                                    52.0    2e-05   
gb|KHN18836.1|  Auxin-induced protein AUX28                           52.0    2e-05   
gb|AFN25816.1|  auxin inducible protein IAA3                          52.4    2e-05   
gb|ACU18407.1|  unknown                                               52.0    2e-05   
emb|CAE00638.1|  IAA1 protein                                         52.0    2e-05   
gb|KHN44139.1|  Auxin-responsive protein IAA17                        52.4    2e-05   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg           52.0    2e-05   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like      52.0    2e-05   
emb|CAN70529.1|  hypothetical protein VITISV_010217                   51.2    2e-05   
gb|ACN27887.1|  unknown                                               51.2    2e-05   
gb|ABD98054.1|  auxin-regulated protein                               52.4    2e-05   
gb|AAU04408.1|  auxin-induced protein 22D                             50.1    2e-05   
gb|ABY65124.1|  At1g04250                                             49.7    2e-05   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like   52.0    2e-05   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like      52.0    2e-05   
ref|XP_004289902.1|  PREDICTED: auxin-induced protein 22D-like        50.8    2e-05   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like   52.0    2e-05   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like   51.2    2e-05   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like   52.0    2e-05   
ref|XP_002280524.2|  PREDICTED: auxin-responsive protein IAA1         51.2    3e-05   
ref|XP_008451269.1|  PREDICTED: auxin-induced protein 22D-like        50.8    3e-05   
emb|CBI36192.3|  unnamed protein product                              51.6    3e-05   
ref|NP_001130483.1|  IAA17-auxin-responsive Aux/IAA family member     51.2    3e-05   
ref|NP_001235069.1|  uncharacterized protein LOC100500488             50.4    3e-05   
gb|KHN30562.1|  Auxin-induced protein 22B                             50.4    3e-05   
ref|NP_001236693.1|  auxin-induced protein AUX28                      50.8    4e-05   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like   51.6    4e-05   
gb|ADL36579.1|  ARF domain class transcription factor                 50.1    4e-05   
gb|KHN02537.1|  Auxin-induced protein AUX28                           51.2    4e-05   
gb|ACU21378.1|  unknown                                               51.2    4e-05   
emb|CDX89499.1|  BnaC04g35180D                                        51.2    4e-05   
emb|CDO99147.1|  unnamed protein product                              50.1    5e-05   
ref|XP_010691245.1|  PREDICTED: auxin-responsive protein IAA1         50.1    5e-05   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...  50.4    5e-05   
gb|ABY65138.1|  At1g04250                                             48.5    5e-05   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like      50.8    5e-05   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...  50.4    5e-05   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like   50.1    6e-05   
gb|KDO58189.1|  hypothetical protein CISIN_1g044582mg                 50.1    6e-05   
gb|AAC36584.1|  putative IAA-related protein                          49.3    6e-05   
ref|NP_001266034.1|  IAA6 protein                                     50.8    6e-05   
ref|XP_007215971.1|  hypothetical protein PRUPE_ppa011570mg           50.1    6e-05   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...  50.4    6e-05   
ref|XP_008228610.1|  PREDICTED: auxin-responsive protein IAA1         50.1    6e-05   
gb|ABY65168.1|  At1g04250-like protein                                48.1    6e-05   
ref|XP_007143879.1|  hypothetical protein PHAVU_007G109700g           49.7    6e-05   
ref|XP_003559829.1|  PREDICTED: auxin-responsive protein IAA13-like   50.1    7e-05   
ref|XP_006420091.1|  hypothetical protein CICLE_v10006002mg           48.9    7e-05   
ref|XP_011091109.1|  PREDICTED: auxin-induced protein 22D             49.7    7e-05   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...  50.4    8e-05   
ref|XP_006427106.1|  hypothetical protein CICLE_v10026522mg           49.7    8e-05   
gb|AAD32145.1|AF123507_1  Nt-iaa4.5 deduced protein                   49.3    8e-05   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like      50.1    8e-05   
ref|XP_010488344.1|  PREDICTED: auxin-responsive protein IAA2-like    49.7    8e-05   
gb|KJB27117.1|  hypothetical protein B456_004G279200                  49.7    9e-05   
ref|XP_004981819.1|  PREDICTED: auxin-responsive protein IAA13-li...  50.1    9e-05   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...  50.4    9e-05   
ref|XP_009764468.1|  PREDICTED: auxin-induced protein 22D-like        49.3    9e-05   
gb|EMT10037.1|  Auxin-responsive protein IAA3                         50.1    9e-05   
gb|AAM12952.1|  auxin-regulated protein                               50.4    1e-04   
ref|NP_001241599.1|  uncharacterized protein LOC100803065             50.1    1e-04   
ref|XP_009389018.1|  PREDICTED: auxin-induced protein 22D-like        49.3    1e-04   
ref|XP_006379864.1|  hypothetical protein POPTR_0008s16100g           49.7    1e-04   
ref|XP_010551701.1|  PREDICTED: auxin-responsive protein IAA1-like    48.9    1e-04   
gb|KHG00541.1|  Auxin-responsive IAA16 -like protein                  49.3    1e-04   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative          48.9    1e-04   
ref|XP_008353297.1|  PREDICTED: auxin-induced protein 22D-like        48.5    1e-04   
ref|XP_010529092.1|  PREDICTED: auxin-responsive protein IAA1-like    48.9    1e-04   
ref|XP_002312567.1|  hypothetical protein POPTR_0008s16100g           49.3    1e-04   
ref|XP_002281696.1|  PREDICTED: auxin-induced protein 22D             48.9    1e-04   
ref|XP_006420092.1|  hypothetical protein CICLE_v10006002mg           48.9    1e-04   
gb|AFZ78615.1|  hypothetical protein                                  48.9    1e-04   
ref|XP_004960656.1|  PREDICTED: auxin-responsive protein IAA17-like   49.7    1e-04   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  49.7    1e-04   
gb|AAC49055.1|  IAA14                                                 48.1    1e-04   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                   48.9    1e-04   
ref|XP_009339009.1|  PREDICTED: auxin-responsive protein IAA1         48.9    2e-04   
emb|CDO98081.1|  unnamed protein product                              48.5    2e-04   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  49.3    2e-04   
ref|XP_010925299.1|  PREDICTED: auxin-responsive protein IAA1-like    48.5    2e-04   
gb|KHN18839.1|  Auxin-induced protein 22D                             48.5    2e-04   
ref|XP_010069174.1|  PREDICTED: auxin-induced protein 22B-like        48.5    2e-04   
ref|NP_001242729.1|  uncharacterized protein LOC100780752             48.5    2e-04   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590        48.9    2e-04   
ref|XP_007204720.1|  hypothetical protein PRUPE_ppa010303mg           48.9    2e-04   
ref|XP_004302956.1|  PREDICTED: auxin-responsive protein IAA17        48.1    2e-04   
ref|XP_006418151.1|  hypothetical protein EUTSA_v10008636mg           48.9    2e-04   
ref|XP_006366662.1|  PREDICTED: auxin-responsive protein IAA3-like    48.1    2e-04   
emb|CDY18679.1|  BnaA09g07160D                                        48.9    2e-04   
ref|XP_008242685.1|  PREDICTED: auxin-responsive protein IAA1-like    48.9    2e-04   
ref|XP_009612692.1|  PREDICTED: auxin-responsive protein IAA4-like    48.1    2e-04   
ref|XP_009398567.1|  PREDICTED: auxin-induced protein 22D-like        48.1    2e-04   
ref|XP_007150685.1|  hypothetical protein PHAVU_005G173000g           48.1    3e-04   
gb|KDP21371.1|  hypothetical protein JCGZ_21842                       48.1    3e-04   
gb|ABG81096.1|  AUX/IAA-like protein                                  48.1    3e-04   
ref|XP_009337290.1|  PREDICTED: auxin-induced protein 22D             47.8    3e-04   
ref|XP_006356050.1|  PREDICTED: auxin-responsive protein IAA3-like    47.8    3e-04   
gb|ADL70717.1|  indole-3-acetic acid inducible 19                     47.0    3e-04   
ref|XP_009765454.1|  PREDICTED: auxin-responsive protein IAA4-like    47.8    3e-04   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...  48.9    3e-04   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative         48.9    3e-04   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like   48.5    3e-04   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                  48.5    4e-04   
gb|ADL70712.1|  indole-3-acetic acid inducible 19                     46.6    4e-04   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...  48.5    4e-04   
gb|ADL70715.1|  indole-3-acetic acid inducible 19                     46.6    4e-04   
ref|XP_009589137.1|  PREDICTED: auxin-induced protein 22D-like        47.8    4e-04   
gb|ADL70710.1|  indole-3-acetic acid inducible 19                     46.6    4e-04   
gb|AAD32144.1|AF123506_1  Nt-iaa4.3 deduced protein                   47.8    4e-04   
emb|CDP02673.1|  unnamed protein product                              48.5    4e-04   
gb|ADL70709.1|  indole-3-acetic acid inducible 19                     46.6    5e-04   
gb|AIN39810.1|  hypothetical protein                                  48.1    5e-04   
ref|XP_002531289.1|  Auxin-induced protein 22D, putative              47.4    5e-04   
gb|KHN03839.1|  Auxin-induced protein 22D                             47.4    5e-04   
ref|NP_001242395.1|  uncharacterized protein LOC100799875             47.4    5e-04   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1       48.1    5e-04   
ref|XP_007144687.1|  hypothetical protein PHAVU_007G176700g           47.4    6e-04   
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g           48.1    6e-04   
ref|XP_011027531.1|  PREDICTED: auxin-induced protein 22D             47.0    6e-04   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...  48.1    6e-04   
gb|KDP33705.1|  hypothetical protein JCGZ_07276                       47.8    6e-04   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g           47.8    6e-04   
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...  48.1    6e-04   
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                   48.1    6e-04   
ref|XP_004139234.1|  PREDICTED: auxin-induced protein 22D-like        47.0    6e-04   
tpg|DAA59796.1|  TPA: hypothetical protein ZEAMMB73_081702            47.0    6e-04   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    47.8    6e-04   
ref|XP_011082600.1|  PREDICTED: auxin-induced protein 22D-like        47.0    7e-04   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27        47.8    7e-04   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               47.8    7e-04   
emb|CDX82428.1|  BnaA03g33930D                                        47.0    7e-04   
gb|ADB93648.2|  indole-3-acetic acid inducible 19                     46.6    7e-04   
ref|NP_001240013.1|  uncharacterized protein LOC100804423             47.8    7e-04   
ref|XP_002885542.1|  indoleacetic acid-induced protein 2              46.6    8e-04   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like   47.8    8e-04   
gb|AFK41338.1|  unknown                                               46.6    8e-04   
ref|XP_010033899.1|  PREDICTED: auxin-responsive protein IAA1         47.0    8e-04   
gb|ACJ84768.1|  unknown                                               46.6    8e-04   
gb|ADB93649.2|  indole-3-acetic acid inducible 19                     46.6    8e-04   
ref|XP_003597715.1|  Auxin-responsive protein IAA                     47.4    0.001   
gb|AAD50278.1|  auxin-induced protein ali50                           47.0    0.001   



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLGHG-GLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ + S
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNS  122



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ + S
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNS  122



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLGHG-GLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ + S
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNS  122



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLGHG-GLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  51   KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  110

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ + S
Sbjct  111  QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNS  167



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            QS  S +DL+    +   +      KDP KPPAKAQ+VGWPPVRSYRKN+MA+ + S
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMANQKNS  122



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 83/121 (69%), Gaps = 12/121 (10%)
 Frame = +3

Query  78   TSVKMTNMLG-HGGLNLKETELCLGLPggsgggn-----enesMKTTGKRGFSETVDLKL  239
             S KM NMLG    LN KETELCLGLPGG GGG      E E+ KTTGKRGFSETVDLKL
Sbjct  3    VSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDLKL  62

