BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024M02

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222183.1|  PREDICTED: nuclear transport factor 2              241   1e-78   Prunus mume [ume]
ref|XP_004310092.1|  PREDICTED: nuclear transport factor 2              240   2e-78   Fragaria vesca subsp. vesca
ref|XP_007223428.1|  hypothetical protein PRUPE_ppa013422mg             240   3e-78   Prunus persica
ref|XP_011098902.1|  PREDICTED: nuclear transport factor 2-like         236   1e-76   Sesamum indicum [beniseed]
ref|XP_010556126.1|  PREDICTED: nuclear transport factor 2-like         236   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_010531125.1|  PREDICTED: nuclear transport factor 2              235   3e-76   Tarenaya hassleriana [spider flower]
ref|XP_008389878.1|  PREDICTED: nuclear transport factor 2-like         235   3e-76   Malus domestica [apple tree]
ref|XP_002304677.1|  Nuclear transport factor 2 family protein          234   6e-76   Populus trichocarpa [western balsam poplar]
ref|XP_002276841.1|  PREDICTED: nuclear transport factor 2              234   7e-76   Vitis vinifera
ref|XP_006438006.1|  hypothetical protein CICLE_v10033081mg             233   2e-75   Citrus clementina [clementine]
ref|XP_010044826.1|  PREDICTED: nuclear transport factor 2              233   2e-75   Eucalyptus grandis [rose gum]
ref|XP_009372264.1|  PREDICTED: nuclear transport factor 2-like         233   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_010025297.1|  PREDICTED: nuclear transport factor 2-like         233   2e-75   Eucalyptus grandis [rose gum]
ref|XP_009109763.1|  PREDICTED: nuclear transport factor 2-like         233   2e-75   Brassica rapa
ref|XP_008340231.1|  PREDICTED: nuclear transport factor 2              233   3e-75   Malus domestica [apple tree]
ref|XP_002514900.1|  nuclear transport factor, putative                 233   3e-75   Ricinus communis
gb|KDP26818.1|  hypothetical protein JCGZ_17976                         231   7e-75   Jatropha curcas
emb|CDP16704.1|  unnamed protein product                                231   1e-74   Coffea canephora [robusta coffee]
ref|XP_010249046.1|  PREDICTED: nuclear transport factor 2-like         230   3e-74   Nelumbo nucifera [Indian lotus]
gb|KHG11196.1|  Nuclear transport factor 2 -like protein                229   6e-74   Gossypium arboreum [tree cotton]
ref|XP_011036092.1|  PREDICTED: nuclear transport factor 2 isofor...    229   7e-74   Populus euphratica
ref|XP_009113718.1|  PREDICTED: nuclear transport factor 2-like         229   9e-74   Brassica rapa
ref|XP_006415779.1|  hypothetical protein EUTSA_v10008965mg             230   9e-74   
emb|CDY48413.1|  BnaCnng16260D                                          228   2e-73   Brassica napus [oilseed rape]
emb|CDY11757.1|  BnaC03g58210D                                          228   2e-73   Brassica napus [oilseed rape]
ref|XP_011071236.1|  PREDICTED: nuclear transport factor 2-like         228   3e-73   Sesamum indicum [beniseed]
gb|KFK44674.1|  hypothetical protein AALP_AA1G288800                    228   3e-73   Arabis alpina [alpine rockcress]
ref|XP_010250681.1|  PREDICTED: nuclear transport factor 2              227   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_011086817.1|  PREDICTED: nuclear transport factor 2              227   4e-73   Sesamum indicum [beniseed]
ref|XP_004156943.1|  PREDICTED: nuclear transport factor 2-like         229   5e-73   
ref|XP_004152114.1|  PREDICTED: nuclear transport factor 2-like         228   5e-73   
emb|CDY71767.1|  BnaCnng74350D                                          227   5e-73   Brassica napus [oilseed rape]
ref|NP_174118.1|  nuclear transport factor 2B                           226   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102940.1|  PREDICTED: nuclear transport factor 2              226   1e-72   Brassica rapa
ref|XP_010540411.1|  PREDICTED: nuclear transport factor 2              226   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_010905497.1|  PREDICTED: nuclear transport factor 2              225   2e-72   Elaeis guineensis
gb|KEH20612.1|  nuclear transport factor 2                              225   2e-72   Medicago truncatula
gb|AAM63803.1|  nuclear transport factor 2, putative                    225   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABL97965.1|  putative nuclear transport factor 2                     225   3e-72   Brassica rapa
gb|EYU42085.1|  hypothetical protein MIMGU_mgv1a016409mg                224   5e-72   Erythranthe guttata [common monkey flower]
ref|XP_006305779.1|  hypothetical protein CARUB_v10010649mg             224   5e-72   Capsella rubella
ref|XP_008454013.1|  PREDICTED: nuclear transport factor 2-like         224   6e-72   Cucumis melo [Oriental melon]
ref|XP_007043966.1|  Nuclear transport factor 2B                        224   6e-72   Theobroma cacao [chocolate]
ref|XP_007158674.1|  hypothetical protein PHAVU_002G172900g             224   7e-72   Phaseolus vulgaris [French bean]
ref|XP_002890753.1|  hypothetical protein ARALYDRAFT_472998             224   9e-72   
ref|XP_006415711.1|  hypothetical protein EUTSA_v10010039mg             224   1e-71   Eutrema salsugineum [saltwater cress]
ref|XP_007163773.1|  hypothetical protein PHAVU_001G262800g             223   1e-71   Phaseolus vulgaris [French bean]
gb|KJB30877.1|  hypothetical protein B456_005G165500                    223   1e-71   Gossypium raimondii
gb|KHG04819.1|  Nuclear transport factor 2 -like protein                223   2e-71   Gossypium arboreum [tree cotton]
gb|KJB15503.1|  hypothetical protein B456_002G182000                    223   2e-71   Gossypium raimondii
gb|ACJ85652.1|  unknown                                                 223   2e-71   Medicago truncatula
ref|XP_010499291.1|  PREDICTED: nuclear transport factor 2              223   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010682741.1|  PREDICTED: nuclear transport factor 2              222   3e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34814.1|  hypothetical protein MIMGU_mgv1a016384mg                222   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_004502282.1|  PREDICTED: nuclear transport factor 2-like         222   4e-71   Cicer arietinum [garbanzo]
ref|XP_006352175.1|  PREDICTED: nuclear transport factor 2-like         222   4e-71   Solanum tuberosum [potatoes]
ref|XP_009403552.1|  PREDICTED: nuclear transport factor 2              222   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798933.1|  PREDICTED: nuclear transport factor 2-like         221   1e-70   Phoenix dactylifera
ref|XP_009421062.1|  PREDICTED: nuclear transport factor 2-like         221   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239227.1|  PREDICTED: nuclear transport factor 2              221   1e-70   Solanum lycopersicum
ref|XP_009419369.1|  PREDICTED: nuclear transport factor 2-like         221   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004231773.1|  PREDICTED: nuclear transport factor 2              221   1e-70   Solanum lycopersicum
ref|XP_003601758.1|  Nuclear transport factor                           221   1e-70   Medicago truncatula
gb|KHG14054.1|  Nuclear transport factor 2 -like protein                220   2e-70   Gossypium arboreum [tree cotton]
emb|CDX84932.1|  BnaC05g21230D                                          219   4e-70   
emb|CDY27606.1|  BnaA09g28010D                                          219   4e-70   Brassica napus [oilseed rape]
ref|XP_002297847.2|  hypothetical protein POPTR_0001s13730g             220   4e-70   
ref|XP_004504406.1|  PREDICTED: nuclear transport factor 2-like         219   4e-70   Cicer arietinum [garbanzo]
ref|NP_001240272.1|  uncharacterized protein LOC100777334               219   5e-70   Glycine max [soybeans]
gb|AFK49295.1|  unknown                                                 219   6e-70   Lotus japonicus
ref|XP_003538542.1|  PREDICTED: nuclear transport factor 2              219   6e-70   Glycine max [soybeans]
ref|XP_008790757.1|  PREDICTED: nuclear transport factor 2              219   8e-70   Phoenix dactylifera
gb|EPS62811.1|  hypothetical protein M569_11974                         218   1e-69   Genlisea aurea
emb|CDY66150.1|  BnaAnng21720D                                          218   1e-69   Brassica napus [oilseed rape]
ref|XP_006305784.1|  hypothetical protein CARUB_v10010663mg             218   1e-69   Capsella rubella
ref|XP_002893460.1|  hypothetical protein ARALYDRAFT_890252             218   1e-69   Arabidopsis lyrata subsp. lyrata
gb|ABQ59097.1|  nuclear transport factor 2                              218   2e-69   Panax ginseng [Asiatic ginseng]
ref|XP_010926830.1|  PREDICTED: nuclear transport factor 2 isofor...    218   2e-69   Elaeis guineensis
emb|CDY03908.1|  BnaC07g11330D                                          218   2e-69   
ref|XP_010927764.1|  PREDICTED: nuclear transport factor 2-like         218   2e-69   Elaeis guineensis
ref|XP_003524901.1|  PREDICTED: nuclear transport factor 2-like         217   3e-69   Glycine max [soybeans]
emb|CDY15721.1|  BnaA07g08920D                                          216   7e-69   Brassica napus [oilseed rape]
ref|XP_009113780.1|  PREDICTED: nuclear transport factor 2-like         216   8e-69   Brassica rapa
gb|ABR17049.1|  unknown                                                 216   1e-68   Picea sitchensis
ref|NP_174051.1|  nuclear transport factor 2A                           216   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499203.1|  PREDICTED: nuclear transport factor 2-like         215   2e-68   Camelina sativa [gold-of-pleasure]
ref|NP_001077612.1|  nuclear transport factor 2B                        216   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806416.1|  PREDICTED: nuclear transport factor 2-like         214   4e-68   Phoenix dactylifera
ref|XP_009109823.1|  PREDICTED: nuclear transport factor 2-like         214   4e-68   Brassica rapa
ref|XP_009415885.1|  PREDICTED: nuclear transport factor 2-like         213   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102992.1|  PREDICTED: nuclear transport factor 2              212   3e-67   Brassica rapa
ref|XP_009405885.1|  PREDICTED: nuclear transport factor 2-like         212   5e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009606510.1|  PREDICTED: nuclear transport factor 2-like         211   6e-67   Nicotiana tomentosiformis
gb|AEZ52394.1|  nuclear transport factor 2                              211   6e-67   Wolffia australiana
gb|KHN44448.1|  Nuclear transport factor 2                              212   6e-67   Glycine soja [wild soybean]
ref|XP_006385898.1|  hypothetical protein POPTR_0003s16930g             206   4e-65   
emb|CDP13353.1|  unnamed protein product                                206   8e-65   Coffea canephora [robusta coffee]
ref|XP_006848276.1|  hypothetical protein AMTR_s00013p00078860          205   2e-64   Amborella trichopoda
ref|XP_009771779.1|  PREDICTED: nuclear transport factor 2-like         205   2e-64   Nicotiana sylvestris
gb|ABK22785.1|  unknown                                                 203   7e-64   Picea sitchensis
ref|XP_009597107.1|  PREDICTED: nuclear transport factor 2-like         203   1e-63   Nicotiana tomentosiformis
gb|KCW86936.1|  hypothetical protein EUGRSUZ_B03507                     201   3e-63   Eucalyptus grandis [rose gum]
ref|XP_001769890.1|  predicted protein                                  201   8e-63   
ref|XP_010462923.1|  PREDICTED: nuclear transport factor 2-like         201   2e-61   
ref|XP_002966354.1|  hypothetical protein SELMODRAFT_230884             197   4e-61   Selaginella moellendorffii
ref|XP_006365034.1|  PREDICTED: nuclear transport factor 2-like         196   4e-61   Solanum tuberosum [potatoes]
ref|XP_004233291.1|  PREDICTED: nuclear transport factor 2-like         196   5e-61   
ref|XP_002967834.1|  hypothetical protein SELMODRAFT_169222             196   8e-61   Selaginella moellendorffii
ref|XP_009786987.1|  PREDICTED: nuclear transport factor 2-like         192   2e-59   Nicotiana sylvestris
ref|XP_009601174.1|  PREDICTED: nuclear transport factor 2-like i...    192   2e-59   Nicotiana tomentosiformis
ref|XP_010680019.1|  PREDICTED: nuclear transport factor 2-like         186   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004957291.1|  PREDICTED: nuclear transport factor 2-like         184   3e-56   Setaria italica
gb|EMS50252.1|  Nuclear transport factor 2                              184   3e-56   Triticum urartu
ref|XP_009387677.1|  PREDICTED: nuclear transport factor 2-like         183   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010238338.1|  PREDICTED: nuclear transport factor 2-like         182   3e-55   Brachypodium distachyon [annual false brome]
gb|EMT26775.1|  Nuclear transport factor 2                              182   3e-55   
ref|XP_008807438.1|  PREDICTED: nuclear transport factor 2              181   4e-55   Phoenix dactylifera
ref|XP_011036093.1|  PREDICTED: nuclear transport factor 2 isofor...    180   6e-55   Populus euphratica
ref|XP_004974006.1|  PREDICTED: nuclear transport factor 2-like         181   6e-55   Setaria italica
emb|CDY71760.1|  BnaAnng38740D                                          179   2e-54   Brassica napus [oilseed rape]
ref|XP_010267746.1|  PREDICTED: nuclear transport factor 2-like         179   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008678399.1|  PREDICTED: nuclear transport factor 2-like         181   4e-54   Zea mays [maize]
gb|ACR36150.1|  unknown                                                 179   4e-54   Zea mays [maize]
ref|NP_001131358.1|  uncharacterized protein LOC100192679               179   5e-54   Zea mays [maize]
gb|KHG12275.1|  Nuclear transport factor 2 -like protein                178   5e-54   Gossypium arboreum [tree cotton]
ref|XP_010025298.1|  PREDICTED: nuclear transport factor 2-like         177   7e-54   
gb|KJB30875.1|  hypothetical protein B456_005G165500                    177   1e-53   Gossypium raimondii
ref|XP_009417248.1|  PREDICTED: nuclear transport factor 2-like         178   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW61931.1|  hypothetical protein EUGRSUZ_H04629                     177   2e-53   Eucalyptus grandis [rose gum]
gb|ABR18341.1|  unknown                                                 177   2e-53   Picea sitchensis
ref|XP_010235339.1|  PREDICTED: nuclear transport factor 2              176   4e-53   Brachypodium distachyon [annual false brome]
ref|XP_001765346.1|  predicted protein                                  176   4e-53   
gb|KJB69325.1|  hypothetical protein B456_011G016400                    176   6e-53   Gossypium raimondii
emb|CDO99715.1|  unnamed protein product                                176   8e-53   Coffea canephora [robusta coffee]
ref|XP_001753949.1|  predicted protein                                  175   1e-52   
gb|KJB30874.1|  hypothetical protein B456_005G165500                    174   1e-52   Gossypium raimondii
gb|KJB30876.1|  hypothetical protein B456_005G165500                    174   1e-52   Gossypium raimondii
ref|XP_006826470.1|  hypothetical protein AMTR_s00004p00233810          175   3e-52   
ref|XP_008224788.1|  PREDICTED: nuclear transport factor 2              173   5e-52   Prunus mume [ume]
ref|XP_004293267.1|  PREDICTED: nuclear transport factor 2              173   5e-52   Fragaria vesca subsp. vesca
ref|XP_007214294.1|  hypothetical protein PRUPE_ppb011119mg             173   7e-52   
ref|XP_009357411.1|  PREDICTED: nuclear transport factor 2-like         173   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_010926831.1|  PREDICTED: nuclear transport factor 2 isofor...    172   7e-52   Elaeis guineensis
ref|XP_002444696.1|  hypothetical protein SORBIDRAFT_07g026170          173   8e-52   Sorghum bicolor [broomcorn]
ref|XP_008384036.1|  PREDICTED: nuclear transport factor 2-like         172   2e-51   Malus domestica [apple tree]
ref|NP_001062338.1|  Os08g0532300                                       171   3e-51   
ref|XP_008349288.1|  PREDICTED: nuclear transport factor 2-like         171   4e-51   
ref|XP_009769269.1|  PREDICTED: nuclear transport factor 2              171   5e-51   Nicotiana sylvestris
gb|EPS58345.1|  hypothetical protein M569_16470                         170   6e-51   Genlisea aurea
ref|XP_007025997.1|  NTF2-like                                          170   9e-51   Theobroma cacao [chocolate]
ref|XP_002518524.1|  nuclear transport factor, putative                 169   3e-50   Ricinus communis
ref|XP_004232740.1|  PREDICTED: nuclear transport factor 2              169   4e-50   Solanum lycopersicum
ref|XP_010926828.1|  PREDICTED: nuclear transport factor 2 isofor...    168   5e-50   Elaeis guineensis
ref|XP_006348083.1|  PREDICTED: nuclear transport factor 2-like         168   6e-50   Solanum tuberosum [potatoes]
ref|XP_009759023.1|  PREDICTED: nuclear transport factor 2-like         169   7e-50   Nicotiana sylvestris
gb|KHG02820.1|  Nuclear transport factor 2 -like protein                167   2e-49   Gossypium arboreum [tree cotton]
ref|XP_009589959.1|  PREDICTED: nuclear transport factor 2              166   4e-49   Nicotiana tomentosiformis
gb|KDP20787.1|  hypothetical protein JCGZ_21258                         165   8e-49   Jatropha curcas
ref|XP_006438005.1|  hypothetical protein CICLE_v10033081mg             164   1e-48   
ref|XP_011086173.1|  PREDICTED: nuclear transport factor 2              164   2e-48   Sesamum indicum [beniseed]
ref|XP_002267081.2|  PREDICTED: nuclear transport factor 2              164   2e-48   
ref|XP_008803212.1|  PREDICTED: nuclear transport factor 2              164   2e-48   Phoenix dactylifera
ref|XP_010533830.1|  PREDICTED: nuclear transport factor 2              164   4e-48   
ref|XP_002317209.2|  hypothetical protein POPTR_0011s00470g             163   1e-47   
ref|XP_006449086.1|  hypothetical protein CICLE_v10016912mg             164   2e-47   
ref|XP_010930886.1|  PREDICTED: nuclear transport factor 2-like         162   2e-47   Elaeis guineensis
ref|XP_004145100.1|  PREDICTED: nuclear transport factor 2-like         162   2e-47   
ref|XP_006644825.1|  PREDICTED: nuclear transport factor 2-like         162   3e-47   Oryza brachyantha
dbj|BAK07582.1|  predicted protein                                      162   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006467992.1|  PREDICTED: nuclear transport factor 2-like         161   3e-47   Citrus sinensis [apfelsine]
ref|XP_004153658.1|  PREDICTED: nuclear transport factor 2-like         161   3e-47   Cucumis sativus [cucumbers]
ref|XP_011000696.1|  PREDICTED: nuclear transport factor 2              162   4e-47   Populus euphratica
ref|XP_010665517.1|  PREDICTED: nuclear transport factor 2              160   5e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008441397.1|  PREDICTED: nuclear transport factor 2              160   5e-47   Cucumis melo [Oriental melon]
ref|NP_001044479.1|  Os01g0788200                                       160   8e-47   
ref|XP_003564383.1|  PREDICTED: nuclear transport factor 2-like         160   9e-47   Brachypodium distachyon [annual false brome]
gb|EMT17766.1|  Nuclear transport factor 2                              160   1e-46   
ref|XP_009601176.1|  PREDICTED: nuclear transport factor 2-like i...    159   1e-46   Nicotiana tomentosiformis
emb|CDM84518.1|  unnamed protein product                                159   3e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004970220.1|  PREDICTED: nuclear transport factor 2-like         161   6e-46   Setaria italica
ref|XP_010052820.1|  PREDICTED: nuclear transport factor 2              158   6e-46   
ref|XP_009110722.1|  PREDICTED: nuclear transport factor 2              157   1e-45   Brassica rapa
ref|XP_011397956.1|  Nuclear transport factor 2                         157   2e-45   Auxenochlorella protothecoides
gb|KDO81863.1|  hypothetical protein CISIN_1g033259mg                   155   2e-45   Citrus sinensis [apfelsine]
ref|XP_009601175.1|  PREDICTED: nuclear transport factor 2-like i...    155   3e-45   Nicotiana tomentosiformis
gb|EMS66303.1|  Nuclear transport factor 2                              156   4e-45   Triticum urartu
emb|CDY57043.1|  BnaC08g14980D                                          155   5e-45   Brassica napus [oilseed rape]
tpg|DAA57309.1|  TPA: hypothetical protein ZEAMMB73_859508              155   1e-44   
ref|XP_010458557.1|  PREDICTED: nuclear transport factor 2-like i...    154   2e-44   
ref|XP_010458556.1|  PREDICTED: nuclear transport factor 2-like i...    154   2e-44   
ref|XP_006304291.1|  hypothetical protein CARUB_v10010585mg             153   6e-44   
ref|XP_010492974.1|  PREDICTED: nuclear transport factor 2-like         152   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003687149.1|  hypothetical protein TPHA_0I02110                  152   1e-43   Tetrapisispora phaffii CBS 4417
ref|NP_001154326.1|  nuclear transport factor 2-like protein            152   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417345.1|  hypothetical protein EUTSA_v10010016mg             152   2e-43   Eutrema salsugineum [saltwater cress]
ref|NP_984109.1|  ADR013Wp                                              151   2e-43   Eremothecium gossypii ATCC 10895
ref|XP_008674948.1|  PREDICTED: uncharacterized protein LOC103651127    154   4e-43   
ref|XP_010101476.1|  Nuclear transport factor 2                         150   4e-43   Morus notabilis
gb|ACN33761.1|  unknown                                                 151   4e-43   Zea mays [maize]
ref|XP_004173691.1|  PREDICTED: nuclear transport factor 2-like         150   4e-43   
ref|XP_002889874.1|  T23J18.22                                          158   2e-42   
gb|AGO11785.1|  AaceriADR013Wp                                          149   2e-42   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_002954251.1|  hypothetical protein VOLCADRAFT_76233              148   3e-42   Volvox carteri f. nagariensis
emb|CCK72705.1|  hypothetical protein KNAG_0L00840                      147   1e-41   Kazachstania naganishii CBS 8797
ref|XP_447218.1|  hypothetical protein                                  146   2e-41   [Candida] glabrata
ref|XP_005847428.1|  hypothetical protein CHLNCDRAFT_134320             145   3e-41   Chlorella variabilis
ref|XP_003646328.1|  hypothetical protein Ecym_4471                     146   3e-41   Eremothecium cymbalariae DBVPG#7215
emb|CDO93876.1|  unnamed protein product                                145   3e-41   Kluyveromyces dobzhanskii CBS 2104
ref|XP_002456464.1|  hypothetical protein SORBIDRAFT_03g036780          146   3e-41   
emb|CDF91739.1|  ZYBA0S13-02454g1_1                                     144   1e-40   Zygosaccharomyces bailii CLIB 213
ref|XP_001643859.1|  hypothetical protein Kpol_499p29                   144   1e-40   Vanderwaltozyma polyspora DSM 70294
gb|KIZ07699.1|  Nuclear transport factor 2                              144   1e-40   Monoraphidium neglectum
ref|XP_003683389.1|  hypothetical protein TDEL_0H03190                  144   1e-40   Torulaspora delbrueckii
gb|EMS56705.1|  Nuclear transport factor 2                              144   1e-40   Triticum urartu
gb|AAF16635.1|AC011661_13  T23J18.22                                    153   1e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO41027.1|  nuclear transport factor 2                             144   2e-40   Kluyveromyces marxianus DMKU3-1042
gb|EHN02800.1|  Ntf2p                                                   144   2e-40   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_005644363.1|  nuclear transport factor 2                         144   2e-40   Coccomyxa subellipsoidea C-169
ref|XP_453665.1|  hypothetical protein                                  143   3e-40   Kluyveromyces lactis
ref|XP_001700802.1|  hypothetical protein CHLREDRAFT_113074             142   5e-40   Chlamydomonas reinhardtii
gb|EMT05655.1|  Nuclear transport factor 2                              144   5e-40   
ref|XP_003959797.1|  hypothetical protein KAFR_0L00550                  142   5e-40   Kazachstania africana CBS 2517
emb|CEP60375.1|  LALA0S01e09296g1_1                                     142   7e-40   Lachancea lanzarotensis
ref|XP_011103155.1|  ntf2p                                              142   1e-39   
ref|NP_010925.1|  Ntf2p                                                 142   1e-39   Saccharomyces cerevisiae S288C
ref|XP_002498169.1|  ZYRO0G03894p                                       141   2e-39   Zygosaccharomyces rouxii
ref|XP_004177428.1|  hypothetical protein TBLA_0A01090                  141   2e-39   Tetrapisispora blattae CBS 6284
pdb|1GY7|A  Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2             141   2e-39   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_003678085.1|  hypothetical protein NCAS_0I00720                  141   2e-39   Naumovozyma castellii CBS 4309
ref|XP_001833727.1|  nuclear transport factor 2                         140   4e-39   Coprinopsis cinerea okayama7#130
emb|CDR46057.1|  CYFA0S21e01794g1_1                                     139   8e-39   Cyberlindnera fabianii
ref|XP_002554769.1|  KLTH0F13354p                                       139   9e-39   Lachancea thermotolerans CBS 6340
gb|EME41775.1|  hypothetical protein DOTSEDRAFT_73992                   139   9e-39   Dothistroma septosporum NZE10
ref|XP_005773382.1|  hypothetical protein EMIHUDRAFT_415819             139   1e-38   Emiliania huxleyi CCMP1516
gb|EEQ42220.1|  nuclear transport factor 2                              139   1e-38   Candida albicans WO-1
ref|XP_002417594.1|  nuclear transport factor 2, putative               139   2e-38   Candida dubliniensis CD36
ref|XP_001382549.1|  hypothetical protein PICST_70878                   138   3e-38   Scheffersomyces stipitis CBS 6054
ref|XP_002776831.1|  Nuclear transport factor, putative                 138   3e-38   Perkinsus marinus ATCC 50983
emb|CCE44595.1|  hypothetical protein CPAR2_403980                      138   3e-38   Candida parapsilosis
ref|XP_007780203.1|  nuclear transport factor 2                         138   4e-38   Coniosporium apollinis CBS 100218
ref|XP_003866378.1|  Ntf2 nuclear envelope protein                      137   4e-38   Candida orthopsilosis Co 90-125
ref|XP_007863703.1|  nuclear transport factor 2                         137   5e-38   Gloeophyllum trabeum ATCC 11539
emb|CEG84495.1|  Putative Nuclear transport factor 2                    137   5e-38   Rhizopus microsporus
ref|XP_003668228.1|  hypothetical protein NDAI_0A08320                  137   8e-38   Naumovozyma dairenensis CBS 421
ref|XP_005822283.1|  hypothetical protein GUITHDRAFT_79942              137   9e-38   Guillardia theta CCMP2712
ref|XP_002619423.1|  nuclear transport factor 2                         138   1e-37   Clavispora lusitaniae ATCC 42720
ref|XP_003036222.1|  hypothetical protein SCHCODRAFT_14583              137   1e-37   Schizophyllum commune H4-8
ref|XP_007375570.1|  hypothetical protein SPAPADRAFT_61370              136   1e-37   Spathaspora passalidarum NRRL Y-27907
ref|XP_001713065.1|  nuclear transport factor Nxt2                      136   2e-37   
ref|XP_004199695.1|  Piso0_002236                                       136   2e-37   
ref|XP_005708848.1|  nuclear transport factor, putative                 137   2e-37   Galdieria sulphuraria
gb|KIL68554.1|  hypothetical protein M378DRAFT_190953                   136   2e-37   Amanita muscaria Koide BX008
ref|XP_002493360.1|  Nuclear envelope protein, interacts with GDP...    135   2e-37   Komagataella phaffii GS115
ref|XP_004198845.1|  Piso0_002236                                       135   3e-37   
ref|XP_002374735.1|  nuclear transport factor NTF-2, putative           135   3e-37   Aspergillus flavus NRRL3357
gb|EMF11233.1|  nuclear transport factor 2                              135   3e-37   Sphaerulina musiva SO2202
ref|XP_004339793.1|  nuclear transport factor 2, putative               135   3e-37   Acanthamoeba castellanii str. Neff
ref|XP_457499.1|  DEHA2B12518p                                          135   4e-37   Debaryomyces hansenii CBS767
ref|XP_006689538.1|  nuclear transport factor 2                         135   5e-37   Yamadazyma tenuis ATCC 10573
gb|ESW97241.1|  Nuclear transport factor 2                              135   5e-37   Ogataea parapolymorpha DL-1
gb|KEQ88771.1|  putative nuclear transport factor NTF-2                 135   5e-37   Aureobasidium pullulans EXF-150
ref|XP_001878542.1|  predicted protein                                  135   6e-37   Laccaria bicolor S238N-H82
ref|XP_002850678.1|  nuclear transport factor 2                         134   9e-37   Microsporum canis CBS 113480
ref|XP_009542210.1|  hypothetical protein HETIRDRAFT_432146             134   9e-37   Heterobasidion irregulare TC 32-1
gb|KEQ65704.1|  putative nuclear transport factor NTF-2                 134   1e-36   Aureobasidium melanogenum CBS 110374
emb|CEI88680.1|  Putative Nuclear transport factor 2                    134   1e-36   Rhizopus microsporus
gb|KIK03823.1|  hypothetical protein K443DRAFT_676481                   134   1e-36   Laccaria amethystina LaAM-08-1
emb|CCM05030.1|  predicted protein                                      134   1e-36   Fibroporia radiculosa
gb|EPX70704.1|  nuclear transport factor Nxt2                           134   1e-36   Schizosaccharomyces octosporus yFS286
emb|CEG68727.1|  Putative Nuclear transport factor 2                    134   2e-36   Rhizopus microsporus
gb|KII89267.1|  hypothetical protein PLICRDRAFT_698354                  133   2e-36   Plicaturopsis crispa FD-325 SS-3
ref|XP_007877576.1|  hypothetical protein PFL1_01873                    133   2e-36   Anthracocystis flocculosa PF-1
gb|KEQ97267.1|  hypothetical protein AUEXF2481DRAFT_78074               133   2e-36   Aureobasidium subglaciale EXF-2481
ref|XP_008037000.1|  nuclear transport factor 2                         133   3e-36   Trametes versicolor FP-101664 SS1
gb|KIN02108.1|  hypothetical protein OIDMADRAFT_18825                   133   3e-36   Oidiodendron maius Zn
gb|KEQ69134.1|  putative nuclear transport factor NTF-2                 133   3e-36   Aureobasidium namibiae CBS 147.97
gb|KIK95962.1|  hypothetical protein PAXRUDRAFT_826480                  133   3e-36   Paxillus rubicundulus Ve08.2h10
dbj|GAD99155.1|  nuclear transport factor 2                             133   3e-36   Byssochlamys spectabilis No. 5
gb|EPY51865.1|  nuclear transport factor Nxt2                           132   4e-36   Schizosaccharomyces cryophilus OY26
ref|XP_007300386.1|  nuclear transport factor 2                         132   4e-36   
gb|KHJ32352.1|  putative nuclear transport factor 2                     132   7e-36   
gb|EMS25154.1|  nuclear transport factor 2                              131   1e-35   
gb|EMG49613.1|  hypothetical protein G210_5581                          138   1e-35   
ref|XP_662546.1|  hypothetical protein AN4942.2                         131   1e-35   
gb|KJB57710.1|  hypothetical protein B456_009G176600                    132   1e-35   
dbj|GAM88017.1|  hypothetical protein ANO11243_060460                   131   2e-35   
ref|XP_002143306.1|  nuclear transport factor NTF-2, putative           131   2e-35   
ref|XP_003855723.1|  nuclear transport factor 2                         131   2e-35   
ref|XP_002771235.1|  Nuclear transport factor, putative                 131   2e-35   
gb|KIW97990.1|  hypothetical protein Z519_01574                         131   2e-35   
ref|XP_007297556.1|  nuclear transport factor 2                         130   3e-35   
gb|EPS98590.1|  hypothetical protein FOMPIDRAFT_1024593                 130   3e-35   
ref|XP_007932192.1|  hypothetical protein MYCFIDRAFT_89255              130   3e-35   
emb|CCG82283.1|  Nuclear transport factor 2                             130   3e-35   
gb|ABY27173.1|  nuclear transport factor 2                              130   3e-35   
gb|KDQ33934.1|  hypothetical protein PLEOSDRAFT_1052734                 130   4e-35   
ref|XP_011389172.1|  putative nuclear transport factor                  130   4e-35   
ref|XP_003238342.1|  nuclear transport factor 2                         130   4e-35   
ref|XP_002764514.1|  Nuclear transport factor, putative                 130   5e-35   
dbj|GAN11240.1|  nuclear transport factor 2                             130   6e-35   
gb|KDE06949.1|  nuclear transport factor 2                              130   6e-35   
gb|EIF49906.1|  nuclear transport factor 2                              129   6e-35   
gb|KIW40233.1|  nuclear transport factor 2                              129   7e-35   
gb|KIR58119.1|  nuclear transport factor 2                              129   7e-35   
gb|KIP10297.1|  hypothetical protein PHLGIDRAFT_18352                   129   9e-35   
gb|KIM55917.1|  hypothetical protein SCLCIDRAFT_1220748                 129   1e-34   
ref|XP_001213756.1|  nuclear transport factor 2                         129   1e-34   
gb|EGD94981.1|  nuclear transport factor 2                              129   1e-34   
gb|EGE06204.1|  nuclear transport factor 2                              129   1e-34   