Query  240  NLQSDGSCLDLSETKMQAppepn------kdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
            NLQS  + +DL++       E        KDP KPPAKAQVVGWPPVRSYRKN+MA+ + 
Sbjct  63   NLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMANQKN  122

Query  402  S  404
            S
Sbjct  123  S  123



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 72/104 (69%), Gaps = 8/104 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-----  281
            LN KETELCLGLPG  G  NE E+ K TGKRGF+ETVDLKLNLQ+    +DL+E      
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNIA  73

Query  282  ---KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
               K Q P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S
Sbjct  74   SKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNAS  117



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 72/104 (69%), Gaps = 8/104 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-----  281
            LN KETELCLGLPG  G  NE E+ K TGKRGF+ETVDLKLNLQ+    +DL+E      
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNIA  73

Query  282  ---KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
               K Q P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S
Sbjct  74   SKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNAS  117



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 70/110 (64%), Gaps = 5/110 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            MT+MLG    LNL+ETELCLGLPGG          K TGKRGFSETVDLKL LQS     
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA    S
Sbjct  61   DNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTS  110



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 79/116 (68%), Gaps = 14/116 (12%)
 Frame = +3

Query  99   MLG-HGGLNLKETELCLGLPggsgggnenesM------------KTTGKRGFSETVDLKL  239
            MLG    LN KETELCLGLPGGSGGG    +             KTTGKRG+SETVDLKL
Sbjct  1    MLGTEHDLNFKETELCLGLPGGSGGGGGAAAAGGGGKNEVESSPKTTGKRGYSETVDLKL  60

Query  240  NLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            NLQS   C+DL++       E N  P KPPAKAQV+GWPPVRSYRKN+MA +QK+N
Sbjct  61   NLQSKEGCMDLNQNLENGSKEKNHHPAKPPAKAQVLGWPPVRSYRKNIMA-NQKNN  115



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  104



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  104



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  104



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  104



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 73/118 (62%), Gaps = 10/118 (8%)
 Frame = +3

Query  72   SCTSVKMTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQ  248
            S  S KM NMLG    LNLKETELCLGLPGG          + TGKRGFSET+DLKLNLQ
Sbjct  4    SAVSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETP-RATGKRGFSETIDLKLNLQ  62

Query  249  SDGSCLDLSETKMQAppep------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            S     D  + K  A  E        K P KPPAKAQVVGWPPVRSYRKN+MA    S
Sbjct  63   SKEDLND--KVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSYRKNIMAQKSSS  118



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 70/110 (64%), Gaps = 5/110 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            MT+MLG    LNL+ETELCLGLPGG          K TGKRGFSETVDLKL LQS     
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA    S
Sbjct  61   DNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTS  110



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 78/116 (67%), Gaps = 14/116 (12%)
 Frame = +3

Query  99   MLG-HGGLNLKETELCLGLPggsgggnenesM------------KTTGKRGFSETVDLKL  239
            MLG    LN  ETELCLGLPGGSGGG    +             KTTGKRG+SETVDLKL
Sbjct  1    MLGTERDLNFNETELCLGLPGGSGGGGGAAAAGGGGKNEVESSPKTTGKRGYSETVDLKL  60

Query  240  NLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            NLQS   C+DL++       E N  P KPPAKAQV+GWPPVRSYRKN+MA +QK+N
Sbjct  61   NLQSKEGCMDLNQNLENGSKEKNHLPAKPPAKAQVLGWPPVRSYRKNIMA-NQKNN  115



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 71/104 (68%), Gaps = 10/104 (10%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            LN KETELCLGLPGG     E    K TGKRGF+ETVDLKLNLQ+    +DL+E    A 
Sbjct  13   LNFKETELCLGLPGGGKTEVETP--KATGKRGFAETVDLKLNLQAKDGVMDLNENIKNAS  70

Query  297  -------pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                       KDP KPPAKAQVVGWPPVRSYRKN+MA +QK+N
Sbjct  71   KDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMA-NQKNN  113



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +3

Query  90   MTNMLG--HGGLNLKETELCLGLPggsgggn-enesMKTTGKRGFSETVDLKLNLQSDGS  260
            MT MLG  HGGLNLK TELCLGLPGG G    + ES+K TGKRGFSETVDLKLNLQ +  
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQPNEP  60

Query  261  CLDLSET-KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             +DL E  K  A          P AKAQVVGWPPVRS+RKN+MA  QKSN
Sbjct  61   VVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMA--QKSN  108



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L+E          KDP KPPAKAQVVGWPPVRSY+KN+MA  QK NN
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMA--QKVNN  104



>gb|AFZ78616.1| hypothetical protein [Populus tomentosa]
Length=211

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 71/105 (68%), Gaps = 9/105 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDL-------  272
            LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL       
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENINNI  73

Query  273  -SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             SE K   P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S
Sbjct  74   ASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNAS  118



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 71/115 (62%), Gaps = 11/115 (10%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggs-gggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG            K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGAERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQAKEGV  62

Query  264  LDLSET--------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            +DL+E         K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  63   MDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNAS  117



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 71/115 (62%), Gaps = 11/115 (10%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggs-gggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG            K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGAERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQAKEGV  62

Query  264  LDLSET--------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            +DL+E         K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  63   MDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNAS  117



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 75/111 (68%), Gaps = 6/111 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            MT+MLG    LNL+ETELCLGLPGG +    E E+ KTTGKRGFSETVDLKLNLQS    
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             D    ++           KDP KPPAKAQVVGWPPVRSYRKN+M+    S
Sbjct  61   NDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMSQKNTS  111



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M NMLG    LNLKETELCLGLPGG          + TGKRGFSET+DLKLNLQS     
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETP-RATGKRGFSETIDLKLNLQSKEDLN  59

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA    S
Sbjct  60   DNVKNIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKSSS  109



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 71/105 (68%), Gaps = 9/105 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDL-------  272
            LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL       
Sbjct  13   LNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKDGVMDLNDNIKNI  72

Query  273  -SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             S+ K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  73   TSKDKNHLPAAAIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNAS  117



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 71/105 (68%), Gaps = 9/105 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDLSET----  281
            LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL+E     
Sbjct  13   LNYKETELCLGLPGAVGAKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNI  72

Query  282  ----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  73   TSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNAS  117



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = +3

Query  90   MTNMLG--HG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS  260
            MT ML   HG  LNLKETELCLGLPGG          + TGKRGFSETVDLKLNLQ+   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETP---RATGKRGFSETVDLKLNLQTKE-  56

Query  261  CLDLSET--KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              DL+E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + SN
Sbjct  57   --DLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSN  105



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 74/111 (67%), Gaps = 6/111 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            M +MLG    LNL+ETELCLGLPGG +    E E+ KTTGKRGFSET+DLKLNLQS    
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             D    ++           KDP KPPAKAQVVGWPPVRSYRKN+MA    S
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMAQKNTS  111



>gb|ADL70640.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 68/99 (69%), Gaps = 6/99 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG---KRGFSETVDLKLNLQS-DGSCLDLSETK  284
            LNLKETELCLGLPGG       +         KRGFSETVDLKLNLQS D S LDL + K
Sbjct  9    LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKLNLQSNDSSGLDLKKDK  68

Query  285  MQ--AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
            M+  +    NKD  KPPAKAQVVGWPPVRS+RKN+MA  
Sbjct  69   MKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMAQK  107



>gb|ADL70642.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>gb|ADL70639.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=171

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M  ++G   GLNLKETELCLGLPGG G G+E E+ +  GKRGFSETVDLKLNLQS+   L
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKEDL  60

Query  267  DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            + +   +       KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  61   NDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  106



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M  ++G   GLNLKETELCLGLPGG G G+E E+ +  GKRGFSETVDLKLNLQS+   L
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKEDL  60

Query  267  DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            + +   +       KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN
Sbjct  61   NDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNN  106



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=189

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 72/105 (69%), Gaps = 9/105 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDLSET----  281
            LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL+E     
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNI  73

Query  282  ----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                K   P +  KDP KPPAKAQVVGWPPVRSYRKNV+A    S
Sbjct  74   ASKDKNHLPADTIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNAS  118



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETIESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 73/111 (66%), Gaps = 6/111 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            M +MLG    LNL+E ELCLGLPGG +    E E+ KTTGKRGFSET+DLKLNLQS    
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             D    ++           KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMAQKNTS  111



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG              KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 KDP KPPAKAQVVGWPPVR+YRKN+MA+ + S
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMANQKSS  97



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 KDP KPPAKAQVVGWPPVR+YRKNVMA +QKS
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA-NQKS  96



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 70/105 (67%), Gaps = 9/105 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDL-------  272
            LN K TELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL       
Sbjct  14   LNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENINNI  73

Query  273  -SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             SE K   P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S
Sbjct  74   ASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNAS  118



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 77/118 (65%), Gaps = 15/118 (13%)
 Frame = +3

Query  96   NMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG------  257
            NM  +  ++LKETELCLGLPGG GGG +  S+K++GKRGFSETVDLKLNLQS        
Sbjct  7    NMPNNQFVSLKETELCLGLPGGGGGGGDQTSLKSSGKRGFSETVDLKLNLQSKDGGGGGG  66

Query  258  --SCLDLSETKMQAppep-------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                +DL+E                +KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  67   VGVGVDLNENVKNVSTNVDGEKSLCSKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNTS  124



>gb|ADL70641.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPG +             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGCTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNVNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 12/118 (10%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG   GN+ E+ K+ GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAEPADTYSMINFEETELRLGLPGGVSNGNDAEAAKSNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 DGS  +   TK +       DP KPP+KAQVVGWPP+RS+RKNVMA  QK+NN
Sbjct  61   KETGKDGSDQEKVATKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMA-VQKNNN  117



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 75/112 (67%), Gaps = 8/112 (7%)
 Frame = +3

Query  90   MTNMLG--HGGLNLKETELCLGLPggsgggnenesMKT---TGKRGFSETVDLKLNLQSD  254
            M  +LG     LNLKETELCLGLPGG GGG  ++ ++T    GKRGFSETVDLKLNLQS 
Sbjct  1    MATLLGKVQNDLNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSK  60

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                D     +       KDP KPPAKAQVVGWPPVRSYRKN+M   QK NN
Sbjct  61   EDLND-DVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMV--QKVNN  109



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 70/102 (69%), Gaps = 13/102 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSE---T  281
            ++LKETELCLGLPGG          K  GKRGFSETVDLKLN Q++   S +DL E   T
Sbjct  1    MDLKETELCLGLPGGGERD------KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKT  54

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                    NKD +KPPAKAQVVGWPPVRS+RKNVMA  QK+N
Sbjct  55   PTTKEIASNKDSVKPPAKAQVVGWPPVRSFRKNVMA--QKNN  94



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GS-  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL S+     GS 
Sbjct  165  MMGSVGLNLRETELCLGLPGGDTASPV-----TGTKRGFSETVDLKLNLNSEPESKEGSK  219

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
              D+     +      KDP KP AKAQVVGWPPVRSYRKNVM   QKS++
Sbjct  220  SHDVVSAVFKEKSSCPKDPTKPLAKAQVVGWPPVRSYRKNVMGSCQKSSS  269



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 71/109 (65%), Gaps = 16/109 (15%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G+  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMGNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN
Sbjct  51   THDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSN  99



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 71/109 (65%), Gaps = 16/109 (15%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G+  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMGNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN
Sbjct  51   THDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSN  99



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 69/102 (68%), Gaps = 9/102 (9%)
 Frame = +3

Query  108  HG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-  281
            HG  LNLKETELCLGLPGG          + TGKRGFSETVDLKLNLQ+     DL+E  
Sbjct  6    HGLSLNLKETELCLGLPGGGSEVETP---RATGKRGFSETVDLKLNLQTKE---DLNENL  59