ref|XP_005539421.1|  similar to nuclear transport factor 2              129   1e-34   
ref|XP_007760877.1|  nuclear transport factor 2                         129   1e-34   
ref|XP_001631309.1|  predicted protein                                  129   1e-34   
ref|XP_003177101.1|  nuclear transport factor 2                         129   2e-34   
ref|XP_001271051.1|  nuclear transport factor NTF-2, putative           128   2e-34   
gb|ACG33145.1|  nuclear transport factor 2                              127   2e-34   
gb|EPB91169.1|  nuclear transport factor 2                              128   2e-34   
gb|EMD34408.1|  hypothetical protein CERSUDRAFT_86529                   128   2e-34   
ref|XP_007364724.1|  nuclear transport factor 2                         128   2e-34   
ref|XP_005828487.1|  hypothetical protein GUITHDRAFT_74696              128   2e-34   
ref|XP_002173630.1|  nuclear transport factor Nxt2                      128   3e-34   
gb|KIR44189.1|  nuclear transport factor 2                              128   3e-34   
gb|KIW64329.1|  hypothetical protein PV04_09272                         127   3e-34   
ref|XP_002479611.1|  nuclear transport factor NTF-2, putative           127   5e-34   
gb|KEH38140.1|  nuclear transport factor 2                              127   5e-34   
ref|XP_007875411.1|  hypothetical protein PNEG_03333                    127   7e-34   
emb|CBQ72991.1|  probable NTF2-nuclear transport factor                 127   8e-34   
gb|KIK17023.1|  hypothetical protein PISMIDRAFT_685758                  126   9e-34   
gb|ETS64815.1|  hypothetical protein PaG_00781                          126   1e-33   
ref|XP_009153133.1|  nuclear transport factor 2                         126   1e-33   
gb|EKG20228.1|  Nuclear transport factor 2                              126   1e-33   
ref|XP_007579607.1|  putative nuclear transport factor 2 protein        126   1e-33   
gb|KIK54562.1|  hypothetical protein GYMLUDRAFT_100055                  126   1e-33   
ref|XP_008371118.1|  PREDICTED: nuclear transport factor 2-like         125   1e-33   
dbj|GAM39955.1|  nuclear transport factor                               126   2e-33   
ref|XP_008029603.1|  hypothetical protein SETTUDRAFT_165007             126   2e-33   
gb|KIX08284.1|  hypothetical protein Z518_02940                         126   2e-33   
gb|KIJ17119.1|  hypothetical protein PAXINDRAFT_162073                  125   2e-33   
gb|EIE88363.1|  hypothetical protein RO3G_13074                         125   2e-33   
emb|CDI53471.1|  probable NTF2-nuclear transport factor                 125   2e-33   
emb|CCU97934.1|  unnamed protein product                                125   2e-33   
ref|XP_754573.1|  nuclear transport factor NTF-2                        125   2e-33   
emb|CCF52832.1|  probable NTF2-nuclear transport factor                 125   3e-33   
dbj|GAC94158.1|  hypothetical protein PHSY_001727                       125   3e-33   
ref|XP_001798316.1|  hypothetical protein SNOG_07989                    125   3e-33   
ref|XP_001731993.1|  hypothetical protein MGL_1261                      126   3e-33   
emb|CCJ28967.1|  unnamed protein product                                125   3e-33   
gb|KJA20289.1|  hypothetical protein HYPSUDRAFT_142469                  125   3e-33   
sp|Q8NJ52.1|NTF2_DAVTA  RecName: Full=Nuclear transport factor 2;...    125   4e-33   
gb|EZF30526.1|  nuclear transport factor 2                              125   4e-33   
gb|KIW60329.1|  hypothetical protein PV05_00556                         125   4e-33   
gb|KEY78051.1|  nuclear transport factor NTF 2                          125   4e-33   
gb|EJU05520.1|  nuclear transport factor NTF-2                          125   5e-33   
gb|KIY48332.1|  nuclear transport factor 2                              124   5e-33   
ref|XP_009256038.1|  hypothetical protein FPSE_04645                    124   5e-33   
dbj|GAK64474.1|  nuclear transport factor 2                             125   5e-33   
ref|XP_011277299.1|  Nuclear transport factor 2                         124   8e-33   
gb|AEH41553.1|  nuclear transport factor 2                              124   9e-33   
ref|XP_006681297.1|  hypothetical protein BATDEDRAFT_90859              124   9e-33   
emb|CCE30050.1|  probable nuclear transport factor 2 (ntf-2)            124   1e-32   
ref|XP_007846412.1|  nuclear transport factor 2                         124   1e-32   
gb|KDR81855.1|  hypothetical protein GALMADRAFT_240106                  124   1e-32   
ref|XP_008371119.1|  PREDICTED: nuclear transport factor 2-like         123   1e-32   
ref|XP_625664.1|  hypothetical protein                                  124   1e-32   
ref|XP_003053011.1|  predicted protein                                  124   1e-32   
ref|XP_003056455.1|  nuclear transport factor 2                         124   2e-32   
gb|KIO04070.1|  hypothetical protein M404DRAFT_15588                    123   2e-32   
ref|XP_007599662.1|  nuclear transport factor 2                         123   2e-32   
ref|XP_007286053.1|  nuclear transport factor 2                         123   2e-32   
emb|CAD38167.1|  putative nuclear transport factor 2                    123   2e-32   
gb|EPS29771.1|  hypothetical protein PDE_04721                          123   2e-32   
gb|KIV94000.1|  hypothetical protein PV10_05165                         123   2e-32   
ref|XP_003074377.1|  RasGAP SH3 binding protein rasputin, contain...    124   2e-32   
emb|CEP19186.1|  hypothetical protein                                   123   2e-32   
ref|XP_003021355.1|  hypothetical protein TRV_04510                     124   2e-32   
ref|XP_001592408.1|  nuclear transport factor 2                         123   2e-32   
emb|CEJ91001.1|  Putative Nuclear transport factor 2 domain-conta...    123   2e-32   
gb|ERZ94543.1|  hypothetical protein GLOINDRAFT_341714                  123   2e-32   
ref|XP_007911526.1|  putative nuclear transport factor 2 protein        123   3e-32   
ref|XP_007740698.1|  nuclear transport factor 2                         122   3e-32   
gb|EGU75360.1|  hypothetical protein FOXB_14121                         122   3e-32   
ref|XP_007837099.1|  Nuclear transport factor 2                         122   3e-32   
gb|KIW08308.1|  nuclear transport factor 2                              122   4e-32   
gb|KID78136.1|  nuclear transport factor 2                              122   4e-32   
ref|XP_007722005.1|  nuclear transport factor 2                         122   4e-32   
gb|KID92842.1|  nuclear transport factor 2                              122   4e-32   
gb|ESZ94013.1|  nuclear transport factor 2                              122   4e-32   
ref|XP_007396304.1|  hypothetical protein PHACADRAFT_257005             122   4e-32   
emb|CCT70756.1|  probable nuclear transport factor 2 (ntf-2)            122   5e-32   
ref|XP_003664240.1|  hypothetical protein MYCTH_2306840                 122   5e-32   
ref|XP_005711458.1|  Nuclear transport factor 2                         122   6e-32   
ref|XP_003650599.1|  hypothetical protein THITE_2169643                 122   6e-32   
ref|XP_006449085.1|  hypothetical protein CICLE_v10016912mg             123   6e-32   
gb|EIE85308.1|  hypothetical protein RO3G_10018                         122   6e-32   
ref|XP_008716731.1|  hypothetical protein HMPREF1541_04163              122   7e-32   
gb|KIM49494.1|  hypothetical protein M413DRAFT_438679                   122   7e-32   
emb|CDH59895.1|  ntf2p                                                  122   8e-32   
gb|ENH86073.1|  nuclear transport factor 2                              121   8e-32   
ref|NP_172623.1|  nuclear transport factor 2-like protein               122   8e-32   
emb|CEF76833.1|  unnamed protein product                                123   9e-32   
gb|EST05575.1|  hypothetical protein PSEUBRA_SCAF5g02416                130   9e-32   
ref|XP_001558550.1|  nuclear transport factor 2                         121   1e-31   
emb|CCF47766.1|  nuclear transport factor 2                             121   1e-31   
ref|XP_003834538.1|  hypothetical protein LEMA_P062070.1                125   1e-31   
ref|XP_008730206.1|  hypothetical protein G647_07671                    121   1e-31   
ref|XP_001905978.1|  hypothetical protein                               120   2e-31   
ref|XP_009654668.1|  nuclear transport factor 2                         120   2e-31   
gb|KEY67666.1|  hypothetical protein S7711_03919                        120   2e-31   
ref|XP_007818462.2|  nuclear transport factor 2                         120   2e-31   
gb|KDQ59639.1|  hypothetical protein JAAARDRAFT_175095                  120   2e-31   
gb|EYE94560.1|  putative nuclear transport factor NTF-2                 120   2e-31   
gb|KIL91899.1|  hypothetical protein FAVG1_04302                        120   2e-31   
ref|XP_002895567.1|  nuclear transport factor, putative                 120   3e-31   
ref|XP_007703125.1|  hypothetical protein COCSADRAFT_39867              120   3e-31   
gb|EMR89047.1|  putative nuclear transport factor 2 protein             120   3e-31   
gb|EEH39665.2|  hypothetical protein PAAG_01854                         120   4e-31   
gb|EGN96251.1|  hypothetical protein SERLA73DRAFT_125076                120   4e-31   
gb|KGB78439.1|  nuclear transport factor 2                              120   4e-31   
gb|KHO01693.1|  Nuclear transport factor 2                              120   4e-31   
gb|EFQ35456.1|  nuclear transport factor 2 domain-containing protein    120   4e-31   
gb|KDN65936.1|  putative nuclear transport factor 2 domain-contai...    120   4e-31   
gb|KDB12808.1|  nuclear transport factor 2                              120   4e-31   
ref|XP_002795966.1|  hypothetical protein PAAG_01854                    119   5e-31   
ref|XP_007707838.1|  hypothetical protein COCCADRAFT_32994              119   5e-31   
ref|XP_008908711.1|  hypothetical protein PPTG_13975                    119   5e-31   
gb|KFY39800.1|  hypothetical protein V494_03837                         124   5e-31   
gb|KFY14969.1|  hypothetical protein V492_02308                         124   6e-31   
ref|XP_572414.1|  nuclear transport factor 2 (ntf-2)                    119   6e-31   
ref|XP_007264265.1|  nuclear transport factor 2                         119   6e-31   
ref|XP_001244179.1|  hypothetical protein CIMG_03620                    119   7e-31   
gb|EEH04933.1|  nuclear transport factor 2                              119   1e-30   
gb|EMD89412.1|  hypothetical protein COCHEDRAFT_1181000                 119   1e-30   
emb|CDM28803.1|  Nuclear transport factor 2                             119   1e-30   
emb|CDS12433.1|  hypothetical protein LRAMOSA04627                      118   1e-30   
gb|EKV05853.1|  Nuclear transport factor NTF-2, putative                118   1e-30   
gb|EXX59492.1|  Ntf2p                                                   118   1e-30   
dbj|GAC71846.1|  hypothetical protein PANT_5d00100                      119   2e-30   
ref|XP_007511796.1|  nuclear transport factor 2                         118   2e-30   
ref|XP_002183658.1|  predicted protein                                  117   3e-30   
gb|KIW11972.1|  hypothetical protein PV08_09246                         126   3e-30   
ref|XP_501730.1|  YALI0C11605p                                          117   3e-30   
gb|KIW86031.1|  hypothetical protein Z517_01425                         126   3e-30   
gb|KDN53288.1|  nuclear transport factor 2                              117   3e-30   
ref|XP_007321576.1|  hypothetical protein SERLADRAFT_397162             117   4e-30   
ref|XP_006669697.1|  nuclear transport factor 2                         117   5e-30   
gb|AAF70316.1|AF260231_1  Rph1                                          117   6e-30   
ref|XP_007798336.1|  putative nuclear transport factor 2 protein        117   6e-30   
ref|XP_002290343.1|  hypothetical protein THAPSDRAFT_22822              116   7e-30   
gb|KIV87545.1|  hypothetical protein PV11_03084                         117   7e-30   
ref|XP_001415545.1|  predicted protein                                  116   8e-30   
gb|AFR99024.1|  nuclear transport factor 2                              116   1e-29   
ref|XP_010756711.1|  hypothetical protein PADG_11111                    117   1e-29   
gb|KIO23371.1|  hypothetical protein M407DRAFT_244800                   116   1e-29   
gb|KIY03781.1|  hypothetical protein Z520_00472                         124   1e-29   
gb|KFY27400.1|  hypothetical protein V493_03507                         119   2e-29   
ref|XP_002507075.1|  nuclear transport factor 2                         115   2e-29   
ref|XP_002582620.1|  nuclear transport factor 2                         119   3e-29   
gb|KIR83961.1|  nuclear transport factor 2                              115   3e-29   
ref|XP_009854072.1|  hypothetical protein NEUTE1DRAFT_118048            114   4e-29   
gb|KFY67620.1|  hypothetical protein V496_01511                         115   4e-29   
ref|XP_009530658.1|  hypothetical protein PHYSODRAFT_286573             114   4e-29   
ref|XP_002559465.1|  Pc13g10440                                         114   4e-29   
gb|KIJ69654.1|  hypothetical protein HYDPIDRAFT_106304                  114   4e-29   
gb|KFA68224.1|  hypothetical protein S40285_01614                       114   5e-29   
gb|KFY10763.1|  hypothetical protein V491_07484                         119   6e-29   
ref|XP_007345768.1|  nuclear transport factor 2                         114   6e-29   
gb|ELR01733.1|  hypothetical protein GMDG_00109                         113   1e-28   
gb|KFY37093.1|  hypothetical protein V495_07381                         113   2e-28   
gb|KDQ12288.1|  hypothetical protein BOTBODRAFT_113274                  113   2e-28   
ref|XP_003197095.1|  nuclear transport factor 2 (ntf-2)                 113   2e-28   
ref|XP_007690713.1|  hypothetical protein COCMIDRAFT_7720               113   2e-28   
gb|EGE80173.1|  nuclear transport factor 2                              112   2e-28   
ref|XP_003353076.1|  hypothetical protein SMAC_03394                    112   2e-28   
ref|XP_006694680.1|  hypothetical protein CTHT_0042790                  112   3e-28   
ref|XP_002140947.1|  nuclear transport factor 2 domain-containing...    112   3e-28   
gb|EER45009.1|  nuclear transport factor 2                              112   3e-28   
gb|KFX88106.1|  hypothetical protein V490_07829                         113   4e-28   
ref|XP_002622015.1|  nuclear transport factor 2                         112   5e-28   
emb|CDO68890.1|  hypothetical protein BN946_scf185000.g33               117   7e-28   
ref|XP_002549051.1|  nuclear transport factor 2                         110   7e-28   
ref|XP_007680142.1|  hypothetical protein BAUCODRAFT_125801             111   7e-28   
ref|XP_003333128.1|  hypothetical protein PGTG_14675                    111   1e-27   
ref|XP_002677191.1|  nuclear transport factor 2                         110   1e-27   
gb|KFZ09171.1|  hypothetical protein V502_08902                         114   2e-27   
ref|XP_001486113.1|  nuclear transport factor 2                         108   2e-27   
ref|XP_007764949.1|  nuclear transport factor 2                         110   3e-27   
gb|KFY85195.1|  hypothetical protein V500_08615                         114   4e-27   
gb|KFY71578.1|  hypothetical protein V499_08238                         114   4e-27   
gb|EWM27142.1|  nuclear transport                                       109   4e-27   
ref|XP_001528019.1|  nuclear transport factor 2                         108   5e-27   
gb|KEF55350.1|  nuclear transport factor 2                              108   6e-27   
gb|KFY88990.1|  hypothetical protein V498_06578                         113   8e-27   
ref|XP_010025299.1|  PREDICTED: nuclear transport factor 2-like         109   8e-27   
ref|XP_003284316.1|  hypothetical protein DICPUDRAFT_27457              108   1e-26   
ref|XP_011127125.1|  hypothetical protein AOL_s00210g21                 108   1e-26   
gb|KEZ38828.1|  hypothetical protein SAPIO_CDS10871                     108   1e-26   
ref|XP_001397751.1|  nuclear transport factor 2                         108   1e-26   
emb|CCA66868.1|  related to nuclear transport factor                    108   1e-26   
gb|KFH40968.1|  Nuclear transport factor-like protein                   108   2e-26   
ref|XP_007004979.1|  hypothetical protein TREMEDRAFT_39381              107   4e-26   
gb|EXX59491.1|  Ntf2p                                                   107   4e-26   