Query  282  -KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + S
Sbjct  60   KNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVS  101



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 7/103 (7%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-----KTTG-KRGFSETVDLKLNLQSDGS-CLDLS  275
            +N+KETELCLGLPGG GGG E E +     K  G KRGFSETVDLKLNLQ++    +DL+
Sbjct  6    MNMKETELCLGLPGGGGGGGEAEVVAESPAKAAGNKRGFSETVDLKLNLQTNKEGVVDLN  65

Query  276  ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                      +KD  KPPAKAQVVGWPPVR+YRKN+MAH + S
Sbjct  66   NVAKDKSLLVSKDHAKPPAKAQVVGWPPVRNYRKNMMAHQKSS  108



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +3

Query  87   KMTNMLGH-GGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQ-SDGS  260
            KM  +L    GLNLKETEL          G    + K TGKRGFSETVDLKLNLQ ++ +
Sbjct  6    KMGGLLAEEQGLNLKETEL-----CLGLPGGGGGADKITGKRGFSETVDLKLNLQPNESA  60

Query  261  CLDLSETK-MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             LDL ET  M  P  P KDP+KPPAKAQVVGWPPVRS+RKN+MAH + S+ 
Sbjct  61   ALDLKETSAMDKPVLPPKDPVKPPAKAQVVGWPPVRSFRKNIMAHQKSSDE  111



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GS-  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MMGSVGLNLRETELCLGLPGGDTASPV-----TGTKRGFSETVDLKLNLNNEPESKEGSK  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++
Sbjct  56   SHDVVSAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSS  105



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 65/104 (63%), Gaps = 8/104 (8%)
 Frame = +3

Query  117  LNLKETELCLGLP-----ggsgggnenesMKTTG-KRGFSETVDLKLNLQS--DGSCLDL  272
            +NLKETELCLGLP                  T G KRGFSETVDLKLNLQ+  +G  +DL
Sbjct  6    MNLKETELCLGLPGSGGGEAEAVVESPAKAATVGNKRGFSETVDLKLNLQTNEEGRVVDL  65

Query  273  SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            +    +      KD  KPPAKAQVVGWPPVR+YRKN+MA  + S
Sbjct  66   NAGDPKNFAGATKDKNKPPAKAQVVGWPPVRNYRKNMMAQQKSS  109



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GS-  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MMGSVGLNLRETELCLGLPGGDTASPL-----TGTKRGFSETVDLKLNLNNEPESKEGSK  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++
Sbjct  56   SHDVVSAISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSS  105



>gb|ADB93635.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93636.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93637.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93638.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93639.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70683.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70686.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70691.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70693.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70694.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=150

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MMGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGST  55

Query  264  L-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+
Sbjct  56   THDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSS  104



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 11/118 (9%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG   GN++E+ K+ GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAEPAGTYSMMNFEETELRLGLPGGVSNGNDSEAAKSNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 DGS  +    K +       DP KPP+KAQVVGWPP+RS+RKNVMA  + SN+
Sbjct  61   KETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSND  118



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NL ETELCLGLPGG+             KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLTETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+H+
Sbjct  61   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNVMANHK  95



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 9/116 (8%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPGG G GN+ E  K+ GKRGFSETVDLKLNL + 
Sbjct  1    MTSIMGAEPEKYSMINFEETELRLGLPGGIGNGNDGEVAKSNGKRGFSETVDLKLNLSTK  60

Query  255  GSCLDLSETKMQ----AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             S   + E K+       P  + DP KPPAKAQVVGWPP+RS+RKNVMA  + SN+
Sbjct  61   ESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSND  116



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 65/113 (58%), Gaps = 16/113 (14%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS  275
            LN KETELCLGLP         +          TTGKRG+SETVDLKLNL       DL+
Sbjct  8    LNFKETELCLGLPGGCGITAEPAAAETPTRPAATTGKRGYSETVDLKLNLHRQSVKEDLN  67

Query  276  ETKMQAppepnkdp---------ikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            E  +++   P K+           KPPAKAQVVGWPPVRSYRKN+MA    +N
Sbjct  68   EINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKMSTN  120



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 72/110 (65%), Gaps = 16/110 (15%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+ +  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMDNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            T        +   +  KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN+
Sbjct  51   THDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSND  100



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            LN KETELCLGLP         E  + K TGKRGFSETVDLKLNL ++   ++ S   + 
Sbjct  3    LNFKETELCLGLPGGAALTTEPEICTPKATGKRGFSETVDLKLNLHANEGLMNESVKNVS  62

Query  291  Appep---nkdpikppAKAQVVGWPPVRSYRKNVMAH  392
            +  +     KDP KPPAKAQVVGWPPVRSYRKNVMA 
Sbjct  63   SREKNLPCIKDPAKPPAKAQVVGWPPVRSYRKNVMAQ  99



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = +3

Query  69   ESCTSVKMTNML-GHGGLNLKETELCLGLPggsgggnenesM--------KTTGKRGFSE  221
            E     +M  ML    GLNLKETELCLGLPGG GGG              + TGKRGFSE
Sbjct  78   EFIDKPEMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSE  137

Query  222  TVDLKLNLQSDGSCLDLSET--KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
            TVDLKLNL S     DL+E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA
Sbjct  138  TVDLKLNLHSKE---DLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  192



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            + LKETELCLGLPGG              KRGFSETVD KLNLQS+    +DL+ T   A
Sbjct  29   MKLKETELCLGLPGGVETVETPTKSGVGNKRGFSETVDFKLNLQSNKQGHVDLNVT--VA  86

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              E  KDP KPPAKAQVVGWPPVR+YRK+VMAH + S
Sbjct  87   HKEKTKDPAKPPAKAQVVGWPPVRNYRKSVMAHQKSS  123



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 71/111 (64%), Gaps = 13/111 (12%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesM-------KTTGKRGFSETVDLKLNL  245
            M  MLG    LNLKETELCLGLPG  GGG             + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  246  QSDGSCLDLSETKMQAppepn--kdpikppAKAQVVGWPPVRSYRKNVMAH  392
            Q+     DL+E    AP E    KDP K PAKAQVVGWPPVRSYRKN+M  
Sbjct  61   QAKE---DLNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMTQ  108



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 11/118 (9%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG+  GN+ E+ K  GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAETADTYSMINYEETELRLGLPGGASNGNDGEAAKGNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 DGS  +    K +       DP KPP+KAQVVGWPP+RS+RKNVMA  + SN+
Sbjct  61   KETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSND  118



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 70/103 (68%), Gaps = 14/103 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSE----  278
            ++LKETELCLGLPGG          K  GKRGFSETVDLKLN Q++   S +DL E    
Sbjct  1    MDLKETELCLGLPGGGERD------KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKT  54

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
               +     NKD +KPPAKAQVVGWPPVRS+RKNVMA  QK+N
Sbjct  55   PTTKEIANCNKDSVKPPAKAQVVGWPPVRSFRKNVMA--QKNN  95



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 80/120 (67%), Gaps = 13/120 (11%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRG--FSETVDLKLNL  245
            MT+++G      +  +N +ETEL LGLPGG   GN+ E+ K+ GKRG  FSETVDLKLNL
Sbjct  1    MTSVMGAEPAGTYSMMNFEETELRLGLPGGVSNGNDPEAAKSNGKRGQRFSETVDLKLNL  60

Query  246  QS-----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             +     DGS  + +  K +A      DP KPP+KAQVVGWPP+RS+RKNVMA  + SN+
Sbjct  61   STKDTGKDGSDQEKAAMKEKAVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSND  120



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG-SCLDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETV LKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  95



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 9/116 (8%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPGG G GN+ E  K+ GKRGFSETVDLKLNL + 
Sbjct  1    MTSIMGAEPEKYSMINFEETELRLGLPGGIGNGNDGEVAKSNGKRGFSETVDLKLNLSTK  60

Query  255  GSCLDLSETKMQ----AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             S     E K+       P  + DP KPPAKAQVVGWPP+RS+RKNVMA  + SN+
Sbjct  61   ESGKGGDEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSND  116



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 73/105 (70%), Gaps = 11/105 (10%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsg------ggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS  275
            GLNLKETELCLGLPGG        GG+E E+ + TGKRGFSETVDLKLNL S     DL+
Sbjct  10   GLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLHSKE---DLN  66

Query  276  ET--KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + S
Sbjct  67   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVS  111



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 70/105 (67%), Gaps = 6/105 (6%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T-KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            T   +     +KDP KPPAKAQVVGWPPVRSYRKNVM   QK+++
Sbjct  56   TLDSKEKSSCSKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKASS  100



>gb|ADL70685.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70695.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=149

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 67/107 (63%), Gaps = 11/107 (10%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL  266
            +G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS  
Sbjct  1    MGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTT  55

Query  267  -DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS
Sbjct  56   HDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKS  102



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            LN KETELCLGLP         E  + K TGKRGFSETVDLKLNL ++   ++ S   + 
Sbjct  10   LNFKETELCLGLPGGAALTTEPEICTPKATGKRGFSETVDLKLNLHANEGLMNESVKNVS  69

Query  291  Appep---nkdpikppAKAQVVGWPPVRSYRKNVMAH  392
            +  +     KDP KPPAKAQVVGWPPVRS+RKNVMA 
Sbjct  70   SREKNLPCIKDPAKPPAKAQVVGWPPVRSFRKNVMAQ  106



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MMGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGST  55

Query  264  L-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+
Sbjct  56   THDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSS  104



>gb|ADL70684.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70688.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70692.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=144

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 65/102 (64%), Gaps = 11/102 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL-DLSE  278
            LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS   D+  
Sbjct  1    LNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVT  55

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
               +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS
Sbjct  56   FDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKS  97



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M+G   LNLKETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MIGSVELNLKETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  264  L-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              D+     +      KDP KPP+KAQVVGWPPVRSYRKNVM   QKS+
Sbjct  56   THDVVTFDSKEKSSCPKDPAKPPSKAQVVGWPPVRSYRKNVMVSCQKSS  104



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-----  263
            M+G   LNL++TELCLGLPGG  G        T  KRGFSETVDLKLNL ++        
Sbjct  1    MMGTVELNLRDTELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPEINEGSK  55

Query  264  -LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
              D+  +  +      KDP KPPAKAQVVGWPPVRSYRKNVM  +QK
Sbjct  56   PHDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSYQK  102



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            KM++MLG   G + KETELCLG     GGG E E++K +GKRGFSETVDLKLNLQS  S 
Sbjct  6    KMSSMLGAERGFDFKETELCLG--LPGGGGGEAETLKASGKRGFSETVDLKLNLQSKESV  63

Query  264  LDLSET-----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            +DL+E      K +      KDP KPPAKAQVVGWPPVRS+RKN+MA    S
Sbjct  64   VDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSS  115



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++
Sbjct  56   THGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSS  105



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++
Sbjct  56   THGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSS  105



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 12/109 (11%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD---  269
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++ +  +   
Sbjct  1    MMGTVELNLRETELCLGLPGGDTAAPV-----TGNKRGFSETVDLKLNLNNEPANKEGCT  55

Query  270  ----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                ++ +  +      KDP KPPAKAQVVGWPPVRSYRKNV+   QKS
Sbjct  56   THDVVTNSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVLVSSQKS  104



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG-SCLDLSETKMQA  293
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKN+M   +
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMMTQQK  100



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG  G        T  KRGFSETVDLKLNL ++    + S+
Sbjct  1    MMGTVELNLRETELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPESNEGSK  55

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QK
Sbjct  56   THDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSCQK  102



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG  G        T  KRGFSETVDLKLNL ++    + S+
Sbjct  1    MMGTVELNLRETELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPESNEGSK  55

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QK
Sbjct  56   THDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSCQK  102



>gb|KJB82526.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=194

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +  + SE KM+     +       AKAQVVGWPPVRS+RKN+MA  + S
Sbjct  59   ETVAEDSE-KMKEKSSTDPAKPP--AKAQVVGWPPVRSFRKNIMAVQKAS  105



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+    ++       KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLKETELCLGLPGGTETVAKSG---VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  57

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  58   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNVMANQK  92



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCL LPGG+   +         KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 KDP+KPPAKAQVVGWPPVR+YRKN+M + + S
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIMTNQKTS  102



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+    ++       KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLKETELCLGLPGGTETVAKSG---VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  57

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ +
Sbjct  58   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNVMANQK  92



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M++MLG   G + KETELCLG     GGG E E++K +GKRGFSETVDLKLNLQS  S +
Sbjct  1    MSSMLGAERGFDFKETELCLG--LPGGGGGEAETLKASGKRGFSETVDLKLNLQSKESVV  58

Query  267  DLSET-----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            DL+E      K +      KDP KPPAKAQVVGWPPVRS+RKN+MA    S
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSS  109



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 68/108 (63%), Gaps = 11/108 (10%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL  266
            +G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS  
Sbjct  1    MGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTT  55

Query  267  -DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+
Sbjct  56   HDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSS  103



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M G  GLN  ETELCLGL  G GGG   + +KTTGKRGFSETVDLKLNLQS+        
Sbjct  8    MAGLHGLNFMETELCLGL-PGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNEPPSSSDL  66

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            +++S T++ A   P      P AKAQVVGWPPVRS+RKN+++H + S+
Sbjct  67   INISSTEINAMLPPKDPIKPP-AKAQVVGWPPVRSFRKNIISHQKSSS  113



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 66/108 (61%), Gaps = 12/108 (11%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG    +      T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVASV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T-------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
            T                KDP KPPAKAQVVGWPPVRSYRKNVM   QK
Sbjct  56   THGVVTFDSKDKISSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQK  103



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  93   TNMLGHGGLNLKETELCLGLPggsgggnenesMKTTG-KRGFSETVDLKLNLQSDGS-CL  266
             NM+G   +NLK TELCLGLPGG+    E+ +    G KRGFSETVDL LNLQS+    +
Sbjct  49   VNMIGQL-MNLKATELCLGLPGGADQAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSV  107

Query  267  DLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            DL+        +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  108  DLNNVAASPKEKNLIKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKTS  154



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N +ETEL LGLPG    G++     ++GKRGFSETVDLKLN  S+   +  S    Q  
Sbjct  21   INFEETELRLGLPGALKDGDQGVKSCSSGKRGFSETVDLKLNFSSENDDVSRSGRDGQVE  80

Query  297  pepnkdpikp---pAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             +  KD        AKAQVVGWPPVRS+RKN++A  +KS +
Sbjct  81   IKKEKDASAAPAPRAKAQVVGWPPVRSFRKNIVAVQKKSTD  121



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+     DL+ +    
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 +DP KPP KAQVVGWPPVR+YRK VMA  +
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMATQK  95



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSS  104



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAST  65

Query  294  ppep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  66   KEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKAS  103



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 68/112 (61%), Gaps = 17/112 (15%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-D  254
             S KM NML        ET+LCLGLPGG          K  GKRGFSETVDLKLN+QS  
Sbjct  3    VSRKMVNML--------ETDLCLGLPGGGAEPETP---KANGKRGFSETVDLKLNIQSKP  51

Query  255  GSCLDLSE-----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
            G  +DL+      +  +     +KDP KPPAKAQVVGWPPVRSYRKN M+  
Sbjct  52   GVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQK  103



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 71/114 (62%), Gaps = 20/114 (18%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM--------KTTGKRGFSETVDLKLNLQ---SDGSC  263
            ++LKETELCLGLPGG GGG     +        K  GKRGFSETVDLKLN      D SC
Sbjct  1    MDLKETELCLGLPGGGGGGGGGGELIRDNNNNNKINGKRGFSETVDLKLNFHQANDDISC  60

Query  264  LDLSETKMQAppepnkdpi------kppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              +   KM+      K+ +      KPPAKAQVVGWPPVRS+RKNVMA  QKSN
Sbjct  61   A-MENNKMKNSVTTTKEVVCNKDPIKPPAKAQVVGWPPVRSFRKNVMA--QKSN  111



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 68/112 (61%), Gaps = 17/112 (15%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-D  254
             S KM NML        ET+LCLGLPGG          K  GKRGFSETVDLKLN+QS  
Sbjct  3    VSRKMVNML--------ETDLCLGLPGGGAEPETP---KANGKRGFSETVDLKLNIQSKP  51

Query  255  GSCLDLSE-----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
            G  +DL+      +  +     +KDP KPPAKAQVVGWPPVRSYRKN M+  
Sbjct  52   GVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQK  103



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 10/110 (9%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +  + SE KM+   + + DP KPPAKAQVVGWPPVRS+RKN+MA  + S
Sbjct  59   ETVAEDSE-KMK--EKSSTDPAKPPAKAQVVGWPPVRSFRKNIMAVQKAS  105



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSS  99



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSS  104



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 69/112 (62%), Gaps = 17/112 (15%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-  254
             S KM NML        ET+LCLGLPGG          K  GKRGFSETVDLKLN+QS  
Sbjct  3    VSRKMVNML--------ETDLCLGLPGGGAEPETP---KANGKRGFSETVDLKLNIQSKT  51

Query  255  GSCLDL----SETKM-QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
            G  +DL    S+T   +     +KDP KPPAKAQVVGWPPVRSYRKN M+  
Sbjct  52   GVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMSQK  103



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 8/104 (8%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgg---gnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSET  281
            GLNLKETELCLGLPGG GG      ++SM+ TGKRGFSETVDLKLNLQS D S +DL+E 
Sbjct  5    GLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDLNEK  64

Query  282  --KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                 +    +KDP+KPPAKAQVVGWPPVR++RKN+MA  QK+N
Sbjct  65   VKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMA--QKNN  106



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NL+ TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAST  65

Query  294  ppep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  66   KEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKAS  103



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 68/109 (62%), Gaps = 11/109 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++     GS 
Sbjct  1    MMGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGST  55

Query  264  L-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              D+     +      KDP KPPAKAQVVGWP VRSYRKNVM   QKS+
Sbjct  56   THDVVTFDSKEKSACPKDPAKPPAKAQVVGWPLVRSYRKNVMVSCQKSS  104



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 10/110 (9%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNEGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +   ++E   +   + + D  KPPAKAQVVGWPPVRS+RKN+MA  + S
Sbjct  59   ET---VAEDSDEMKEKSSTDTAKPPAKAQVVGWPPVRSFRKNIMAVQKAS  105



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKM-QAppep  305
            ETEL LGLPG   G     + K  GKR FSETVDLKLNL S  S +D    KM +     
Sbjct  19   ETELRLGLPGAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDKMKEKKNIA  78

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              DP KPPAKAQVVGWPPVRS+RKNV+   +KS
Sbjct  79   PTDPSKPPAKAQVVGWPPVRSFRKNVLNVQKKS  111



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +  + S+ KM+     +       AKAQVVGWPPVRS+RKN+MA  + S
Sbjct  59   ETVAEDSD-KMKEKSSTDPAKPP--AKAQVVGWPPVRSFRKNIMAVQKAS  105



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 17/113 (15%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD---  269
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++ +  +   
Sbjct  1    MMGTVELNLRETELCLGLPGGDTAAPV-----TGNKRGFSETVDLKLNLNNEPANKEGCT  55

Query  270  --------LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                    +S+ K  + P+    P    ++AQVVGWPPVRSYRKNV+   QKS
Sbjct  56   THDVVTNSVSKEK-SSSPKDPAKPPAKISRAQVVGWPPVRSYRKNVLVSSQKS  107



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+      E      KRGFSETVDL LNLQS+    +DL+     +
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNNVASAS  65

Query  294  ppep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +   KDP KPPAKAQVVGWPPVR+YRKN++   + S
Sbjct  66   KDKTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTS  103



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK T+LCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  294  ppepnkdp-ikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +       KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIMTQQKTS  103



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTG-KRGFSET--VDLKLNLQ  248
            TSV  T    +  +N +ETEL LGLPGGS   +    +KT+G KRGFSET  VDLKLNL 
Sbjct  2    TSVTETERDNYSMINFEETELRLGLPGGSASEHSESPIKTSGGKRGFSETSNVDLKLNLS  61

Query  249  SDGSCLDLSET----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 +  S T          +       P AKAQVVGWPPVRS+RKN++ + QKSNN
Sbjct  62   PTNDSVSPSSTIPLVPANKVKDKTSTTAPPRAKAQVVGWPPVRSFRKNIV-NVQKSNN  118



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepn------kdpikppAKAQVVGW  353
            KTTGKRGFSETVDLKLNLQS  + +DL++       E        KDP KPPAKAQVVGW
Sbjct  10   KTTGKRGFSETVDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGW  69

Query  354  PPVRSYRKNVMAHHQKS  404
            PPVRSYRKN+MA+ + S
Sbjct  70   PPVRSYRKNIMANQKNS  86



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = +3

Query  99   MLGHG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GS  260
            MLG G  LN+KETELCLGLPGG              KRGFSETVDLKLNL ++     GS
Sbjct  1    MLGGGVDLNMKETELCLGLPGGETAAPV-----AGNKRGFSETVDLKLNLNNEPHKDVGS  55

Query  261  CL-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAH  392
             L +   + + + P  +    KPPAKAQVVGWPPVR+YRKN+M  
Sbjct  56   ALSEQDPSSLVSVPNDSSSCPKPPAKAQVVGWPPVRTYRKNMMGR  100



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+             KR FSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGSVDLNNVAAST  65

Query  294  ppep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  66   KEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKAS  103



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 65/104 (63%), Gaps = 7/104 (7%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNL---QSDGSCLDLSETKM  287
            +N +ETEL LGLPGGS   +   + K  GKRGFSETVDLKLNL   +  G  + + E  M
Sbjct  15   INFEETELRLGLPGGSNVNDSEFA-KVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETM  73

Query  288  QAppepnkdp---ikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            +             KPPAKAQVVGWPP+RS+RKNVMA  + S +
Sbjct  74   KEKATVPSSSNDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSTD  117



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG-SCLDLSETKMQA  293
            +NL  TELCLGLPGG+             KRGFSET+DL LNLQ +    +DL+      
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 KDP KPPAKAQVVGWPPVR+YRKN+M   + S
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMMTQQKTS  102



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAAP  65

Query  294  ppepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              +   KDP KPP KAQVVGWPPVR+YRKN+M   + S
Sbjct  66   KEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMMTQQKTS  103



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S  +GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKEGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H +
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQK  99



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S  +GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKEGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H +
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQK  99



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSET--KM  287
            +N +ETEL LGLPGG+G   E    K  GKRGFSETVDLKLNL +    + D +E   K 
Sbjct  15   INFEETELRLGLPGGNGNDGEMT--KNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKK  72

Query  288  QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                  + DP KPPAKAQVVGWPPVRS+RKN+MA  + S++
Sbjct  73   STVAPRSADPAKPPAKAQVVGWPPVRSFRKNIMAVQKNSSD  113



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             +    P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQK  89



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 15/111 (14%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDL------  272
            GLN KETELCLGL  G GGG E +++K  GKRGFSETVDLKLNLQS D +  DL      
Sbjct  13   GLNFKETELCLGL-PGGGGGGEPDAVKINGKRGFSETVDLKLNLQSNDSASTDLNNGGGG  71

Query  273  -------SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                   S  K  A   P KDP+KPPAKAQVVGWPPVRS+RKN++  HQK+
Sbjct  72   GAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIVMSHQKN  122



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQ-------SDGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL        S  +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSPTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSN  119



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 17/106 (16%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            GL L+ETEL LGLPGG GGG + E++K +GKRGF+ETVDLKL LQ+    +D+ E   +A
Sbjct  4    GLGLEETELRLGLPGGGGGGGDAEAVKNSGKRGFAETVDLKLQLQTP---VDVKEAVAEA  60