>ref|XP_008222183.1| PREDICTED: nuclear transport factor 2 [Prunus mume]
Length=123

 Score =   241 bits (614),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD+LAKAFVEHYY++FD+NRGAL +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDSLAKAFVEHYYTLFDANRGALANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004310092.1| PREDICTED: nuclear transport factor 2 [Fragaria vesca subsp. 
vesca]
Length=123

 Score =   240 bits (613),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FDSNR AL +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSQFDSNRAALANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_007223428.1| hypothetical protein PRUPE_ppa013422mg [Prunus persica]
 gb|EMJ24627.1| hypothetical protein PRUPE_ppa013422mg [Prunus persica]
Length=123

 Score =   240 bits (612),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY++FD+NRGAL +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDSVAKAFVEHYYTLFDANRGALANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_011098902.1| PREDICTED: nuclear transport factor 2-like [Sesamum indicum]
Length=123

 Score =   236 bits (602),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQD SMLTFEGQKI GSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGQKIMGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QHAITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHAITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010556126.1| PREDICTED: nuclear transport factor 2-like [Tarenaya hassleriana]
Length=123

 Score =   236 bits (602),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDANRAGLASLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQL+GEQHALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLSGEQHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010531125.1| PREDICTED: nuclear transport factor 2 [Tarenaya hassleriana]
Length=123

 Score =   235 bits (600),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQG+QNIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDANRAGLASLYQEGSMLTFEGQKIQGAQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHAL+FSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALRFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_008389878.1| PREDICTED: nuclear transport factor 2-like [Malus domestica]
 ref|XP_009343147.1| PREDICTED: nuclear transport factor 2 [Pyrus x bretschneideri]
Length=123

 Score =   235 bits (599),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDAL+KAFVEHYY++FD+NRGAL +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDALSKAFVEHYYTLFDANRGALANLYQETSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTQQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_002304677.1| Nuclear transport factor 2 family protein [Populus trichocarpa]
 ref|XP_011020765.1| PREDICTED: nuclear transport factor 2-like [Populus euphratica]
 gb|ABK94425.1| unknown [Populus trichocarpa]
 gb|EEE79656.1| Nuclear transport factor 2 family protein [Populus trichocarpa]
Length=123

 Score =   234 bits (597),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYY+MFDSNR  L +LYQDASMLTFEGQK QGSQNIVAKLT+LPF QC
Sbjct  1    MDPDTVAKAFVEHYYNMFDSNRAGLANLYQDASMLTFEGQKTQGSQNIVAKLTALPFHQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGS+YVYNDIFRL
Sbjct  61   KHHITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSYYVYNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_002276841.1| PREDICTED: nuclear transport factor 2 [Vitis vinifera]
 emb|CAN70316.1| hypothetical protein VITISV_001831 [Vitis vinifera]
Length=123

 Score =   234 bits (597),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ++SMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRANLANLYQESSMLTFEGQKIQGSPNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_006438006.1| hypothetical protein CICLE_v10033081mg [Citrus clementina]
 ref|XP_006484130.1| PREDICTED: nuclear transport factor 2-like [Citrus sinensis]
 gb|ESR51246.1| hypothetical protein CICLE_v10033081mg [Citrus clementina]
 gb|KDO81862.1| hypothetical protein CISIN_1g033259mg [Citrus sinensis]
Length=123

 Score =   233 bits (595),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY+ FD+NR  L +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010044826.1| PREDICTED: nuclear transport factor 2 [Eucalyptus grandis]
 gb|KCW86935.1| hypothetical protein EUGRSUZ_B03507 [Eucalyptus grandis]
Length=123

 Score =   233 bits (594),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NRG L +LYQ+ SMLTFEGQKIQGSQ+IV+KLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRGGLANLYQEGSMLTFEGQKIQGSQSIVSKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQ+FHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQLFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009372264.1| PREDICTED: nuclear transport factor 2-like [Pyrus x bretschneideri]
Length=123

 Score =   233 bits (594),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDAL+KAFVEHYY++FD+NR AL +LYQ++SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDALSKAFVEHYYTLFDANRAALANLYQESSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGP GGMLVFVSG LQL+GEQHALKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPVGGMLVFVSGNLQLSGEQHALKFSQMFHLMPTQQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010025297.1| PREDICTED: nuclear transport factor 2-like [Eucalyptus grandis]
 gb|KCW61928.1| hypothetical protein EUGRSUZ_H04624 [Eucalyptus grandis]
Length=123

 Score =   233 bits (594),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR AL +LYQ+ SMLTFEGQKIQGS +IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAALSNLYQEGSMLTFEGQKIQGSPSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009109763.1| PREDICTED: nuclear transport factor 2-like [Brassica rapa]
 emb|CDX90117.1| BnaA08g18670D [Brassica napus]
Length=126

 Score =   233 bits (594),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            A+MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQGSQNIVAKLTSLPFQ
Sbjct  2    AQMDPDAVAKAFVEHYYSTFDNNRVGLAGLYQEASMLTFEGQKIQGSQNIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_008340231.1| PREDICTED: nuclear transport factor 2 [Malus domestica]
Length=123

 Score =   233 bits (593),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDAL+KAFVEHYY++FD+NR AL +LYQ++SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDALSKAFVEHYYTLFDANRAALANLYQESSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQL+GEQHALKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLSGEQHALKFSQMFHLMPTQQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_002514900.1| nuclear transport factor, putative [Ricinus communis]
 gb|EEF47454.1| nuclear transport factor, putative [Ricinus communis]
Length=123

 Score =   233 bits (593),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L +LYQ+ASMLTFEGQKIQG+QN+VAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDANRAGLANLYQEASMLTFEGQKIQGAQNVVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG L+L GEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLKLTGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KDP26818.1| hypothetical protein JCGZ_17976 [Jatropha curcas]
Length=123

 Score =   231 bits (590),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQD SMLTFEG+KIQGS NIVAKLTSLPF+QC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGEKIQGSPNIVAKLTSLPFKQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHRITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>emb|CDP16704.1| unnamed protein product [Coffea canephora]
Length=123

 Score =   231 bits (588),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L +LYQDASMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDANRAGLSTLYQDASMLTFEGQKIQGSANIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSGPAGGMLVFVSG LQL GE HALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   HHQISTVDCQPSGPAGGMLVFVSGNLQLVGESHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010249046.1| PREDICTED: nuclear transport factor 2-like [Nelumbo nucifera]
Length=123

 Score =   230 bits (586),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD+LAKAFVEHYY+ FD+NR  L +LYQ+ SMLTFEGQKIQGSQNIVA LT LPFQQC
Sbjct  1    MDPDSLAKAFVEHYYTTFDANRAGLANLYQEGSMLTFEGQKIQGSQNIVAHLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KHG11196.1| Nuclear transport factor 2 -like protein [Gossypium arboreum]
 gb|KJB60939.1| hypothetical protein B456_009G332400 [Gossypium raimondii]
Length=122

 Score =   229 bits (584),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 116/123 (94%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L +LYQD SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDANRAGLANLYQDGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSG AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSG-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_011036092.1| PREDICTED: nuclear transport factor 2 isoform X1 [Populus euphratica]
 gb|ABK93835.1| unknown [Populus trichocarpa]
Length=123

 Score =   229 bits (584),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYYS FD+NR  L +LYQD SMLTFEGQK QGSQNIVAKL +LPFQQC
Sbjct  1    MDPDQVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGQKTQGSQNIVAKLIALPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHLITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009113718.1| PREDICTED: nuclear transport factor 2-like [Brassica rapa]
Length=127

 Score =   229 bits (583),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
             A+MDPDA+AKAFVEHYYS FD+NR  LG LYQ+ASMLTFEGQKIQG Q+IV KLTSLPF
Sbjct  2    AAQMDPDAVAKAFVEHYYSTFDNNRVGLGGLYQEASMLTFEGQKIQGVQSIVTKLTSLPF  61

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            QQC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDI
Sbjct  62   QQCKHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDI  121

Query  390  FRLNYA  407
            FRLNYA
Sbjct  122  FRLNYA  127



>ref|XP_006415779.1| hypothetical protein EUTSA_v10008965mg [Eutrema salsugineum]
 gb|ESQ34132.1| hypothetical protein EUTSA_v10008965mg [Eutrema salsugineum]
Length=161

 Score =   230 bits (586),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
             +MDPDA++KAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQ
Sbjct  37   TEMDPDAISKAFVEHYYSTFDANRAGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQ  96

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H ITTVDCQPSGPAGGM+VFVSG LQLAGEQHALKFSQMFHLMPT QGS+YV+NDIF
Sbjct  97   QCKHNITTVDCQPSGPAGGMVVFVSGNLQLAGEQHALKFSQMFHLMPTAQGSYYVHNDIF  156

Query  393  RLNYA  407
            RLNYA
Sbjct  157  RLNYA  161



>emb|CDY48413.1| BnaCnng16260D [Brassica napus]
Length=127

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
             A+MDPDA+AKAFVEHYYS FD+ R  LG LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPF
Sbjct  2    AAQMDPDAVAKAFVEHYYSTFDNTRVGLGGLYQEASMLTFEGQKIQGVQSIVAKLTSLPF  61

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            QQC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDI
Sbjct  62   QQCKHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDI  121

Query  390  FRLNYA  407
            FRLNYA
Sbjct  122  FRLNYA  127



>emb|CDY11757.1| BnaC03g58210D [Brassica napus]
Length=126

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            A+MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKI G QNIVAKLTSLPFQ
Sbjct  2    AQMDPDAVAKAFVEHYYSTFDNNRVGLAGLYQEASMLTFEGQKILGVQNIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_011071236.1| PREDICTED: nuclear transport factor 2-like [Sesamum indicum]
Length=123

 Score =   228 bits (580),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQD+SML+FEG KIQGSQ+I AKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDTNRPGLANLYQDSSMLSFEGLKIQGSQSISAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QHAITTVDCQPSGPAGGMLVFVSG LQLAGEQH LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHAITTVDCQPSGPAGGMLVFVSGNLQLAGEQHPLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KFK44674.1| hypothetical protein AALP_AA1G288800 [Arabis alpina]
Length=126

 Score =   228 bits (580),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            ++MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQ
Sbjct  2    SQMDPDAVAKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_010250681.1| PREDICTED: nuclear transport factor 2 [Nelumbo nucifera]
Length=123

 Score =   227 bits (579),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQG+QNIV  LT LPFQQC
Sbjct  1    MDPDSVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGAQNIVTHLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_011086817.1| PREDICTED: nuclear transport factor 2 [Sesamum indicum]
Length=123

 Score =   227 bits (579),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L +LYQD SML+FEGQK QG+Q+I AKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDTNRAGLANLYQDTSMLSFEGQKFQGTQSITAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHGITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004156943.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus]
Length=173

 Score =   229 bits (583),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
             +MDPDA+AKAFV+HYYS FD+NR  LG+LYQD SMLTFEGQKIQGS NIVAKL+SLPFQ
Sbjct  49   TRMDPDAVAKAFVDHYYSTFDANRANLGNLYQDNSMLTFEGQKIQGSPNIVAKLSSLPFQ  108

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H+++TVDCQPSGP GGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSF+V NDIF
Sbjct  109  QCKHSVSTVDCQPSGPTGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFFVQNDIF  168

Query  393  RLNYA  407
            RLNYA
Sbjct  169  RLNYA  173



>ref|XP_004152114.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus]
 gb|KGN53044.1| hypothetical protein Csa_4G012400 [Cucumis sativus]
Length=173

 Score =   228 bits (582),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
             +MDPDA+AKAFV+HYYS FD+NR  LG+LYQD SMLTFEGQKIQGS NIVAKL+SLPFQ
Sbjct  49   TRMDPDAVAKAFVDHYYSTFDANRANLGNLYQDNSMLTFEGQKIQGSPNIVAKLSSLPFQ  108

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H+++TVDCQPSGP GGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSF+V NDIF
Sbjct  109  QCKHSVSTVDCQPSGPTGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFFVQNDIF  168

Query  393  RLNYA  407
            RLNYA
Sbjct  169  RLNYA  173



>emb|CDY71767.1| BnaCnng74350D [Brassica napus]
Length=123

 Score =   227 bits (578),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDTNRAGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NY+
Sbjct  121  NYS  123



>ref|NP_174118.1| nuclear transport factor 2B [Arabidopsis thaliana]
 sp|Q9C7F5.1|NTF2_ARATH RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Arabidopsis 
thaliana]
 gb|AAG51491.1|AC069471_22 nuclear transport factor 2, putative [Arabidopsis thaliana]
 gb|ABF59016.1| At1g27970 [Arabidopsis thaliana]
 gb|AEE30896.1| nuclear transport factor 2B [Arabidopsis thaliana]
Length=126

 Score =   226 bits (577),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            ++MDPDA++KAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQ
Sbjct  2    SQMDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_009102940.1| PREDICTED: nuclear transport factor 2 [Brassica rapa]
Length=123

 Score =   226 bits (576),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDTNRAGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPA GMLVF+SG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHNISTVDCQPSGPASGMLVFISGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NY+
Sbjct  121  NYS  123



>ref|XP_010540411.1| PREDICTED: nuclear transport factor 2 [Tarenaya hassleriana]
Length=127

 Score =   226 bits (576),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
             A+MDPDA+AKAFVEHYYS FD+NRG L +LYQD+SMLTFEGQKIQG Q+IV+KLTSLPF
Sbjct  2    AAQMDPDAVAKAFVEHYYSTFDTNRGGLANLYQDSSMLTFEGQKIQGVQSIVSKLTSLPF  61