Query  294  ppepnkdpikppA--------------KAQVVGWPPVRSYRKNVMA  389
              E  K  +   +              KAQVVGWPPVRS+RKN+++
Sbjct  61   ASEKVKRSVSQKSLVSCGSDPEKPSAPKAQVVGWPPVRSFRKNILS  106



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  62   INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMK  119

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             +    P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  120  EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQK  149



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S   GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKQGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H +
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQK  99



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             +    P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQK  89



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
              P        AK QVVGWPPVRS+RKNVM+  +
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSGQK  85



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
              P        AK QVVGWPPVRS+RKNVM+  +
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSGQK  85



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S  S ++L   K +  
Sbjct  2    INFEATELRLGLPGGNHGGEIAG--KNNGKRGFSETVDLKLNLSSTVSEVELENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
              P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  60   KPP--------AKAQVVGWPPVRSFRKNVMSGQK  85



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
              P        AK QVVGWPPVRS+RKNVM+  +
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSGQK  85



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 +  +KPPAK QVVGWPPVRS+RKNVM+  +++
Sbjct  57   --NLKEKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQT  91



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD  269
            ++ KETELCLGLP         +       + K + KRGF ET  +DLKLNLQS  S +D
Sbjct  8    MDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQSKESSVD  67

Query  270  LSETKMQAppe----pnkdpikppAKAQVVGWPPVRSYRKNVMAH  392
            L+E     P                KAQVVGWPPVRSYRKN MA 
Sbjct  68   LNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMAE  112



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 61/107 (57%), Gaps = 20/107 (19%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD----GSCLDLSETK  284
            +  +ETEL LGLP               GKRGFSETVDLKLNL S      S +DL E  
Sbjct  8    MGFEETELRLGLPNA-----------NYGKRGFSETVDLKLNLSSAEIGLDSAIDLKENN  56

Query  285  MQAp-----pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                          D +KPPAKAQVVGWPPVRS+RKNVMA  +++++
Sbjct  57   FNKEKNLLPSSSPTDSVKPPAKAQVVGWPPVRSFRKNVMAVQKRTDS  103



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                 +  +KPPAK QVVGWPPVRS+RKNVM+  +++
Sbjct  57   --NLKEKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQT  91



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 8/97 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                    +KPPAK QVVGWPPVRS+RKNVM+  +++
Sbjct  57   --NLKGKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQT  91



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 10/95 (11%)
 Frame = +3

Query  132  TELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD---LSETKMQAppe  302
            TELCLGLPG +         K TGKRGF +TVDLKL LQSD S L+   L+      P  
Sbjct  1    TELCLGLPGAAEP-------KVTGKRGFFQTVDLKLKLQSDQSDLEEENLTTPSSDKPHL  53

Query  303  pnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            P K   KPP+KAQVVGWPPVRS+RKNV+ + + S+
Sbjct  54   PPKHLSKPPSKAQVVGWPPVRSFRKNVICNRKSSS  88



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD  269
            ++ KETELCLGLP         +       + K + KRGF ET  +DLKLNLQS  S +D
Sbjct  8    MDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQSKESSVD  67

Query  270  LSETKMQAppe----pnkdpikppAKAQVVGWPPVRSYRKNVMAH  392
            L+E     P                KAQVVGWPPVRSYRKN MA 
Sbjct  68   LNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMAE  112



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 58/95 (61%), Gaps = 14/95 (15%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPG + GG      K  GKRGFSETVDLKLNL S      S LDL   K
Sbjct  2    INFEATELRLGLPGENHGGGMAA--KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
             +    P        AKAQVVGWPPVRS+RKNVM+
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMS  86



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  LKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQApp  299
            L  TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+     +  
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNNVASASKE  71

Query  300  ep-nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                KDP KPPAKAQVVGWPPVR+YRKN++   + S
Sbjct  72   TTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTS  107



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKM-QAppep  305
            ETEL LGLPG   G     + K  GKR FSETVDLKLNL S  S +D     + +     
Sbjct  19   ETELRLGLPGAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDNIKEKKNIA  78

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              DP KPPAKAQVVGWPPVRS+RKNV+   + S
Sbjct  79   PTDPAKPPAKAQVVGWPPVRSFRKNVLTVQKNS  111



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSETKMQ  290
            +N + TEL LGLPG + GG      K  GKRGFSETVDLKLNL S   GS  ++    M+
Sbjct  2    INFEATELRLGLPGENHGGGMAA--KNNGKRGFSETVDLKLNLSSTAMGSVSEVDLVNMK  59

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
                  +  +KPPAKAQVVGWPPVRS+RKNVM+
Sbjct  60   ------EKVVKPPAKAQVVGWPPVRSFRKNVMS  86



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGG+ GG+    +K  GKRGFSETVDLKLNL S  + +D S +  Q  
Sbjct  2    INFEATELRLGLPGGNHGGDMAA-VKNNGKRGFSETVDLKLNLSS--TAMD-SVSGAQLE  57

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
                KD +KPPAK QVVGWPPVRS+RKNVM+  +
Sbjct  58   DIKEKDVVKPPAKTQVVGWPPVRSFRKNVMSGQK  91



>gb|ADL70689.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=138

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 60/97 (62%), Gaps = 11/97 (11%)
 Frame = +3

Query  135  ELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL-DLSETKMQAp  296
            ELCLGLPGG           T  KRGFSETVDLKLNL ++     GS   D+     +  
Sbjct  1    ELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEK  55

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+
Sbjct  56   SACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSS  92



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 14/98 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGEMAG--KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             +    P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQK  89



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-KMQA  293
            LN +ETEL LGL    GGGN+ +  KT+GKRGFSETVDLKLNL S  S  D +E  K ++
Sbjct  14   LNYEETELRLGLGLPGGGGNDGDVSKTSGKRGFSETVDLKLNLLSKDSVADQAEKMKEKS  73

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
               P+ DP KPPAKAQVVGWPPVRS+RKN++
Sbjct  74   ALPPSNDPAKPPAKAQVVGWPPVRSFRKNIL  104



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 69/118 (58%), Gaps = 19/118 (16%)
 Frame = +3

Query  99   MLGHG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETV-DLKLNLQSD------  254
            MLG G  LNLK+TELCLGLPGG           +  KRGFSETV DLKLNL ++      
Sbjct  1    MLGGGVDLNLKDTELCLGLPGGGETAAPV----SGNKRGFSETVVDLKLNLNNEPRDHKD  56

Query  255  -GSCL------DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             GS         L+           KDP KPPAKAQVVGWPPVRSYRKN+ A  QK++
Sbjct  57   LGSVTTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKNMTAMSQKAS  114



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 80/117 (68%), Gaps = 12/117 (10%)
 Frame = +3

Query  90   MTNMLGH---GGLNLKETELCLGLPggsg--ggnenesMKTTGKRGFSETVDLKLNLQ--  248
            M  ML      GLNLKETELCLGLPGG G       + +K TGKRGFSETVDLKL L   
Sbjct  7    MAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLKLKLHQS  66

Query  249  SDGSCLDLSE----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            ++ + LDL E    +  + P  P KDPIKPPAKAQVVGWPPVRS+RKN M+ HQKS+
Sbjct  67   NEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMS-HQKSD  122



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 17/98 (17%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            LNLKETELCLG+PGG G        +   KRGFS+TVDLKLNL +         +     
Sbjct  3    LNLKETELCLGMPGGGGD-------RNIKKRGFSQTVDLKLNLDN--------PSININN  47

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
               N D +KPP KAQVVGWPPVRS+RKN+M+  QK NN
Sbjct  48   TSSNNDSLKPPTKAQVVGWPPVRSFRKNIMS--QKGNN  83



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 64/111 (58%), Gaps = 14/111 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnen-esMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ-  290
            +N +ETEL LGLPGG     ++ E+ K  GKRGFSETVDLKLN+ S     D S  + Q 
Sbjct  16   INFEETELRLGLPGGIANPGKDGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQ  75

Query  291  ------------AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                          P  N     P +KAQVVGWPPVRS+RKN++   +KS+
Sbjct  76   LMELKREKNAAAPAPSANDPSKPPASKAQVVGWPPVRSFRKNIVTVQKKSS  126



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 14/98 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGEMVG--KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             +    P        AKAQVVGWPPVRS+RKNVM+  +
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQK  89



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 9/104 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMK-------TTGKRGFSETVDLKLNLQSDGSCLDLS  275
            +N +ETEL LGLPGG GGG  N + +         GKRGFSETVDLKLNL +  S  +  
Sbjct  11   INFEETELRLGLPGGGGGGGGNTTNEGDQIAKINNGKRGFSETVDLKLNLSTKESGKE-E  69

Query  276  ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            + K +     + DP KPPAKAQVVGWPP+RS+RKNVM+  QKSN
Sbjct  70   KMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFRKNVMS-VQKSN  112



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 77/115 (67%), Gaps = 10/115 (9%)
 Frame = +3

Query  90   MTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSD--GS  260
            M  +LG   LN KETELCLGL  G GGG E E+ + TGKRGFSET VDLKLNLQ+    S
Sbjct  1    MAGLLGGVDLNFKETELCLGL-PGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASS  59

Query  261  CLDLSET------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             +DL E        + A   P KDP KPPAKAQVVGWPPVRSYRKN+M   + ++
Sbjct  60   VVDLKEAMKSNEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMMVAQKSTD  114



>ref|XP_010249884.1| PREDICTED: auxin-responsive protein IAA1 [Nelumbo nucifera]
Length=217

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            GLN KETEL LGLPG S    E   +    KRGFSETVDL L   S       S+ + Q 
Sbjct  16   GLNFKETELTLGLPGESRTQAEI--VSKNSKRGFSETVDLNLGSSSSSETRGRSQVEEQG  73

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
              E       P +KAQVVGWPPVRS+RKN +
Sbjct  74   ESEAPCAGKPPASKAQVVGWPPVRSFRKNAL  104



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 10/101 (10%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-------CLD  269
            +N +ETEL LGLP    S  G + E+ K TGKRGF+ETVDLKLN+ S+          +D
Sbjct  16   INFEETELRLGLPGGILSTAGKDGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVD  75

Query  270  LSETKMQAppepnkdpikp-pAKAQVVGWPPVRSYRKNVMA  389
            + + K  AP   + DP KP  AKAQVVGWPPVRS+R N++A
Sbjct  76   MKKEKDVAPVPRSNDPTKPHAAKAQVVGWPPVRSFRXNILA  116



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 68/117 (58%), Gaps = 11/117 (9%)
 Frame = +3

Query  87   KMTNMLG----HGGLNLKETEL---CLGLPggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG       LN +ETEL     G  GGS G +     K  GKRGF ETVDLKLNL
Sbjct  6    KMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVDLKLNL  65

Query  246  QSDGSCLDLSETKMQAppep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             S  S +D SE K     +       D  KPPAKAQVVGWPPVRS+RKN+++  + S
Sbjct  66   PSKESVMDPSEKKNSPKEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILSVQKSS  122



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = +3

Query  198  TGKRGFSETVDLKLNLQSDGSCLDLSETKMQ--AppepnkdpikppAKAQVVGWPPVRSY  371
            T KRGFSETVDLKLNLQS+   LDLS+ K++  +    NKD  KPPAK QVVGWPPVRSY
Sbjct  43   TKKRGFSETVDLKLNLQSN---LDLSKEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRSY  99

Query  372  RKNVMAH  392
            RKN+MA 
Sbjct  100  RKNIMAQ  106



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +3

Query  117  LNLKETELCLGLPggs--gggnenesMKTTGKRGFSETVDLKLNL----QSDGSCLDLSE  278
            +N +ETEL LGLPGG     G + E+ K TGKRGF+ETVDLKLN+    QS G    + E
Sbjct  16   INFEETELRLGLPGGILGTAGKDGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEE  75