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            QQCQH I+TVDCQPSGPA GMLVFVSG L LAGEQH LKFSQMFHLMP+PQGSFYV NDI
Sbjct  62   QQCQHHISTVDCQPSGPASGMLVFVSGNLLLAGEQHPLKFSQMFHLMPSPQGSFYVQNDI  121

Query  390  FRLNYA  407
            FRLNYA
Sbjct  122  FRLNYA  127



>ref|XP_010905497.1| PREDICTED: nuclear transport factor 2 [Elaeis guineensis]
Length=123

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYY  FD+NR  LGSLYQ+ SMLTFEG K QG+Q IVAKL SLPFQQC
Sbjct  1    MDPDALAKAFVEHYYRTFDTNRAGLGSLYQEGSMLTFEGAKTQGAQAIVAKLISLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH I+TVDCQPSGPAGGMLVFVSG+LQLAGEQH+LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHQISTVDCQPSGPAGGMLVFVSGSLQLAGEQHSLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KEH20612.1| nuclear transport factor 2 [Medicago truncatula]
Length=123

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD LAKAFVEHYY+ FD+NRG L +LYQ+ SMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDVLAKAFVEHYYTTFDNNRGGLATLYQEGSMLTFEGQKIQGSPNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+ITTVDCQPSG  GGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGS+YV NDIFRL
Sbjct  61   HHSITTVDCQPSGANGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSYYVMNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|AAM63803.1| nuclear transport factor 2, putative [Arabidopsis thaliana]
Length=123

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA++KAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|ABL97965.1| putative nuclear transport factor 2 [Brassica rapa]
 emb|CDY15697.1| BnaA07g08680D [Brassica napus]
Length=123

 Score =   225 bits (573),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L   YQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDTNRAGLAGFYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NY+
Sbjct  121  NYS  123



>gb|EYU42085.1| hypothetical protein MIMGU_mgv1a016409mg [Erythranthe guttata]
Length=123

 Score =   224 bits (572),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+A++KAFVEHYYS FD+NRG LGSLYQ++SMLTFEGQK QGSQNI  KLTSLPFQQC
Sbjct  1    MDPEAVSKAFVEHYYSTFDTNRGGLGSLYQESSMLTFEGQKFQGSQNITGKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH I+TVD QPSGP GGMLVFVSG LQL+GEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHHISTVDFQPSGPVGGMLVFVSGNLQLSGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_006305779.1| hypothetical protein CARUB_v10010649mg [Capsella rubella]
 gb|EOA38677.1| hypothetical protein CARUB_v10010649mg [Capsella rubella]
Length=126

 Score =   224 bits (572),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            ++MDPDA++KAFVEHYYS FDSNR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQ
Sbjct  2    SQMDPDAVSKAFVEHYYSTFDSNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+H LKFSQMFHLMPTPQGSFYV NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHTLKFSQMFHLMPTPQGSFYVLNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_008454013.1| PREDICTED: nuclear transport factor 2-like [Cucumis melo]
Length=123

 Score =   224 bits (571),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD LAKAFV+HYYS FD+NR  LG+LYQ+ SMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDTLAKAFVDHYYSTFDANRAGLGNLYQENSMLTFEGQKIQGSTNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ++T+DCQPSGP+GGMLVFVSG LQL GEQHALKFSQMFHLMPTPQGSF+V NDIFRL
Sbjct  61   KHNVSTIDCQPSGPSGGMLVFVSGNLQLVGEQHALKFSQMFHLMPTPQGSFFVQNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_007043966.1| Nuclear transport factor 2B [Theobroma cacao]
 gb|EOX99797.1| Nuclear transport factor 2B [Theobroma cacao]
Length=122

 Score =   224 bits (571),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L +LYQ+ SMLTFEGQKIQG QNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDANRAGLANLYQEGSMLTFEGQKIQGCQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITTVDCQPSG AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   QHNITTVDCQPSG-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTAQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_007158674.1| hypothetical protein PHAVU_002G172900g [Phaseolus vulgaris]
 gb|ESW30668.1| hypothetical protein PHAVU_002G172900g [Phaseolus vulgaris]
Length=123

 Score =   224 bits (571),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD LAKAFVEHYYS FD+NR +L +LYQDASMLTFEGQKIQG+ NIVAKLTSLPFQQC
Sbjct  1    MDPDTLAKAFVEHYYSTFDTNRPSLANLYQDASMLTFEGQKIQGASNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSG  GGMLVFVSG LQLAGEQH LKFSQMFHLMPTPQGS+YV NDIFRL
Sbjct  61   HHTISTVDCQPSGVNGGMLVFVSGNLQLAGEQHTLKFSQMFHLMPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_002890753.1| hypothetical protein ARALYDRAFT_472998 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67012.1| hypothetical protein ARALYDRAFT_472998 [Arabidopsis lyrata subsp. 
lyrata]
Length=123

 Score =   224 bits (570),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA++KAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPA GMLVFVSG LQLAGE+H LKFSQMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   KHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHTLKFSQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_006415711.1| hypothetical protein EUTSA_v10010039mg [Eutrema salsugineum]
 gb|ESQ34064.1| hypothetical protein EUTSA_v10010039mg [Eutrema salsugineum]
Length=126

 Score =   224 bits (570),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            A+MDPDA+AKAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IV KLTSLPFQ
Sbjct  2    AQMDPDAVAKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVTKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+H LKFSQMFHLMPTPQGS+YV+NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHNLKFSQMFHLMPTPQGSYYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_007163773.1| hypothetical protein PHAVU_001G262800g [Phaseolus vulgaris]
 gb|ESW35767.1| hypothetical protein PHAVU_001G262800g [Phaseolus vulgaris]
Length=123

 Score =   223 bits (569),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SML+FEGQKIQGS NIVAKLTSLPF QC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFNQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSG + GMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGS+YV NDIFRL
Sbjct  61   QHSITTVDCQPSGVSAGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KJB30877.1| hypothetical protein B456_005G165500 [Gossypium raimondii]
Length=122

 Score =   223 bits (568),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSG +GGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHNITTVDCQPSG-SGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|KHG04819.1| Nuclear transport factor 2 -like protein [Gossypium arboreum]
Length=122

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVDHYYSTFDANRAGLANLYQERSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSG AGG+LVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHNITTVDCQPSG-AGGVLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|KJB15503.1| hypothetical protein B456_002G182000 [Gossypium raimondii]
 gb|KJB15504.1| hypothetical protein B456_002G182000 [Gossypium raimondii]
 gb|KJB15505.1| hypothetical protein B456_002G182000 [Gossypium raimondii]
 gb|KJB15506.1| hypothetical protein B456_002G182000 [Gossypium raimondii]
Length=122

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVDHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSG AGG+LVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHNITTVDCQPSG-AGGVLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|ACJ85652.1| unknown [Medicago truncatula]
 gb|AFK38842.1| unknown [Medicago truncatula]
Length=123

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD LAKAFVEHYY+ FD+NRG L +LYQ+ SMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDVLAKAFVEHYYTTFDNNRGGLATLYQEGSMLTFEGQKIQGSPNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+ITTVDCQPSG  GGMLVFVSG LQLAGEQ+ALKFSQMFHLMPTPQGS+YV NDIFRL
Sbjct  61   HHSITTVDCQPSGANGGMLVFVSGNLQLAGEQYALKFSQMFHLMPTPQGSYYVMNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010499291.1| PREDICTED: nuclear transport factor 2 [Camelina sativa]
 ref|XP_010460565.1| PREDICTED: nuclear transport factor 2 [Camelina sativa]
 ref|XP_010478149.1| PREDICTED: nuclear transport factor 2 [Camelina sativa]
Length=126

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            ++MDPDA++KAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPF 
Sbjct  2    SQMDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFN  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+H LKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHTLKFSQMFHLMPTPQGSFYVFNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_010682741.1| PREDICTED: nuclear transport factor 2 [Beta vulgaris subsp. vulgaris]
Length=122

 Score =   222 bits (566),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQD+SMLTFEGQKIQG+QNI AKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRPGLANLYQDSSMLTFEGQKIQGTQNITAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSG +GGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSF V NDIFRL
Sbjct  61   QHSITTVDCQPSG-SGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFCVQNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|EYU34814.1| hypothetical protein MIMGU_mgv1a016384mg [Erythranthe guttata]
Length=123

 Score =   222 bits (566),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQD SMLTFEGQKI GSQNIVAKLT LPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLATLYQDGSMLTFEGQKIMGSQNIVAKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH I+TVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMF LMPT QGS +V NDIFRL
Sbjct  61   QHQISTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFQLMPTAQGSLFVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004502282.1| PREDICTED: nuclear transport factor 2-like [Cicer arietinum]
Length=123

 Score =   222 bits (566),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYY+ FD+NR  L +LYQ+ SML+FEGQKIQGSQNIVAKLT+LPFQQC
Sbjct  1    MDPDALAKAFVEHYYTTFDTNRSGLANLYQEGSMLSFEGQKIQGSQNIVAKLTTLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+ITTVDCQPSG   GMLVFVSG LQLAGEQHALKFSQMFHL+PTPQGS+YV NDIFRL
Sbjct  61   HHSITTVDCQPSGVNAGMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_006352175.1| PREDICTED: nuclear transport factor 2-like [Solanum tuberosum]
Length=123

 Score =   222 bits (565),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+ LAKAFVEHYYS FD+NR  LG+LYQ+ SMLTFEG K QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPNELAKAFVEHYYSTFDTNRAGLGNLYQEGSMLTFEGIKTQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT DCQPSGPAGGM+V VSG LQLAGEQHALKF QMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   QHTITTTDCQPSGPAGGMIVVVSGHLQLAGEQHALKFGQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>ref|XP_009403552.1| PREDICTED: nuclear transport factor 2 [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   222 bits (565),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD NR  LG LYQDASMLTFEG KIQG+  IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDGNRPGLGGLYQDASMLTFEGDKIQGAAAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             HA++TVDCQPSGPAGGMLVFVSG+LQ++GE HALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   VHAVSTVDCQPSGPAGGMLVFVSGSLQISGESHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_008798933.1| PREDICTED: nuclear transport factor 2-like [Phoenix dactylifera]
Length=123

 Score =   221 bits (563),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYY  FD++R  LG+LYQ+ SMLTFEG K QG+Q IVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYRTFDTSRPGLGNLYQEGSMLTFEGAKTQGAQAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ++TVDCQPSGPAGGMLVFVSG+LQLAGEQH LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   QHNVSTVDCQPSGPAGGMLVFVSGSLQLAGEQHPLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009421062.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   221 bits (563),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDS+R ALG LYQDASMLTFEG KIQG+  IVAKL+SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSSRAALGVLYQDASMLTFEGDKIQGAAAIVAKLSSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I TVDCQPSGP+GGMLVFVSG+LQL GEQH LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   AHVIATVDCQPSGPSGGMLVFVSGSLQLGGEQHPLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004239227.1| PREDICTED: nuclear transport factor 2 [Solanum lycopersicum]
Length=123

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+ LAKAFVEHYYS FDSNR ALG+LYQ+ SMLTFEG K QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPNDLAKAFVEHYYSTFDSNRAALGNLYQEGSMLTFEGIKTQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+DCQ SGPAGGM+V VSG LQLAGEQHALKF QMFHLMPTPQGSFYV+NDIFRL
Sbjct  61   HHTITTIDCQHSGPAGGMIVVVSGNLQLAGEQHALKFGQMFHLMPTPQGSFYVFNDIFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>ref|XP_009419369.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYY  FD NR ALG LYQDASMLTFEG KIQG+  IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVDHYYRTFDGNRVALGGLYQDASMLTFEGVKIQGAAAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             HAI+TVDCQPSGPAGG+LVFVSG+LQLAGE H LKFSQMFHLMPTPQGSFYV ND+FRL
Sbjct  61   VHAISTVDCQPSGPAGGVLVFVSGSLQLAGESHTLKFSQMFHLMPTPQGSFYVLNDVFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004231773.1| PREDICTED: nuclear transport factor 2 [Solanum lycopersicum]
 ref|XP_006338703.1| PREDICTED: nuclear transport factor 2-like [Solanum tuberosum]
Length=123

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFV+HYYS FDSNR  L +LYQ+ASML+FEG +IQG+Q+IVAKLTSLPFQQC
Sbjct  1    MDPDSVAKAFVDHYYSTFDSNRAGLANLYQEASMLSFEGVQIQGAQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSGPAGGMLVFVSG LQL GEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHHINTVDCQPSGPAGGMLVFVSGNLQLPGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_003601758.1| Nuclear transport factor [Medicago truncatula]
 gb|AES72009.1| nuclear transport factor 2 [Medicago truncatula]
 gb|AFK43041.1| unknown [Medicago truncatula]
Length=123

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+AL+KAFVEHYY+ FD+NR  L +LYQD SMLTFEGQ+I GSQNIV KLTSLPFQQC
Sbjct  1    MDPNALSKAFVEHYYTTFDTNRPNLAALYQDGSMLTFEGQQIMGSQNIVTKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+ITTVDCQPSG  GGMLVFVSG LQLAGEQHALKFSQMFHL+PTPQGS+YV+NDIFRL
Sbjct  61   HHSITTVDCQPSGANGGMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVWNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KHG14054.1| Nuclear transport factor 2 -like protein [Gossypium arboreum]
Length=122

 Score =   220 bits (561),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IV KLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVVKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSG +GGMLVFVSG LQL GEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   KHNITTVDCQPSG-SGGMLVFVSGNLQLVGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>emb|CDX84932.1| BnaC05g21230D [Brassica napus]
Length=122

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRAGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>emb|CDY27606.1| BnaA09g28010D [Brassica napus]
Length=122

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNRG L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRGGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPA GMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAAGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_002297847.2| hypothetical protein POPTR_0001s13730g [Populus trichocarpa]
 gb|EEE82652.2| hypothetical protein POPTR_0001s13730g [Populus trichocarpa]
Length=138

 Score =   220 bits (560),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYYS FD+NR  L +LYQD SMLTFEGQK QGSQNIVAKL +LPFQQC
Sbjct  1    MDPDQVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGQKTQGSQNIVAKLIALPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHLMPTPQGSFYV+NDIFR 
Sbjct  61   KHLITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVFNDIFRF  120

Query  399  NY  404
             +
Sbjct  121  CF  122



>ref|XP_004504406.1| PREDICTED: nuclear transport factor 2-like [Cicer arietinum]
Length=123

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYY+ FD+NR  L +LYQ+ASMLTFEGQKIQGS NIVAKLTSLPFQQ 
Sbjct  1    MDPDALAKAFVEHYYTTFDTNRAGLANLYQEASMLTFEGQKIQGSSNIVAKLTSLPFQQS  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+ITTVDCQPS    GMLVFVSG LQLAGEQHALKFSQMFHL+PTPQGS+YV NDIFRL
Sbjct  61   HHSITTVDCQPSAVNAGMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVQNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|NP_001240272.1| uncharacterized protein LOC100777334 [Glycine max]
 gb|ACU20646.1| unknown [Glycine max]
 gb|KHN12382.1| Nuclear transport factor 2 [Glycine soja]
Length=123

 Score =   219 bits (558),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQG+ NIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDTNRNGLANLYQEGSMLTFEGQKIQGASNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+I+TVDCQPSG   GMLVFVSG LQLAGEQH LKFSQMFHL+PTPQGS+YV NDIFRL
Sbjct  61   HHSISTVDCQPSGVNAGMLVFVSGNLQLAGEQHTLKFSQMFHLIPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|AFK49295.1| unknown [Lotus japonicus]
Length=123