Query  279  TKMQAppe----pnkdpikppAKAQVVGWPPVRSYRKNVMA  389
             K +         N     P AKAQ VGWPPVRS+RKN++A
Sbjct  76   MKKEKNVAPVPRSNNPTKPPAAKAQAVGWPPVRSFRKNILA  116



>gb|KEH43016.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=243

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQ-------SDGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL        S  +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSSTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSN  119



>gb|KJB44872.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=210

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +N +ETEL LGLP G    NE    K  GKRG+S+ VDLKLNL +   + +D +E KM+ 
Sbjct  15   INFEETELRLGLPTGIENDNETA--KNNGKRGYSDMVDLKLNLSTTKEASVDEAE-KMKE  71

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                        AKAQVVGWPPVRS+RKN+M   + S++
Sbjct  72   KNTAKPP-----AKAQVVGWPPVRSFRKNIMTVQKNSSD  105



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQ-------SDGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL        S  +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSSTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSN  119



>ref|XP_010254225.1| PREDICTED: auxin-responsive protein IAA1-like [Nelumbo nucifera]
Length=212

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            GLN KETEL LGLPG +    E  + K   KRGFSETVDL L     GSC   +  + Q 
Sbjct  17   GLNFKETELTLGLPGEARSQTETIA-KNNSKRGFSETVDLNL-----GSC-SKNRIEDQG  69

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
              E +     P +KAQVVGWPPVRS+RKNV+
Sbjct  70   ESEVSGASKPPSSKAQVVGWPPVRSFRKNVL  100



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 63/111 (57%), Gaps = 13/111 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnen-esMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ-  290
            +N +ETEL LGLPGG     ++ E+ K  GKRGFSETVDLKLN+ S     D  +   Q 
Sbjct  60   INFEETELRLGLPGGIANPGKDGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQL  119

Query  291  -----------AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                         P  N     P +KAQVVGWPPVRS+RKN+    +KS++
Sbjct  120  LELKKEKNAAAPAPGANDPSKPPASKAQVVGWPPVRSFRKNIATVQKKSSD  170



>ref|XP_004150437.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
Length=264

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = +3

Query  96   NMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG------  257
            NM  +  ++LKETELCLGLPGG G G +  S+K +GKRGFSETVDLKLNLQS        
Sbjct  7    NMPNNQFVSLKETELCLGLPGGGGSGGDQTSLKASGKRGFSETVDLKLNLQSKDGGGGVG  66

Query  258  --SCLDLSETKMQAppep-------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                +DL+E                +KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  67   VGVGVDLNENIKNVSTNVDGEKSLCSKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNTS  124



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = +3

Query  96   NMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG------  257
            NM  +  ++LKETELCLGLPGG G G +  S+K +GKRGFSETVDLKLNLQS        
Sbjct  7    NMPNNQFVSLKETELCLGLPGGGGSGGDQTSLKASGKRGFSETVDLKLNLQSKDGGGGVG  66

Query  258  --SCLDLSETKMQAppep-------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                +DL+E                +KDP KPPAKAQVVGWPPVRSYRKNVMA    S
Sbjct  67   VGVGVDLNENIKNVSTNVDGEKSLCSKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNTS  124



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +N +ETEL LGLP G    NE    K  GKRG+S+ VDLKLNL +   + +D +E KM+ 
Sbjct  15   INFEETELRLGLPTGIENDNETA--KNNGKRGYSDMVDLKLNLSTTKEASVDEAE-KMKE  71

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                        AKAQVVGWPPVRS+RKN+M   + S++
Sbjct  72   KNTAKPP-----AKAQVVGWPPVRSFRKNIMTVQKNSSD  105



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-KMQA  293
            LN +ETEL LGL    GGGN+ +  K++GKRGFSETVDLKLNL S  S  D +E  K ++
Sbjct  14   LNYEETELRLGLGLPGGGGNDGDVSKSSGKRGFSETVDLKLNLLSKDSVADQAEKMKEKS  73

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
               P+ DP KPPAKAQVVGWPPVRS+RKN++
Sbjct  74   ALPPSNDPAKPPAKAQVVGWPPVRSFRKNIL  104



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG     N        GKRG+ ETVDLKLNL + D   LD S+ K + 
Sbjct  16   LGFEETELRLGLPGAGEKSNA-----NYGKRGYEETVDLKLNLSTKDVGNLDQSDLKEKT  70

Query  294  ppepnk------dpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
              +         D +KPPAKAQVVGWPPVRS+RKNVMA  + S++
Sbjct  71   LSKEKNLLPCPNDSVKPPAKAQVVGWPPVRSFRKNVMAVQKVSDS  115



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 77/118 (65%), Gaps = 12/118 (10%)
 Frame = +3

Query  87   KMTNMLGHG----GLNLKETELCLGLPggsgggnenesMKTT----GKRGFSETVDLKLN  242
            KM + LG G     LN +ETEL LGLPGG GGG+ + +   T     KRGF+ETVDLKLN
Sbjct  6    KMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETVDLKLN  65

Query  243  LQSDGSCLDLSETKMQAppep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            L +  S LD +E K     +     + DP KPPAKAQVVGWPPVRS+RKN+++ H+ S
Sbjct  66   LPTKESVLDPAEKKNSPKEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILSVHKSS  123



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKM-QAppep  305
            ETEL LGL     G     + K  GKR FSETVDLKLNL S  S +D     + +     
Sbjct  19   ETELRLGLRSAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDNIKEKKNIA  78

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              DP KPPAKAQVVGWPPVRS+RKNV+   + S
Sbjct  79   PTDPAKPPAKAQVVGWPPVRSFRKNVLTVQKNS  111



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 12/100 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD------LSE  278
            LNL+ TEL LGLPGGS G       +   KRGFSETVDLKLNL    + +D      L +
Sbjct  20   LNLEATELRLGLPGGSEGS------EVVRKRGFSETVDLKLNLSGKEAGVDDNKVKSLQK  73

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             K ++      DP +PPAKAQVVGWPPVRS+RKN++A  +
Sbjct  74   EKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQK  113



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 12/100 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD------LSE  278
            LNL+ TEL LGLPGGS G       +   KRGFSETVDLKLNL    + +D      L +
Sbjct  11   LNLEATELRLGLPGGSEGS------EVVRKRGFSETVDLKLNLSGKEAGVDDNKVKSLQK  64

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
             K ++      DP +PPAKAQVVGWPPVRS+RKN++A  +
Sbjct  65   EKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQK  104



>gb|ABR08758.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08759.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08760.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08761.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08762.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08764.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08765.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08766.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08767.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08768.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08769.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08770.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08771.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08772.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08773.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08774.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08775.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08776.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08777.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08778.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08779.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = +3

Query  141  CLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL-DLSETKMQAppe  302
            CLGLPGG           T  KRGFSETVDLKLNL ++     GS   D+     +    
Sbjct  1    CLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSA  55

Query  303  pnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              KDP KPPAKAQVVGWPPVRSYRKNVM   QKS
Sbjct  56   CPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKS  89



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +  +ETEL LGLPG    G      +   KRGFSETVDLKLNL S + S +D +E K + 
Sbjct  71   MGFEETELRLGLPGNIRAGEG----EVARKRGFSETVDLKLNLSSKESSGVDPNE-KEKN  125

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                  DP KPPAKAQVVGWPPVRS+RKN+ A  + S+
Sbjct  126  LLPCATDPAKPPAKAQVVGWPPVRSFRKNMFATQKSSS  163



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLD-------LSET  281
            ETEL LGLPG +G   E+ + K  GKR FSETVDLKLNL +  D + +D       + E 
Sbjct  19   ETELRLGLPGANGNEVESTN-KNNGKRVFSETVDLKLNLSNSKDSTLMDNINQVDNMKEK  77

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            K       + DP K PAKAQVVGWPPVRS+RKNVM   + +
Sbjct  78   KNNIVVPSSNDPAKSPAKAQVVGWPPVRSFRKNVMTVQKNT  118



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +  +ETEL LGLPG    G      +   KRGFSETVDLKLNL S + S +D +E K + 
Sbjct  84   MGFEETELRLGLPGNIRAGEG----EVARKRGFSETVDLKLNLSSKESSGVDPNE-KEKN  138

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                  DP KPPAKAQVVGWPPVRS+RKN+ A  + S+
Sbjct  139  LLPCATDPAKPPAKAQVVGWPPVRSFRKNMFATQKSSS  176



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 12/81 (15%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQ---SDGSCLDLSETKMQAppepnkdpi------kppAKAQV  344
            K  GKRGFSETVDLKLN      D SC  +   KM++     K+ +      KPPAKAQV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCA-MENNKMKSSVTTTKEVVCNKDPIKPPAKAQV  90

Query  345  VGWPPVRSYRKNVMAHHQKSN  407
            VGWPPVRS+RKNVMA  QKSN
Sbjct  91   VGWPPVRSFRKNVMA--QKSN  109



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 55/106 (52%), Gaps = 17/106 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG           + T KRGFSET+DLKL LQ+ D   ++    KM+ 
Sbjct  14   LGFEETELRLGLPGDG---------EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKR  64

Query  294  ppepn-------kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                             P  KAQVVGWPPVRS+RKN+M+      N
Sbjct  65   SASQKNLLACSNDPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGN  110



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 55/106 (52%), Gaps = 17/106 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG           + T KRGFSET+DLKL LQ+ D   ++    KM+ 
Sbjct  14   LGFEETELRLGLPGDG---------EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKR  64

Query  294  ppepn-------kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                             P  KAQVVGWPPVRS+RKN+M+      N
Sbjct  65   SASQKNLLACSNDPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGN  110



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 58/110 (53%), Gaps = 18/110 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG-----------SC  263
            LN + TEL LG PG           K  GKRGFSETVDLKLNL               + 
Sbjct  7    LNFEATELRLGPPGNGDSAG-----KGIGKRGFSETVDLKLNLMEPAPLDVPASTVKDTG  61

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA-HHQKSNN  410
            +DL+E K++           P  KAQVVGWPPVRS+R+N++A    K NN
Sbjct  62   VDLTE-KLRGSNAVADPAKPPAHKAQVVGWPPVRSFRRNMLATQSSKGNN  110



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 64/103 (62%), Gaps = 12/103 (12%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLD---------LS  275
            ETEL LGLPG +G   E+ + K  GKR FSETVDLKLNL +  D + +D         + 
Sbjct  19   ETELRLGLPGANGNELESSN-KNNGKRVFSETVDLKLNLSNSKDSTLMDNININQVDNMK  77

Query  276  ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
            E K       + DP KPPAKAQVVGWPPVRS+RKNVM   + +
Sbjct  78   EKKNNIVVPSSNDPAKPPAKAQVVGWPPVRSFRKNVMTVQKNT  120



>ref|XP_002299625.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|ABK94664.1| unknown [Populus trichocarpa]
 gb|EEE84430.1| auxin-induced protein IAA4 [Populus trichocarpa]
Length=220

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +3

Query  93   TNMLGHGGLN--LKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            +N+L     N   KETEL LGLPG S G    E  KT+GKRGF ETVDL L   S+    
Sbjct  7    SNLLESDAANVSFKETELTLGLPGESRGLALIE--KTSGKRGFLETVDLNLGRSSNVDS-  63

Query  267  DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
            D ++   ++  +       P AKAQVVGWPPVR+YRKN M
Sbjct  64   DHNKYSGESETDVPNTAKPPAAKAQVVGWPPVRAYRKNAM  103



>gb|ABR08763.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 56/94 (60%), Gaps = 11/94 (12%)
 Frame = +3

Query  141  CLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSCL-DLSETKMQAppe  302
            CLGLPGG           T  KRGFSETVDLKLNL ++     GS   D+     +    
Sbjct  1    CLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSA  55

Query  303  pnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
              KDP KPP KAQVVGWPPVRSYRKNVM   QKS
Sbjct  56   CPKDPAKPPTKAQVVGWPPVRSYRKNVMVSCQKS  89



>gb|AFZ78621.1| hypothetical protein [Populus tomentosa]
Length=220

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            ++ KETEL LGLPG S G    E  KT+GKRGF ETVDL L   S+    D  +   ++ 
Sbjct  17   VSFKETELTLGLPGESRGLALIE--KTSGKRGFLETVDLNLGRSSNVDS-DHHKYSGESE  73

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVM  386
             +       P AKAQVVGWPPVR+YRKN M
Sbjct  74   TDVPNTAKPPAAKAQVVGWPPVRAYRKNAM  103



>gb|ADL70687.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70690.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=132

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  195  TTGKRGFSETVDLKLNLQSD-----GSCL-DLSETKMQAppepnkdpikppAKAQVVGWP  356
            T  KRGFSETVDLKLNL ++     GS   D+     +      KDP KPPAKAQVVGWP
Sbjct  10   TGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWP  69

Query  357  PVRSYRKNVMAHHQKS  404
            PVRSYRKNVM   QKS
Sbjct  70   PVRSYRKNVMVSCQKS  85



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 7/69 (10%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGS--CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRK  377
            KRGFSETVDLKLNLQ++     +DL+        + +KDP KPP+KAQVVGWPPVR+YRK
Sbjct  38   KRGFSETVDLKLNLQTNKQEGVMDLTNA-----SKVSKDPAKPPSKAQVVGWPPVRNYRK  92

Query  378  NVMAHHQKS  404
            NVMA+ + S
Sbjct  93   NVMANQKNS  101



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 61/102 (60%), Gaps = 8/102 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG  GG       +   KRGFSETVDLKL L S  S  D +  K  + 
Sbjct  9    MGFEETELRLGLPGNGGGAEG----EMVRKRGFSETVDLKLKLSSKESGADPNHEKTSSL  64

Query  297  pep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                     DP KPPAKAQVVGWPPVRS+RKN++A  + S +
Sbjct  65   QREKNLLATDPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTD  106



>ref|XP_011045352.1| PREDICTED: auxin-responsive protein IAA1 [Populus euphratica]
Length=220

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            ++ KETEL LGLPG S G    E  KT+GKRGF ETVDL L   S+    D ++   ++ 
Sbjct  17   VSFKETELTLGLPGESRGLALIE--KTSGKRGFLETVDLNLGRPSNVDS-DHNKYSGESE  73

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVM  386
             +       P AKAQVVGWPPVR++RKN M
Sbjct  74   TDVPNTAKPPAAKAQVVGWPPVRAFRKNAM  103



>gb|KDP21369.1| hypothetical protein JCGZ_21840 [Jatropha curcas]
Length=251

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSE-TK  284
            G    E  L LGLPG + GG  NE   T  KRGFS+TVDL+LN+ S  + +  D ++ TK
Sbjct  9    GFEEPELRLGLGLPGNNSGGGGNEGEMTIRKRGFSQTVDLELNISSKEESAAFDPNQKTK  68

Query  285  --MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
               +       DP KPPAKAQVVGWPPVRSYRKN++A  + SN
Sbjct  69   NLPREKNLLAADPAKPPAKAQVVGWPPVRSYRKNMLAVPKSSN  111



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 8/102 (8%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           + + KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVRSEG----EGSRKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+
Sbjct  61   EKHPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS  102



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 8/102 (8%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           + + KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVRSEG----EGSRKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+
Sbjct  61   EKHPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS  102



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNN  410
            ++A  + S +
Sbjct  96   MLAVQKSSTD  105



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNN  410
            ++A  + S +
Sbjct  96   MLAVQKSSTD  105



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQS-DGSCLDLSETK--MQAppepnkdpikppAKAQVVGWPPV  362
            K  GKRGF ETVDLKLNL S D   LD  + K    +P  P+ D +KPPAKAQVVGWPPV
Sbjct  47   KNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGWPPV  106

Query  363  RSYRKNVMAHHQKSNN  410
            RS+RKN+++  + S +
Sbjct  107  RSFRKNIVSAQKNSGD  122



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 68/122 (56%), Gaps = 24/122 (20%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKT-----TGKRGFSET----VDLKLNLQSDGSCLD  269
            ++ +ETEL LGLP  +          T     TGKRGFS+T    VDLKLNL S  + + 
Sbjct  15   IDFEETELRLGLPLSANETESTLIRNTSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVS  74

Query  270  LSETKMQA--------------ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH-QKS  404
             + +   A                 P KDP KPPAKAQVVGWPPVRS+RKN++ ++ QKS
Sbjct  75   ATPSSDMAKDNTASAAANTTTPSSPPVKDPAKPPAKAQVVGWPPVRSFRKNIVNNNVQKS  134

Query  405  NN  410
            NN
Sbjct  135  NN  136



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNN  410
            ++A  + S +
Sbjct  96   MLAVQKSSTD  105



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = +3

Query  126  KETELCLGLPggsgggnenesMKTT---GKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +ETEL LGLPG      +  S  +    GKRGF+ETVDLKLNL +    LD  E + +  
Sbjct  1    EETELRLGLPGAGVDQFQAVSSASAAACGKRGFAETVDLKLNLAAKEMNLD-KEKEKKKN  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             + + D  KPP KAQVVGWPPVR++R+N +   +KS
Sbjct  60   LQISADSSKPPMKAQVVGWPPVRAFRRNAICSQKKS  95



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 61/106 (58%), Gaps = 13/106 (12%)
 Frame = +3

Query  117  LNLKETELCLG--LPggsgggnenesMKTTGKRGFSETVDLKLNLQS------DGSCLDL  272
            L  +ETEL LG  LPG     +      + GKRGF+ETVDLKL L S      D   L+ 
Sbjct  14   LGFEETELRLGIGLPGAGDQKSSG----SYGKRGFAETVDLKLKLSSKEIGDLDRGGLER  69

Query  273  SET-KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             +  K +       +  +PPAKAQVVGWPPVRS+RKNVMA  +KS 
Sbjct  70   KDLCKEKNLMPSPTESARPPAKAQVVGWPPVRSFRKNVMAVQKKSE  115



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (60%), Gaps = 8/102 (8%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           +   KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVLSEG----EGARKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+
Sbjct  61   EKNPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS  102



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K +        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNN  410
            ++A  + S +
Sbjct  96   MLAVQKSSTD  105



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 53/93 (57%), Gaps = 13/93 (14%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GSCLDLSETKMQ  290
            E  LCLGLPGG              KRG+SETVDLKLNL ++      GS +    T   
Sbjct  2    ELNLCLGLPGGGETTATV----AGNKRGYSETVDLKLNLNNEPETNKEGSLVSKENT---  54

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
            +   P      PPAKAQVVGWPPVRSYRKNVM+
Sbjct  55   SSICPKDSTKPPPAKAQVVGWPPVRSYRKNVMS  87



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 15/90 (17%)
 Frame = +3

Query  120  NLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQApp  299
            + +ETEL LG+PGG        +     KRGF ET+D KLN  S+G  ++ S        
Sbjct  5    SYEETELRLGMPGGLHKIAGAGN-SYGAKRGFEETLDFKLNFASNGENINDS--------  55

Query  300  epnkdpikppAKAQVVGWPPVRSYRKNVMA  389
                  +KPPAKAQVVGWPPVRS+RKN+MA
Sbjct  56   ------VKPPAKAQVVGWPPVRSFRKNIMA  79



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 8/102 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD----GSCLDLSETK  284
            +  +ETEL LGLPG  GG       +   KRGFSETVDLKL L S     G   + + + 
Sbjct  9    MGFEETELRLGLPGNGGGAEG----EMVRKRGFSETVDLKLKLSSKERGAGPNHEKTRSL  64

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             +       DP KPPAKAQVVGWPPVRS+RKN++A  + S +
Sbjct  65   QREKNILATDPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTD  106



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 9/102 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +     +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKTTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNN  107



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 9/102 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +     +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKTTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNN  107



>ref|NP_001266055.1| IAA10 protein [Solanum lycopersicum]
 gb|AEX00360.1| IAA17 [Solanum lycopersicum]
Length=208

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 54/96 (56%), Gaps = 17/96 (18%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            L+ +ETEL LGLP         +N++    GKRGF   VDLKLNL SD + +  S  K  
Sbjct  6    LDFEETELRLGLPGGARKNVYGDNDTCNVNGKRGF---VDLKLNLSSDINNIKNSTHKTP  62

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
            A            AKAQVVGWPPVRS+RKN++   +
Sbjct  63   A------------AKAQVVGWPPVRSFRKNILTSQK  86



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 20/91 (22%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTT-GKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            ++ +ETEL LGLP G      +E+   + GKR FSE VDLKLNL S      L+E +   
Sbjct  1    MDFEETELRLGLPCGGERKKAHETYNNSNGKRDFSEEVDLKLNLSSK-----LTENQ---  52

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
                        AKAQVVGWPPVRS+RKN++
Sbjct  53   -----------AAKAQVVGWPPVRSFRKNIL  72



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 9/102 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +N    +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKNTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLAKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNN  107



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 7/73 (10%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ-------AppepnkdpikppAKAQVVG  350
            K +GKR F ETVDLKL LQ+     +++  KM+                     KAQVVG
Sbjct  38   KNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQVVG  97

Query  351  WPPVRSYRKNVMA  389
            WPPVRSYRKN++A
Sbjct  98   WPPVRSYRKNILA  110



>gb|KJB11142.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11143.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=227

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMA  389
            VRS+RKN++A
Sbjct  111  VRSFRKNMLA  120



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 25/103 (24%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            L  +ETEL LGLPG +         + T KRGFS+T+DLKL L++    +D  + K +A 
Sbjct  14   LGFEETELRLGLPGDA---------EATKKRGFSKTIDLKLKLRT----VDSKDAKPEAE  60

Query  297  pepnkdpik------------ppAKAQVVGWPPVRSYRKNVMA  389
                    K            P  KAQVVGWPPVRS+RKN+M+
Sbjct  61   KMKRSASQKNLLACSSDPEKPPAPKAQVVGWPPVRSFRKNIMS  103



>ref|XP_003554705.1| PREDICTED: auxin-responsive protein IAA16-like isoform 1 [Glycine 
max]
 gb|KHN43187.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=230

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 58/99 (59%), Gaps = 16/99 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCLDLSETKMQA  293
            +N +ETEL LGLP          +  +TGKR FS+T VDLKLNL S              
Sbjct  11   INFEETELRLGLPLSGNETTLKNTC-STGKRVFSDTSVDLKLNLSS--------------  55

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                   P KPPAKAQVVGWPPVRS+RKN++ + Q+SNN
Sbjct  56   TSNNAPPPAKPPAKAQVVGWPPVRSFRKNIVNNVQRSNN  94



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 53/86 (62%), Gaps = 12/86 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS---DGSCLDLSETKM  287
            +N + TEL LGLPG           K  GKRGFSETVDLKLNL S   D   +D SE KM
Sbjct  2    INFEATELRLGLPGADHEEKAA---KNNGKRGFSETVDLKLNLSSMATDSGSMDGSE-KM  57

Query  288  QAppepnkdpikppAKAQVVGWPPVR  365
            +      K  +KPPAK+QVVGWPPVR
Sbjct  58   K-----EKTTVKPPAKSQVVGWPPVR  78



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMA  389
            VRS+RKN++A
Sbjct  111  VRSFRKNMLA  120



>gb|ACU19616.1| unknown [Glycine max]
Length=230

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 59/99 (60%), Gaps = 16/99 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCLDLSETKMQA  293
            +N +ETEL LGLP          +  +TGKR FS+T VDLKLNL S  +           
Sbjct  11   INFEETELRLGLPLSGNETTLKNTC-STGKRVFSDTSVDLKLNLSSTSN-----------  58