 Score =   219 bits (558),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD NR  L +LYQ+ SMLTFEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDGNRAGLANLYQEGSMLTFEGQKIQGSTNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+I+TVDCQPSG   GMLVFVSG LQLAGEQHALKFSQMFHL+PTPQGS+YV ND+FRL
Sbjct  61   LHSISTVDCQPSGVNNGMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVLNDVFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_003538542.1| PREDICTED: nuclear transport factor 2 [Glycine max]
Length=123

 Score =   219 bits (558),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L +LYQ+ SML+FEGQKIQGS NIVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDTNRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVD QPSG    MLVFVSG LQLAGEQHALKFSQMFHL+PTPQGS+YV NDIFRL
Sbjct  61   QHSITTVDSQPSGVNAAMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_008790757.1| PREDICTED: nuclear transport factor 2 [Phoenix dactylifera]
Length=123

 Score =   219 bits (557),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQ+ SMLTFEG K QG+Q I AK++SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLANLYQEGSMLTFEGAKTQGAQAIAAKISSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSGPAGGMLVFVSG+LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   IHNISTVDCQPSGPAGGMLVFVSGSLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|EPS62811.1| hypothetical protein M569_11974, partial [Genlisea aurea]
Length=125

 Score =   218 bits (556),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            A M+PDALAKAFV HYYS FD+NR  L SLYQD+SML+FEGQK  G+ NI AKL +LPFQ
Sbjct  1    AAMEPDALAKAFVNHYYSTFDANRAGLASLYQDSSMLSFEGQKFLGAHNISAKLNALPFQ  60

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QCQH ITTVDCQPSGP+GG+LVF SG LQLAGEQHALKFSQMFHLMPTPQGSFYV NDIF
Sbjct  61   QCQHNITTVDCQPSGPSGGVLVFASGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIF  120

Query  393  RLNYA  407
            RLNYA
Sbjct  121  RLNYA  125



>emb|CDY66150.1| BnaAnng21720D [Brassica napus]
 emb|CDY11822.1| BnaC03g57560D [Brassica napus]
Length=122

 Score =   218 bits (556),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDANRAGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_006305784.1| hypothetical protein CARUB_v10010663mg [Capsella rubella]
 gb|EOA38682.1| hypothetical protein CARUB_v10010663mg [Capsella rubella]
Length=122

 Score =   218 bits (555),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLI-SNQGTYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_002893460.1| hypothetical protein ARALYDRAFT_890252 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69719.1| hypothetical protein ARALYDRAFT_890252 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   218 bits (555),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLI-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|ABQ59097.1| nuclear transport factor 2 [Panax ginseng]
Length=123

 Score =   218 bits (555),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA++KAFVEHYYS FD+NR  L +LYQD SMLTFEGQKIQG QNIVAKLTS PF QC
Sbjct  1    MDPDAVSKAFVEHYYSAFDANRSGLANLYQDGSMLTFEGQKIQGFQNIVAKLTSFPFSQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H IT VD QPSGPAGGMLVFVSGT QLAGEQHALKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   KHTITPVDRQPSGPAGGMLVFVSGTFQLAGEQHALKFSQMFHLMPTQQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010926830.1| PREDICTED: nuclear transport factor 2 isoform X2 [Elaeis guineensis]
Length=123

 Score =   218 bits (555),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQD SMLTFEG K QG+Q I AKL SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLANLYQDGSMLTFEGAKTQGAQAIAAKLASLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSGPAGGM+VFVSG+LQLAGEQH LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   MHNISTVDCQPSGPAGGMVVFVSGSLQLAGEQHPLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>emb|CDY03908.1| BnaC07g11330D [Brassica napus]
Length=122

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRAGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPA GMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPANGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_010927764.1| PREDICTED: nuclear transport factor 2-like [Elaeis guineensis]
Length=123

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQ+ SMLTFEG K QG+Q I AKL SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLANLYQEGSMLTFEGAKTQGAQAIAAKLASLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSGPAGGMLVFVSG+LQLAGEQHALKFSQMFHLMPTPQGSF+V NDIFRL
Sbjct  61   LHNISTVDCQPSGPAGGMLVFVSGSLQLAGEQHALKFSQMFHLMPTPQGSFFVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_003524901.1| PREDICTED: nuclear transport factor 2-like [Glycine max]
 gb|KHN34826.1| Nuclear transport factor 2 [Glycine soja]
Length=123

 Score =   217 bits (553),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDALAKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQG+ +IVAKLTSLPFQQC
Sbjct  1    MDPDALAKAFVEHYYSTFDTNRNGLANLYQEGSMLTFEGQKIQGASSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+I+TVDCQPSG   GMLVFVSG LQLAGEQH LKFSQMFHL+PTPQGS+YV NDIFRL
Sbjct  61   HHSISTVDCQPSGVNAGMLVFVSGNLQLAGEQHTLKFSQMFHLIPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>emb|CDY15721.1| BnaA07g08920D [Brassica napus]
Length=122

 Score =   216 bits (551),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNR  L SLYQ+ SML+FEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRAGLVSLYQEGSMLSFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPA GMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPANGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_009113780.1| PREDICTED: nuclear transport factor 2-like [Brassica rapa]
Length=122

 Score =   216 bits (550),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNRG L SL Q+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRGGLVSLCQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPA GMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAAGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|ABR17049.1| unknown [Picea sitchensis]
 gb|ABR17891.1| unknown [Picea sitchensis]
 gb|ACN41171.1| unknown [Picea sitchensis]
Length=123

 Score =   216 bits (549),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV HYY++FDSNR  L  LYQ+ SMLTFEG+KIQG Q+IV KLTSLPFQQC
Sbjct  1    MDPDAVAKAFVGHYYNLFDSNRANLAGLYQEGSMLTFEGEKIQGVQSIVGKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSGPAGGMLVFVSG+LQL GEQH LKFSQMFHLMPTP GS+YV+NDIFRL
Sbjct  61   KHNISTVDCQPSGPAGGMLVFVSGSLQLPGEQHQLKFSQMFHLMPTPAGSYYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|NP_174051.1| nuclear transport factor 2A [Arabidopsis thaliana]
 gb|AAF99749.1|AC004557_28 F17L21.10 [Arabidopsis thaliana]
 gb|AAK68829.1| similar to nuclear transport factor 2 [Arabidopsis thaliana]
 gb|AAL66888.1| similar to nuclear transport factor 2 [Arabidopsis thaliana]
 gb|AEE30805.1| nuclear transport factor 2A [Arabidopsis thaliana]
Length=122

 Score =   216 bits (549),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLT LPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLI-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_010499203.1| PREDICTED: nuclear transport factor 2-like [Camelina sativa]
 ref|XP_010478053.1| PREDICTED: nuclear transport factor 2-like [Camelina sativa]
Length=122

 Score =   215 bits (548),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPF QC
Sbjct  1    MDPDAVAKAFVEHYYSTFDGNRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFNQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLI-SNQGTYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|NP_001077612.1| nuclear transport factor 2B [Arabidopsis thaliana]
 gb|AEE30897.1| nuclear transport factor 2B [Arabidopsis thaliana]
Length=134

 Score =   216 bits (549),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            ++MDPDA++KAFVEHYYS FD+NR  L  LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQ
Sbjct  2    SQMDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQMFHLMPTPQGSFYV+NDIF
Sbjct  62   QCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIF  121



>ref|XP_008806416.1| PREDICTED: nuclear transport factor 2-like [Phoenix dactylifera]
Length=123

 Score =   214 bits (546),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQ+ SMLTFEG K QG+Q I AKL SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLVNLYQEGSMLTFEGAKTQGAQAIAAKLASLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+TVDCQPSGPAGGMLVFVSG+LQLAGEQH LKFSQMFHLMPTPQGSF+V NDIFRL
Sbjct  61   MHNISTVDCQPSGPAGGMLVFVSGSLQLAGEQHPLKFSQMFHLMPTPQGSFFVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009109823.1| PREDICTED: nuclear transport factor 2-like [Brassica rapa]
Length=122

 Score =   214 bits (545),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FD+NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYTTFDANRAGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +  ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KPNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_009415885.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   213 bits (542),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+A+AKAFV+HYY  FD NR AL  LY DASMLTFEG KIQG+  IVAKLTSLPFQQC
Sbjct  1    MDPEAVAKAFVDHYYRTFDGNRAALAGLYHDASMLTFEGDKIQGAAAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             HAI+TVD QPSGP GGMLVFVSG+LQLAGE H LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   AHAISTVDFQPSGPPGGMLVFVSGSLQLAGESHTLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009102992.1| PREDICTED: nuclear transport factor 2 [Brassica rapa]
Length=122

 Score =   212 bits (540),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY+ FDSNR  L SLYQ+ SML+FEGQKIQGSQNIVAKLTSLPFQQ 
Sbjct  1    MDPDAVAKAFVEHYYTTFDSNRAGLVSLYQEGSMLSFEGQKIQGSQNIVAKLTSLPFQQR  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPA GMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRL
Sbjct  61   KHNITTVDCQPSGPANGMLVFVSGNLQLAGEQHALKFSQMFHLV-SNQGNYYVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_009405885.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   212 bits (539),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD D +AKAFV+HYY  FDSNR ALG LYQD SMLTFEG KIQG+  I AKLTSLP QQC
Sbjct  1    MDQDGVAKAFVDHYYQTFDSNRAALGRLYQDGSMLTFEGAKIQGAAAIAAKLTSLPLQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H+I+T+DCQPSGP GG+LVFVSG+LQL GEQH+LKFSQMFHLMPTPQGSFYV NDIFRL
Sbjct  61   AHSISTIDCQPSGPTGGILVFVSGSLQLGGEQHSLKFSQMFHLMPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009606510.1| PREDICTED: nuclear transport factor 2-like [Nicotiana tomentosiformis]
Length=123

 Score =   211 bits (538),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            M+PDA+A AFVEHYYS FDSNR  L +LYQ+ SML+FEG KIQG+Q+IVAKLTSLPFQQC
Sbjct  1    MNPDAVATAFVEHYYSTFDSNRAGLANLYQEGSMLSFEGVKIQGAQHIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSGP GGMLVFVSG LQL GE+H LKFSQMFHLMPT QGSFYV NDIFRL
Sbjct  61   KHQINTVDCQPSGPIGGMLVFVSGNLQLPGEEHVLKFSQMFHLMPTQQGSFYVMNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|AEZ52394.1| nuclear transport factor 2 [Wolffia australiana]
Length=123

 Score =   211 bits (538),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  LG+LYQD SMLTFE  K QGSQ IVAKL  LPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRADLGNLYQDGSMLTFEEAKTQGSQAIVAKLAGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ++TVDCQPSGP GG+LVFVSG LQLAGEQH LKFSQMFHL+PTPQGSFYV NDIFRL
Sbjct  61   LHKVSTVDCQPSGPGGGVLVFVSGLLQLAGEQHPLKFSQMFHLIPTPQGSFYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KHN44448.1| Nuclear transport factor 2 [Glycine soja]
Length=136

 Score =   212 bits (539),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 111/136 (82%), Gaps = 13/136 (10%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ--  212
            MDPDALAKAFVEHYYS FD+NR  L +LYQ+ SML+FEGQKIQGS NIVAKLTSLPFQ  
Sbjct  1    MDPDALAKAFVEHYYSTFDTNRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFQHY  60

Query  213  -----------QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTP  359
                       QC H+I+TVDCQPSG   GMLVFVSG LQLAGEQHALKFSQMFHL+PTP
Sbjct  61   AVAKLTSLPFQQCHHSISTVDCQPSGVNAGMLVFVSGNLQLAGEQHALKFSQMFHLIPTP  120

Query  360  QGSFYVYNDIFRLNYA  407
            QGS+YV NDIFRLNYA
Sbjct  121  QGSYYVLNDIFRLNYA  136



>ref|XP_006385898.1| hypothetical protein POPTR_0003s16930g [Populus trichocarpa]
 gb|ABK94617.1| unknown [Populus trichocarpa]
 gb|ERP63695.1| hypothetical protein POPTR_0003s16930g [Populus trichocarpa]
Length=114

 Score =   206 bits (525),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 106/123 (86%), Gaps = 9/123 (7%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYY+MFDSNR  L +LYQDASMLTFEGQK QGSQNIVAKLT+LPF QC
Sbjct  1    MDPDTVAKAFVEHYYNMFDSNRAGLANLYQDASMLTFEGQKTQGSQNIVAKLTALPFHQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFS         QGS+YVYNDIFRL
Sbjct  61   KHHITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFS---------QGSYYVYNDIFRL  111

Query  399  NYA  407
            NYA
Sbjct  112  NYA  114



>emb|CDP13353.1| unnamed protein product [Coffea canephora]
Length=124

 Score =   206 bits (524),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D +AKAFV+HYYS FD+NR  LG+LYQD SMLTFEG+K QGS NI+AKLT LPFQQCQH 
Sbjct  5    DQVAKAFVDHYYSTFDTNRSGLGNLYQDQSMLTFEGEKFQGSSNILAKLTGLPFQQCQHG  64

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            ITTVDCQPSGPAGGMLVFVSG L + G +H LKFSQMFHLMPTPQGSFYV NDIFRLNYA
Sbjct  65   ITTVDCQPSGPAGGMLVFVSGLLVVDGGEHPLKFSQMFHLMPTPQGSFYVLNDIFRLNYA  124



>ref|XP_006848276.1| hypothetical protein AMTR_s00013p00078860 [Amborella trichopoda]
 gb|ERN09857.1| hypothetical protein AMTR_s00013p00078860 [Amborella trichopoda]
Length=123

 Score =   205 bits (522),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD D +A+AFVEHYYS FD+NR  L SLYQD SMLTFEGQK+QG+QNIV KLTSLPFQQC
Sbjct  1    MDTDVVARAFVEHYYSTFDTNRAGLASLYQDNSMLTFEGQKVQGAQNIVTKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITT+D QPS     ++VFVSG LQLAGEQHALKFSQMFHL+ TPQ S+YV NDIFRL
Sbjct  61   QHSITTIDSQPSVHPNSIIVFVSGNLQLAGEQHALKFSQMFHLLQTPQNSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_009771779.1| PREDICTED: nuclear transport factor 2-like [Nicotiana sylvestris]
Length=123

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +A AFV+HYYS FDSNR  L +LYQ+ SMLTFEG+K QGSQNIV KLT LPFQQC
Sbjct  1    MDPDDVATAFVKHYYSTFDSNRVGLSNLYQEGSMLTFEGEKHQGSQNIVNKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVD QPSGP G MLVFVSG LQL GEQH LKFSQMFHLMPTPQGS+YV NDIFRL
Sbjct  61   KHNISTVDSQPSGPGGAMLVFVSGNLQLPGEQHPLKFSQMFHLMPTPQGSYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|ABK22785.1| unknown [Picea sitchensis]
Length=123

 Score =   203 bits (517),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYY+ FD++R  L +LYQ+ SM+TFEGQK QG  +IVAKLT LPFQQC
Sbjct  1    MDPDIVAKAFVEHYYNTFDASRANLVTLYQETSMMTFEGQKHQGPASIVAKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +HAI+TVDCQPSGPAGGM+VFVSG LQLAGE+H L+FSQ+FHL+PTPQGSF+V NDIFRL
Sbjct  61   KHAISTVDCQPSGPAGGMIVFVSGMLQLAGEEHHLRFSQLFHLIPTPQGSFFVQNDIFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>ref|XP_009597107.1| PREDICTED: nuclear transport factor 2-like [Nicotiana tomentosiformis]
Length=123

 Score =   203 bits (516),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +A AFV+HYYS FDSNR  L +LYQ+ SMLTFEG+K QGSQNIV KLT LPFQQC
Sbjct  1    MDPDDVATAFVKHYYSTFDSNRVGLSNLYQEGSMLTFEGEKHQGSQNIVNKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVD QPSGP G MLVFVSG LQL GEQH LKFSQMFHLMPTPQG +YV NDIFRL
Sbjct  61   KHNISTVDSQPSGPGGAMLVFVSGNLQLPGEQHPLKFSQMFHLMPTPQGGYYVLNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KCW86936.1| hypothetical protein EUGRSUZ_B03507 [Eucalyptus grandis]
Length=110

 Score =   201 bits (512),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 105/123 (85%), Gaps = 13/123 (11%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NRG L +LYQ+ SMLTFEGQKIQGSQ+IV+KLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRGGLANLYQEGSMLTFEGQKIQGSQSIVSKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH+ITTVDCQPSGP             LAGEQHALKFSQ+FHLMPTPQGSFYV NDIFRL
Sbjct  61   QHSITTVDCQPSGP-------------LAGEQHALKFSQLFHLMPTPQGSFYVLNDIFRL  107

Query  399  NYA  407
            NYA
Sbjct  108  NYA  110



>ref|XP_001769890.1| predicted protein [Physcomitrella patens]
 gb|EDQ65250.1| predicted protein [Physcomitrella patens]
Length=123

 Score =   201 bits (511),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD L+K FVEHYY+ FD+NR AL +LYQ+ SMLTFEG+KIQG+Q+I  KL SLPFQQC
Sbjct  1    MDPDQLSKHFVEHYYTTFDTNRLALINLYQEGSMLTFEGEKIQGAQSISNKLNSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSG +GG +VFVSG LQL GE+H LKFSQMFHL PTPQGSFYV+NDIFRL
Sbjct  61   KHNISTVDCQPSGLSGGWVVFVSGNLQLPGEEHLLKFSQMFHLAPTPQGSFYVFNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_010462923.1| PREDICTED: nuclear transport factor 2-like [Camelina sativa]
Length=213

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  54   LAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHAIT  233
             ++AFVEHYYS FD NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPF QC+H IT
Sbjct  97   FSQAFVEHYYSTFDGNRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFNQCKHNIT  156

Query  234  TVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            TVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQMFHL+ + QG++YV+NDIFRLNYA
Sbjct  157  TVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLI-SNQGTYYVFNDIFRLNYA  213


 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD NR  L SLYQ+ SMLTFEGQKIQGSQNIVAKLTSLPF QC
Sbjct  1    MDPDAVAKAFVEHYYSTFDGNRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFNQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMF  341
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQ F
Sbjct  61   KHNITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQAF  101



>ref|XP_002966354.1| hypothetical protein SELMODRAFT_230884 [Selaginella moellendorffii]
 ref|XP_002978206.1| hypothetical protein SELMODRAFT_152345 [Selaginella moellendorffii]
 gb|EFJ20863.1| hypothetical protein SELMODRAFT_152345 [Selaginella moellendorffii]
 gb|EFJ32381.1| hypothetical protein SELMODRAFT_230884 [Selaginella moellendorffii]
Length=126

 Score =   197 bits (500),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            A MDPD +++AFV+HYY+ FD+NR  L SLYQDASMLTFEGQ+ QG+ NI  KL SLPFQ
Sbjct  2    AAMDPDQVSRAFVDHYYNTFDANRAGLVSLYQDASMLTFEGQQFQGAPNIANKLNSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            QC+H I+TVDCQPSG  GGMLVFVSG LQL GE+H LKFSQMFHL+PT +GS +V NDIF
Sbjct  62   QCKHNISTVDCQPSGAHGGMLVFVSGILQLPGEEHPLKFSQMFHLVPTAEGSLFVLNDIF  121

Query  393  RLNYA  407
            RLNYA
Sbjct  122  RLNYA  126



>ref|XP_006365034.1| PREDICTED: nuclear transport factor 2-like [Solanum tuberosum]
Length=123

 Score =   196 bits (499),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV++YY+ FD+NR  L ++YQ++S+L+FEGQK QG+Q+I  KLT LPFQQC
Sbjct  1    MDPDAVAKAFVDYYYTTFDTNRAGLANVYQESSVLSFEGQKYQGTQSISGKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSG AGGMLVFVSG L L GEQHALKFSQMFHL+PT  GSFYV NDIFRL
Sbjct  61   KHQINTVDCQPSGAAGGMLVFVSGNLSLPGEQHALKFSQMFHLIPTQGGSFYVQNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_004233291.1| PREDICTED: nuclear transport factor 2-like [Solanum lycopersicum]
Length=123

 Score =   196 bits (499),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV++YY+ FD+NR  L S+YQ++S+L+FEGQK QG+Q+I  KLT LPFQQC
Sbjct  1    MDPDAVAKAFVDYYYTTFDTNRAGLASVYQESSVLSFEGQKYQGTQSISGKLTGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSG AGGMLVFVSG L L GEQH LKFSQMFHL+PT  GSFYV NDIFRL
Sbjct  61   KHQINTVDCQPSGAAGGMLVFVSGNLSLPGEQHTLKFSQMFHLIPTQGGSFYVQNDIFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>ref|XP_002967834.1| hypothetical protein SELMODRAFT_169222 [Selaginella moellendorffii]
 ref|XP_002981682.1| hypothetical protein SELMODRAFT_271504 [Selaginella moellendorffii]
 gb|EFJ17164.1| hypothetical protein SELMODRAFT_271504 [Selaginella moellendorffii]
 gb|EFJ31181.1| hypothetical protein SELMODRAFT_169222 [Selaginella moellendorffii]
Length=123

 Score =   196 bits (497),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+ +AKAFV+HYYS+FD+NR AL  LYQD SMLTFEG+KIQG+ +I AKL  LPFQQC
Sbjct  1    MDPNQVAKAFVDHYYSLFDTNRPALAGLYQDGSMLTFEGEKIQGAASISAKLNGLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH I+TVD QPSG   GMLVFVSG+L+L GE H LKFSQ+FHL+PTPQGSFYV+NDIFRL
Sbjct  61   QHQISTVDFQPSGAGSGMLVFVSGSLKLQGEDHPLKFSQLFHLIPTPQGSFYVFNDIFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>ref|XP_009786987.1| PREDICTED: nuclear transport factor 2-like [Nicotiana sylvestris]
Length=122

 Score =   192 bits (489),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+++AKAFV+HYYS FD+NR AL +LYQ+ SML+FEGQK QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPESVAKAFVDHYYSTFDTNRAALANLYQENSMLSFEGQKYQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+T DCQ SG A GMLVFVSG LQ+ GE+H LKFSQMF L+P  QGS YV NDIFRL
Sbjct  61   KHHISTTDCQLSG-ANGMLVFVSGNLQIPGEEHPLKFSQMFQLIPAGQGSLYVSNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_009601174.1| PREDICTED: nuclear transport factor 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=122

 Score =   192 bits (488),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+++AKAFV+HYYS FD+NR AL +LYQ++SML+FEGQK QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPESVAKAFVDHYYSTFDTNRAALANLYQESSMLSFEGQKYQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+T DCQ SG + GMLVFVSG LQ+ GE+H LKFSQMF L+P  QGS YV NDIFRL
Sbjct  61   KHHISTTDCQLSG-SNGMLVFVSGNLQIPGEEHPLKFSQMFQLIPAGQGSLYVSNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_010680019.1| PREDICTED: nuclear transport factor 2-like [Beta vulgaris subsp. 
vulgaris]
Length=125

 Score =   186 bits (473),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +AKAFV+HYY+ FD+NR  L +L+Q+ SML+FEGQK  G QNIV KLTSLPF+QC+H+
Sbjct  5    EQVAKAFVDHYYTTFDTNRAGLSNLHQENSMLSFEGQKFLGGQNIVGKLTSLPFEQCKHS  64

Query  228  ITTVDCQPSGPAG-GMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            ITT+DCQ SGP G  ++VFVSG LQLAGEQH LKFSQMF+L+PTPQGSFYV NDIFRLNY
Sbjct  65   ITTIDCQLSGPNGTTLIVFVSGNLQLAGEQHPLKFSQMFYLLPTPQGSFYVQNDIFRLNY  124

Query  405  A  407
            A
Sbjct  125  A  125



>ref|XP_004957291.1| PREDICTED: nuclear transport factor 2-like [Setaria italica]
Length=123

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFV+HYY+ FD+NR AL  LYQ+ SMLTFEG K  G+  I  KLTSLPF  C
Sbjct  1    MDPDSVAKAFVDHYYTTFDTNRAALVGLYQEGSMLTFEGTKFMGAAAITGKLTSLPFTAC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H +TTVDCQPSGP GGMLVFVSG LQ+A  +H LKFSQMFHLMP   G+FYV ND+FRL
Sbjct  61   KHQVTTVDCQPSGPGGGMLVFVSGALQVAEGEHPLKFSQMFHLMPVGPGNFYVQNDMFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>gb|EMS50252.1| Nuclear transport factor 2 [Triticum urartu]
Length=122

 Score =   184 bits (467),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY  FD+NR AL  LYQ+ SML+FEG+K QG+  I  KLTSLPF +C
Sbjct  1    MDPDSVAKAFVEHYYRTFDTNRAALVGLYQEGSMLSFEGEKFQGAAAIATKLTSLPFTKC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H + TVDCQP+GP GGMLVFVSG+LQ+ GE H +KFSQMFHLMP   G+FYV+ND+FRL
Sbjct  61   AHTVVTVDCQPAGPTGGMLVFVSGSLQVDGEHH-IKFSQMFHLMPLGPGNFYVHNDMFRL  119

Query  399  NY  404
            NY
Sbjct  120  NY  121



>ref|XP_009387677.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=119

 Score =   183 bits (465),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD NR ALG LYQDASMLTFEG KIQG+  IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDGNRAALGGLYQDASMLTFEGDKIQGAAAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSF  371
             HAI+TVDCQPSGPAGG+LVFVSG+LQLAGE H LKFSQ+F+L+     +F
Sbjct  61   AHAISTVDCQPSGPAGGVLVFVSGSLQLAGESHTLKFSQVFYLLSLSMSAF  111



>ref|XP_010238338.1| PREDICTED: nuclear transport factor 2-like [Brachypodium distachyon]
Length=123

 Score =   182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYY  FD++R AL  LYQ+ SML+FEG+K  G+  I AKLTSLPF++C
Sbjct  1    MDPDGVAKAFVEHYYRTFDTSRAALVGLYQEGSMLSFEGEKFMGATAIAAKLTSLPFEKC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H++ TVDCQP+GP GGMLVFVSG+L +   +HA+KFSQMFHLMP   G+FYV ND+FRL
Sbjct  61   AHSVVTVDCQPAGPTGGMLVFVSGSLTVGEGEHAIKFSQMFHLMPAGPGNFYVQNDMFRL  120

Query  399  NY  404
            NY
Sbjct  121  NY  122



>gb|EMT26775.1| Nuclear transport factor 2 [Aegilops tauschii]
Length=122

 Score =   182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY  FD+NR AL  LYQ+ SML+FEG+K QG+  I  KLTSLPF +C
Sbjct  1    MDPDSVAKAFVEHYYRTFDTNRAALVGLYQEGSMLSFEGEKFQGAAAIATKLTSLPFTKC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H + TV CQP+GP GGMLVFVSG+LQ+ GE H +KFSQMFHLMP   G+FYV+ND+FRL
Sbjct  61   AHTVVTVACQPAGPTGGMLVFVSGSLQVDGEHH-IKFSQMFHLMPIGPGNFYVHNDMFRL  119

Query  399  NY  404
            NY
Sbjct  120  NY  121



>ref|XP_008807438.1| PREDICTED: nuclear transport factor 2 [Phoenix dactylifera]
Length=122

 Score =   181 bits (460),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            M+PD LA AFV  YY  FD +R  LGSLY+  SMLTFEG K +G + IVAKLTSLPFQQC
Sbjct  1    MNPDTLAMAFVGLYYETFDKSRADLGSLYRQGSMLTFEGVKKKGVEAIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ++T+DCQPSG AGG+LVFVSG+LQL GEQ+ LKFS+MFHL+  PQGSFYV NDIFRL
Sbjct  61   QHNVSTIDCQPSG-AGGILVFVSGSLQLPGEQYPLKFSEMFHLLGIPQGSFYVLNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>ref|XP_011036093.1| PREDICTED: nuclear transport factor 2 isoform X2 [Populus euphratica]
Length=111

 Score =   180 bits (457),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD +AKAFVEHYYS FD+NR  L +LYQD SMLTFEGQK QGSQNIVAKL +LPFQQC
Sbjct  1    MDPDQVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGQKTQGSQNIVAKLIALPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYV  377
            +H ITTVDCQPSGPAGGMLVFVSG LQLAGEQHALKFSQ+  L+ T   S Y+
Sbjct  61   KHLITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQI--LLSTTAVSCYL  111



>ref|XP_004974006.1| PREDICTED: nuclear transport factor 2-like [Setaria italica]
Length=124

 Score =   181 bits (459),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD+NR AL  LYQD SMLTFEGQK QG   I  KL SLPFQ C
Sbjct  3    MDPDAVAKAFVEHYYRTFDTNRAALVGLYQDTSMLTFEGQKFQGPAAIAGKLGSLPFQHC  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSGP GGMLVFVSG+++   E+H +KFSQ FHL+P   GSFYV ND+FRL
Sbjct  63   EHQIVTVDCQPSGPQGGMLVFVSGSIRTGPEEHPIKFSQAFHLLPA-GGSFYVQNDMFRL  121

Query  399  NY  404
            NY
Sbjct  122  NY  123



>emb|CDY71760.1| BnaAnng38740D, partial [Brassica napus]
Length=105

 Score =   179 bits (453),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  LG LYQ+ASMLTFEGQKIQG Q+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDNNRVGLGGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQM  338
            +H I+TVDCQPSGPA GMLVFVSG LQLAGE+HALKFSQ+
Sbjct  61   KHNISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQV  100



>ref|XP_010267746.1| PREDICTED: nuclear transport factor 2-like [Nelumbo nucifera]
Length=128

 Score =   179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
            G +   + + KAFVEHYY +FD+NR +L SLYQ +SMLTFEGQ IQG Q+I  KLT LPF
Sbjct  3    GMEEQVELVGKAFVEHYYHLFDTNRQSLSSLYQPSSMLTFEGQNIQGVQDIAGKLTQLPF  62

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
             QCQH I+T+D QPS   GG++VFVSG LQL GE+H L+FSQMFHL+PT QGSFYV NDI
Sbjct  63   DQCQHVISTIDSQPSSFPGGIIVFVSGNLQLPGEEHQLRFSQMFHLIPTIQGSFYVQNDI  122

Query  390  FRLNYA  407
            FRLNY 
Sbjct  123  FRLNYG  128



>ref|XP_008678399.1| PREDICTED: nuclear transport factor 2-like [Zea mays]
Length=196

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +3

Query  21   GGGGA--KMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKL  194
            GGGG    MDPDA+AKAFVEHYY  FD+NR AL  LYQ+ SMLTFEGQK QG   I  KL
Sbjct  67   GGGGEVMAMDPDAVAKAFVEHYYRTFDTNRAALVGLYQETSMLTFEGQKFQGPSAIAGKL  126

Query  195  TSLPFQQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFY  374
             SLPFQ C+H I TVDCQPSGP GGMLVFVSG+++   E+H +KFSQ FHL+P   GSF+
Sbjct  127  GSLPFQACEHQIVTVDCQPSGPQGGMLVFVSGSIRTGPEEHPIKFSQAFHLLPA-AGSFF  185

Query  375  VYNDIFRLNY  404
            V ND+FRLNY
Sbjct  186  VQNDMFRLNY  195



>gb|ACR36150.1| unknown [Zea mays]
Length=122

 Score =   179 bits (453),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD+NR AL  LYQ+ SMLTFEGQK QG   I  KL SLPFQ C
Sbjct  1    MDPDAVAKAFVEHYYRTFDTNRAALVGLYQETSMLTFEGQKFQGPSAIAGKLGSLPFQAC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSGP GGMLVFVSG+++   E+H +KFSQ FHL+P   GSF+V ND+FRL
Sbjct  61   EHQIVTVDCQPSGPQGGMLVFVSGSIRTGPEEHPIKFSQAFHLLPA-AGSFFVQNDMFRL  119