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                   P KPPAKAQVVGWPPVRS+RKN++ + Q+SNN
Sbjct  59   ---NAPPPAKPPAKAQVVGWPPVRSFRKNIVNNVQRSNN  94



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +3

Query  189  MKTTGKRGFSETVDLKLNLQSDGSCLDLSET---KMQAppepnkdpikppAKAQVVGWPP  359
            +K+ GKR FS+TVDLKL L S  S +D  E              D  KPPAKAQVVGWPP
Sbjct  25   VKSNGKRAFSDTVDLKLKLSSKESNVDQVENLKDNNNNVVTSPSDSTKPPAKAQVVGWPP  84

Query  360  VRSYRKNVMAHHQ  398
            VRSYRKN+++  +
Sbjct  85   VRSYRKNILSGQK  97



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMA  389
            VRS+RKN++A
Sbjct  111  VRSFRKNMLA  120



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMA  389
            VRS+RKN++A
Sbjct  111  VRSFRKNMLA  120



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 17/82 (21%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikp--------------p  329
            K +GKRGFSET+DLKL L +     D  E  M+A  +  + P                  
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VADSKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPA  93

Query  330  AKAQVVGWPPVRSYRKNVMAHH  395
             KAQVVGWPPVRS+RKN+MA H
Sbjct  94   PKAQVVGWPPVRSFRKNMMASH  115



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +3

Query  201  GKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKN  380
            GKRG+ +TVDLKLNL S     DL      A  + N  P+KPPAKAQVVGWPPVR++RKN
Sbjct  37   GKRGYEQTVDLKLNLSSK----DLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRKN  92

Query  381  VMAHHQ  398
            VMA  +
Sbjct  93   VMAVQK  98



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 60/108 (56%), Gaps = 14/108 (13%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggn----enesMKTTGKRGFSETVDLKLNLQSDGSC------  263
            GL ++ETEL LGLPGG GGG     E ES K +GKRGF E VDLKL LQ+          
Sbjct  4    GLRMEETELRLGLPGGGGGGGGGGGEVESGKNSGKRGFVEIVDLKLQLQTPVGVQEAAAE  63

Query  264  ----LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
                +  S          +      P KAQVVGWPPVRS+RKN+++ H
Sbjct  64   AAEKVKRSPNDDSIVSCGSDPEKPSPPKAQVVGWPPVRSFRKNILSVH  111



>gb|KDP37176.1| hypothetical protein JCGZ_06232 [Jatropha curcas]
Length=220

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            G+NLKETEL L LPG S    E    K   KRGF ETVDL L   S   C    +    +
Sbjct  17   GMNLKETELTLALPGESRSLTEINGAKIGTKRGFLETVDLNLGSSSVVDCGSKDQND-SS  75

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
              + +     P AKAQVVGWPPVR+YRKN M
Sbjct  76   ENDVSSAAKPPAAKAQVVGWPPVRAYRKNAM  106



>ref|XP_010923479.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Elaeis 
guineensis]
Length=232

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 16/81 (20%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpik-------------ppA  332
            K +GKRGFSET+DLKL L +    +D  E +M+   +  + P +                
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAP  93

Query  333  KAQVVGWPPVRSYRKNVMAHH  395
            KAQVVGWPPVRS+RKN++A H
Sbjct  94   KAQVVGWPPVRSFRKNILATH  114



>emb|CBI36106.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 58/120 (48%), Gaps = 24/120 (20%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnene--sMKTTGKRGFSETVD------LKLNLQSDGSCLD-  269
            LNL+ETEL LGLPG      + +     +  KRGFS+ +D        +N  S+ SC+  
Sbjct  43   LNLRETELRLGLPGSESPERKPQLGGFVSGAKRGFSDAIDGSGKWVFSVNGGSEKSCMPG  102

Query  270  --------------LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
                          + E K QA            AKAQVVGWPP+RS+RKN MA   K+N
Sbjct  103  PAMKDVAAPSSPKPVQEKKPQASAANEHASAPA-AKAQVVGWPPIRSFRKNTMASSAKNN  161



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMA  389
            VRS+RKN++A
Sbjct  111  VRSFRKNMLA  120



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 16/81 (20%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpik-------------ppA  332
            K +GKRGFSET+DLKL L +    +D  E +M+   +  + P +                
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAP  93

Query  333  KAQVVGWPPVRSYRKNVMAHH  395
            KAQVVGWPPVRS+RKN++A H
Sbjct  94   KAQVVGWPPVRSFRKNILATH  114



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNV  383
            KRGFSETVDLKLNL S  S  D  E +       +  P KPPAK QVVGWPPVRS+RKN+
Sbjct  49   KRGFSETVDLKLNLASKNSQAD--EEEKSVAASSSSSPSKPPAKTQVVGWPPVRSFRKNI  106

Query  384  MAHHQKSN  407
            ++  + SN
Sbjct  107  LSVQKNSN  114



>ref|NP_001290520.1| auxin-responsive protein IAA1 [Elaeis guineensis]
 gb|AAT76903.1| IAA type protein [Elaeis guineensis]
Length=211

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 51/92 (55%), Gaps = 10/92 (11%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQ  290
            GL+ +ETEL LGLPGGS         +T  KRGF+ETVDL L  +S  G   D S     
Sbjct  16   GLDYEETELKLGLPGGSRTAGS----ETEKKRGFAETVDLSLGAESRSGDLGDRSTGDFG  71

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
            +             KAQVVGWPPVRS+RKN +
Sbjct  72   SGAGKPPA-----VKAQVVGWPPVRSFRKNAL  98



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 58/103 (56%), Gaps = 20/103 (19%)
 Frame = +3

Query  117  LNLKETELCLGLPggsggg--nenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            L+ +ETEL LGLPG       ++N++    GKRGF   VDLKLNL SD + +  S  K  
Sbjct  12   LDFEETELRLGLPGEGRKNVHDDNDTYNVNGKRGF---VDLKLNLSSDINNIKNSTLKAP  68

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH---QKSNN  410
            A             K Q+VGWPPVRS+RKN++      Q+S+N
Sbjct  69   A------------VKTQIVGWPPVRSFRKNILTSQKLGQESDN  99



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCL------  266
            +N +ETEL LGLP    S          + GKRGFSET  VDLKLNL S           
Sbjct  2    INFEETELRLGLPGGSASDHNESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSS  61

Query  267  ---DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQ  398
               + + T    PP    DP KPPAKAQVVGWPPVRS+RKN++  ++
Sbjct  62   ASTEKTTTAAPPPPSRANDPAKPPAKAQVVGWPPVRSFRKNIVQRNK  108



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 12/96 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG           +   KR FS TVDLKLNL S     D  +  + + 
Sbjct  24   MGYEETELRLGLPGDG---------EVVRKRDFSHTVDLKLNLISTSPTDDKDKNIVPSH  74

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +P K P    AKAQVVGWPPVRS+RKN++A  + S
Sbjct  75   LDPAKPPP---AKAQVVGWPPVRSFRKNMLATQKSS  107



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 12/96 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG           +   KR FS TVDLKLNL S     D  +  + + 
Sbjct  24   MGYEETELRLGLPGDG---------EVVRKRDFSHTVDLKLNLISTSPTDDKDKNIVPSH  74

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             +P K P    AKAQVVGWPPVRS+RKN++A  + S
Sbjct  75   LDPAKPPP---AKAQVVGWPPVRSFRKNMLATQKSS  107



>ref|XP_009398379.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDL--------  272
            L  +ETEL LGL  G G G E +  K +GKR F+ET+DLKL LQ+ G   D+        
Sbjct  15   LGFQETELRLGL-PGGGSGGEGDVGKNSGKRAFAETIDLKLKLQAAGDTKDMAAALKMKR  73

Query  273  SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
            S ++M            P  KAQVVGWPPVRS+R++++A
Sbjct  74   SPSQMSIAASATDPEKPPAPKAQVVGWPPVRSHRRSMLA  112



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 61/110 (55%), Gaps = 25/110 (23%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD-------  269
            +N +ETEL LGLPG            +  KRGFSET  VDLKLNL    SC++       
Sbjct  2    INFEETELRLGLPGNDSALKG-----SAAKRGFSETASVDLKLNL---SSCINDSASDSP  53

Query  270  -------LSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
                     E K   A P P  DP KPPAKAQVVGWPPVRS+RKN++  +
Sbjct  54   SSVSTEKPKENKTTTAEPPPANDPAKPPAKAQVVGWPPVRSFRKNIVQRN  103



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETK-MQA  293
            L  +ETEL LGLPGG G  +         KRGF+ETVDLKLN+ +D +  + +  K + +
Sbjct  5    LGFEETELRLGLPGGDGRNDG----DAVKKRGFTETVDLKLNIVTDSNQGNKTTDKNVVS  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
                   P  PPAKAQVVGWPPV+S R+N++   +K+
Sbjct  61   SFVNKDLPKPPPAKAQVVGWPPVKSLRRNIVGPPKKN  97



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 61/110 (55%), Gaps = 25/110 (23%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD-------  269
            +N +ETEL LGLPG            +  KRGFSET  VDLKLNL    SC++       
Sbjct  2    INFEETELRLGLPGNDSALKG-----SAAKRGFSETASVDLKLNL---SSCINDSASDSP  53

Query  270  -------LSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH  395
                     E K   A P P  DP KPPAKAQVVGWPPVRS+RKN++  +
Sbjct  54   SSVSTEKPKENKTTTAEPPPANDPAKPPAKAQVVGWPPVRSFRKNIVQRN  103



>ref|XP_007013279.1| Indoleacetic acid-induced protein 16, putative [Theobroma cacao]
 gb|EOY30898.1| Indoleacetic acid-induced protein 16, putative [Theobroma cacao]
Length=232

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 46/90 (51%), Gaps = 5/90 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  ++TEL LGLPG          +K + KRGF ETVDLKL     GSC           
Sbjct  17   MRFEDTELTLGLPGEGRSPAVIAGVKCSAKRGFVETVDLKL-----GSCSRAPSGGGDTH  71

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVM  386
                     PPAKAQV+GWPPVRS RK  +
Sbjct  72   VNEAGAGKPPPAKAQVIGWPPVRSSRKKAI  101



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSET----KMQAppepnkdpikppAKAQVVGWPPVRSY  371
            KRGFSETVDLKLNL S    +D ++       +       DP KPPAKAQVVGWPPVRS+
Sbjct  45   KRGFSETVDLKLNLSSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKAQVVGWPPVRSF  104

Query  372  RKNVMAHHQKSN  407
            RK+++   + SN
Sbjct  105  RKHMLTVQKSSN  116



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 67/112 (60%), Gaps = 16/112 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
            G    + +TK + A      D  KPPAKAQVVGWPPVRS+RKN+MA  QK N
Sbjct  62   GGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMA-VQKDN  112



>gb|KDO48908.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=171

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 69/112 (62%), Gaps = 16/112 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNLQSDGS  260
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL +  S
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  261  C-LDLSE-TKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
              +D+ E TK + A      D  KPPAK+QVVGWPPVRS+RKN+MA  QK N
Sbjct  62   GGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMA-VQKDN  112



>ref|XP_007024033.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOY26655.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=202

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 54/92 (59%), Gaps = 10/92 (11%)
 Frame = +3

Query  111  GGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
             GLN + TEL LGLPG S   ++ E+ K+  KRGF ETVDL L  +  G     S+T +Q
Sbjct  8    AGLNFEATELTLGLPGKSKVTSDGEA-KSGTKRGFLETVDLNLGDKKCGQ----SQTDVQ  62

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
                       P +KAQVVGWPPVR+ RKN M
Sbjct  63   -----EAAKSSPVSKAQVVGWPPVRALRKNAM  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564491502050