Query  399  NY  404
            NY
Sbjct  120  NY  121



>ref|NP_001131358.1| uncharacterized protein LOC100192679 [Zea mays]
 gb|ACF79735.1| unknown [Zea mays]
 gb|ACG24513.1| nuclear transport factor 2 [Zea mays]
 gb|ACG24655.1| nuclear transport factor 2 [Zea mays]
 gb|ACG24663.1| nuclear transport factor 2 [Zea mays]
 gb|ACG27380.1| nuclear transport factor 2 [Zea mays]
 gb|ACG30927.1| nuclear transport factor 2 [Zea mays]
 gb|ACG33239.1| nuclear transport factor 2 [Zea mays]
 gb|ACG41539.1| nuclear transport factor 2 [Zea mays]
 gb|AFW61583.1| nuclear transport factor 2 [Zea mays]
 tpg|DAA48219.1| TPA: nuclear transport factor 2 [Zea mays]
Length=124

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD+NR AL  LYQ+ SMLTFEGQK QG   I  KL SLPFQ C
Sbjct  3    MDPDAVAKAFVEHYYRTFDTNRAALVGLYQETSMLTFEGQKFQGPSAIAGKLGSLPFQAC  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I TVDCQPSGP GGMLVFVSG+++   E+H +KFSQ FHL+P   GSF+V ND+FRL
Sbjct  63   EHQIVTVDCQPSGPQGGMLVFVSGSIRTGPEEHPIKFSQAFHLLPA-AGSFFVQNDMFRL  121

Query  399  NY  404
            NY
Sbjct  122  NY  123



>gb|KHG12275.1| Nuclear transport factor 2 -like protein [Gossypium arboreum]
Length=124

 Score =   178 bits (452),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D++ KAFV+HYY +FD++R A+ SLYQ  SMLTFEGQK+QG ++I+ KLT LPF QC+H 
Sbjct  6    DSVGKAFVDHYYHLFDNDRAAMSSLYQPTSMLTFEGQKLQGVEDIITKLTQLPFDQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+TVD QP+   GG++VFVSG+LQL GE H L+FSQMFHL PTPQG+F+V NDIFRLNY
Sbjct  66   ISTVDSQPASVTGGIVVFVSGSLQLPGENHPLQFSQMFHLSPTPQGNFFVLNDIFRLNY  124



>ref|XP_010025298.1| PREDICTED: nuclear transport factor 2-like [Eucalyptus grandis]
Length=108

 Score =   177 bits (450),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR AL +LYQ+ SMLTFEGQKIQGS  IVAK TSLPFQ C
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAALCNLYQEGSMLTFEGQKIQGSPGIVAKPTSLPFQLC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHL  347
            QH+ITTVDCQPSGPAGGMLVFVSG LQ+AGEQHALKFSQ+  L
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQVAGEQHALKFSQVVAL  103



>gb|KJB30875.1| hypothetical protein B456_005G165500 [Gossypium raimondii]
Length=102

 Score =   177 bits (448),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 1/101 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMF  341
            +H ITTVDCQPSG +GGMLVFVSG LQLAGEQHALKFSQ+F
Sbjct  61   KHNITTVDCQPSG-SGGMLVFVSGNLQLAGEQHALKFSQVF  100



>ref|XP_009417248.1| PREDICTED: nuclear transport factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=151

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 102/142 (72%), Gaps = 11/142 (8%)
 Frame = +3

Query  15   TDGGGGAKMDPD-----------ALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQK  161
            T   GGA+MD D            + KAFV+HYY++FD+NR AL  LY   SML+FEGQK
Sbjct  10   TSTTGGARMDKDQGKREMEEQLEMVTKAFVDHYYNLFDTNRAALACLYDQTSMLSFEGQK  69

Query  162  IQGSQNIVAKLTSLPFQQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMF  341
            I G+  I  KL+ LPF+QC H+I+TVDCQPS   GG+LVFV+G LQLAGE+H L+FSQMF
Sbjct  70   ILGADEISRKLSQLPFEQCNHSISTVDCQPSPLVGGILVFVTGNLQLAGEEHQLRFSQMF  129

Query  342  HLMPTPQGSFYVYNDIFRLNYA  407
             L+PT Q SF+V NDIFRLNY 
Sbjct  130  QLIPTQQASFFVQNDIFRLNYC  151



>gb|KCW61931.1| hypothetical protein EUGRSUZ_H04629 [Eucalyptus grandis]
Length=128

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR AL +LYQ+ SMLTFEGQKIQGS  IVAK TSLPFQ C
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAALCNLYQEGSMLTFEGQKIQGSPGIVAKPTSLPFQLC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYN  383
            QH+ITTVDCQPSGPAGGMLVFVSG LQ+AGEQHALKFSQ +        +F V+ 
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQVAGEQHALKFSQHWQKSDELVAAFLVWE  115



>gb|ABR18341.1| unknown [Picea sitchensis]
Length=141

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D +AKAFV+HYY+MFDS+R  L +LY  +S ++FEGQKI+G+ NI  KL +LPF +C+H 
Sbjct  22   DEVAKAFVDHYYNMFDSSRPNLPALYDSSSAMSFEGQKIEGAHNISLKLANLPFHECKHY  81

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            ++T+DCQ SG  GG++VFVSG+LQL GE+H L+FSQMFHL+PTP+GSFYV+NDIFRLNY
Sbjct  82   VSTIDCQSSGVPGGIIVFVSGSLQLPGEEHHLRFSQMFHLVPTPEGSFYVHNDIFRLNY  140



>ref|XP_010235339.1| PREDICTED: nuclear transport factor 2 [Brachypodium distachyon]
Length=122

 Score =   176 bits (446),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYY  FD+NRGAL  LYQD SMLTFEG K  GS  I  KL SLPFQQC
Sbjct  1    MDPDAVAKAFVQHYYQTFDANRGALVGLYQDGSMLTFEGDKFLGSAAIAGKLGSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I TVDCQPSGP GG+LVFVSG +     +H LKFSQMFHL+P   GSFYV ND+FRL
Sbjct  61   HHKIDTVDCQPSGPQGGVLVFVSGAITTGPGEHPLKFSQMFHLLPA-GGSFYVQNDMFRL  119

Query  399  NYA  407
            NY 
Sbjct  120  NYG  122



>ref|XP_001765346.1| predicted protein [Physcomitrella patens]
 gb|EDQ69809.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   176 bits (446),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD L+K FVEHYY+ FD+NR AL  LYQ+ SMLTFEG+KI+G+Q I  KL  L FQQC
Sbjct  1    MDPDTLSKTFVEHYYNTFDTNRPALIGLYQEGSMLTFEGEKIKGAQAISNKLNGLGFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQPSG    M+VFVSG LQL GE+H LKFSQMFHL+P   G+++V+NDIFRL
Sbjct  61   KHHISTVDCQPSGLLDSMIVFVSGNLQLPGEEHMLKFSQMFHLVPA-NGTYFVFNDIFRL  119

Query  399  NYA  407
            NYA
Sbjct  120  NYA  122



>gb|KJB69325.1| hypothetical protein B456_011G016400 [Gossypium raimondii]
Length=124

 Score =   176 bits (445),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D++ KAFV+HYY +FD++R A+ SLYQ  SMLTFEGQK+QG ++I+ KLT LP  QC+H 
Sbjct  6    DSVGKAFVDHYYHLFDNDRPAMSSLYQPTSMLTFEGQKLQGVEDIITKLTQLPLDQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+TVD QP+   GG++VFVSG+LQL GE H L+FSQMFHL PTPQG+F+V NDIFRLNY
Sbjct  66   ISTVDSQPASVTGGIVVFVSGSLQLPGENHPLQFSQMFHLSPTPQGNFFVLNDIFRLNY  124



>emb|CDO99715.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV+HYY +FD++R +L  LYQ  SMLTFEGQKIQG+ NI+AKL  LPFQQC H 
Sbjct  6    EMVGKAFVDHYYHLFDNDRPSLALLYQPTSMLTFEGQKIQGTDNIIAKLVQLPFQQCHHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D Q S  AGG+LVFVSGTLQL GE H L+FSQMFHL+PT +GSF+V NDIFRLNY
Sbjct  66   ISTIDSQLSSFAGGILVFVSGTLQLQGEDHPLRFSQMFHLIPTVEGSFFVLNDIFRLNY  124



>ref|XP_001753949.1| predicted protein [Physcomitrella patens]
 gb|EDQ81271.1| predicted protein [Physcomitrella patens]
Length=123

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD D L++ FVEHYY+ FD++R  L   YQ+ SMLTFEG K QG++ I  KL +L FQQC
Sbjct  1    MDLDTLSRMFVEHYYNTFDTSRETLAVWYQEQSMLTFEGNKTQGAEAISDKLNALGFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            +H I+TVDCQ SGP+GG++VFV+G LQL  E+H LKFSQMFHL+PT +GSFY++ND+FRL
Sbjct  61   KHNISTVDCQLSGPSGGVIVFVTGNLQLPDEEHLLKFSQMFHLIPTLEGSFYIFNDMFRL  120

Query  399  NYA  407
            NYA
Sbjct  121  NYA  123



>gb|KJB30874.1| hypothetical protein B456_005G165500 [Gossypium raimondii]
Length=98

 Score =   174 bits (441),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ  335
            +H ITTVDCQPSG +GGMLVFVSG LQLAGEQHALKFSQ
Sbjct  61   KHNITTVDCQPSG-SGGMLVFVSGNLQLAGEQHALKFSQ  98



>gb|KJB30876.1| hypothetical protein B456_005G165500 [Gossypium raimondii]
Length=105

 Score =   174 bits (441),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYYS FD+NR  L +LYQ+ SMLTFEGQKIQGSQ+IVAKLTSLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYSTFDANRAGLANLYQEGSMLTFEGQKIQGSQSIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ  335
            +H ITTVDCQPSG +GGMLVFVSG LQLAGEQHALKFSQ
Sbjct  61   KHNITTVDCQPSG-SGGMLVFVSGNLQLAGEQHALKFSQ  98



>ref|XP_006826470.1| hypothetical protein AMTR_s00004p00233810 [Amborella trichopoda]
 gb|ERM93707.1| hypothetical protein AMTR_s00004p00233810 [Amborella trichopoda]
Length=154

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +AKAFV+HYY+ FD+ R  LG LY   S+L+FEGQ ++G  +IV KLT LPF QC+H 
Sbjct  35   EMVAKAFVDHYYNTFDNGRALLGPLYAATSLLSFEGQMVKGVADIVQKLTQLPFDQCRHH  94

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPSGPAGG+LVFVSG LQL GE+H L+FSQMFHL+PTP GSF+V NDIFRLNY
Sbjct  95   ISTIDSQPSGPAGGILVFVSGNLQLPGEEHHLRFSQMFHLIPTPPGSFFVQNDIFRLNY  153



>ref|XP_008224788.1| PREDICTED: nuclear transport factor 2 [Prunus mume]
Length=125

 Score =   173 bits (439),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD+ R +L SLYQ  SML+FEGQKI G  +I +KL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYHLFDTERASLSSLYQPTSMLSFEGQKIFGVDDITSKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+TVD QPS P GG++VFVSG+LQL GE+H L+FSQMFHL+PTPQGSF++ NDIFRLNY
Sbjct  66   ISTVDSQPSSPTGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPTPQGSFFLQNDIFRLNY  124



>ref|XP_004293267.1| PREDICTED: nuclear transport factor 2 [Fragaria vesca subsp. 
vesca]
Length=125

 Score =   173 bits (439),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FDS+R +L +LYQ  SML+FEGQKI G  +I AKL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYLLFDSDRASLSALYQPTSMLSFEGQKIFGVDDISAKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+TVD QPS   GG++VFVSG+LQL+GE+H L+FSQMFHL+PTPQGSF+V NDIFRLNY
Sbjct  66   ISTVDSQPSSTTGGIVVFVSGSLQLSGEEHLLRFSQMFHLIPTPQGSFFVQNDIFRLNY  124



>ref|XP_007214294.1| hypothetical protein PRUPE_ppb011119mg [Prunus persica]
 gb|EMJ15493.1| hypothetical protein PRUPE_ppb011119mg [Prunus persica]
Length=125

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD+ R +L SLYQ  SML+FEGQKI G  +I +KL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYHLFDTERASLSSLYQPTSMLSFEGQKIFGVDDITSKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS P GG++VFVSG+LQL GE+H L+FSQMFHL+PTPQGSF++ NDIFRLNY
Sbjct  66   ISTIDSQPSSPTGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPTPQGSFFLQNDIFRLNY  124



>ref|XP_009357411.1| PREDICTED: nuclear transport factor 2-like [Pyrus x bretschneideri]
 ref|XP_009340943.1| PREDICTED: nuclear transport factor 2-like [Pyrus x bretschneideri]
Length=125

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD++R +L SLYQ +SML+FEGQK+ G+ +I +KL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYHLFDTDRASLSSLYQPSSMLSFEGQKLFGANDISSKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS P+GG++VFVSG+LQL GE+H L+FSQMFHL+PTP+G+F+V NDIFRLNY
Sbjct  66   ISTIDSQPSSPSGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPTPEGTFFVQNDIFRLNY  124



>ref|XP_010926831.1| PREDICTED: nuclear transport factor 2 isoform X3 [Elaeis guineensis]
Length=109

 Score =   172 bits (437),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQD SMLTFEG K QG+Q I AKL SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLANLYQDGSMLTFEGAKTQGAQAIAAKLASLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFH  344
             H I+TVDCQPSGPAGGM+VFVSG+LQLAGEQH LKFSQ+ H
Sbjct  61   MHNISTVDCQPSGPAGGMVVFVSGSLQLAGEQHPLKFSQVLH  102



>ref|XP_002444696.1| hypothetical protein SORBIDRAFT_07g026170 [Sorghum bicolor]
 gb|EES14191.1| hypothetical protein SORBIDRAFT_07g026170 [Sorghum bicolor]
Length=122

 Score =   173 bits (438),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYY  FD+NR AL  LYQ+ SMLTFEG K QG   I  KL SLPFQ C
Sbjct  1    MDPDAVAKAFVDHYYQTFDTNRPALVGLYQETSMLTFEGHKFQGPAAIAGKLGSLPFQAC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH I TVDCQPSGP GG+LVFVSG+++   E H LKFSQ FHL+P   GSF+V ND+FRL
Sbjct  61   QHKIDTVDCQPSGPQGGVLVFVSGSIRTGPEDHPLKFSQAFHLLPA-AGSFFVQNDMFRL  119

Query  399  NY  404
            NY
Sbjct  120  NY  121



>ref|XP_008384036.1| PREDICTED: nuclear transport factor 2-like [Malus domestica]
Length=125

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD++R +L SLYQ +SML+FEGQK+ G+ +I +KL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYHLFDTDRASLSSLYQPSSMLSFEGQKLFGANDISSKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS P+GG++VFVSG+L+L GE+H L+FSQMFHL+PTP+G+F+V NDIFRLNY
Sbjct  66   ISTIDSQPSSPSGGIVVFVSGSLELPGEEHHLRFSQMFHLIPTPEGTFFVQNDIFRLNY  124



>ref|NP_001062338.1| Os08g0532300 [Oryza sativa Japonica Group]
 sp|Q9XJ54.1|NTF2_ORYSJ RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Oryza 
sativa Japonica Group]
 dbj|BAA81910.1| nuclear transport factor 2 (NTF2) [Oryza sativa Japonica Group]
 dbj|BAD11649.1| nuclear transport factor 2 (NTF-2) [Oryza sativa Japonica Group]
 dbj|BAF24252.1| Os08g0532300 [Oryza sativa Japonica Group]
 gb|EAZ07769.1| hypothetical protein OsI_30022 [Oryza sativa Indica Group]
 gb|EAZ43455.1| hypothetical protein OsJ_28061 [Oryza sativa Japonica Group]
 dbj|BAG89385.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99769.1| unnamed protein product [Oryza sativa Japonica Group]
Length=122

 Score =   171 bits (434),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD DA+AKAFVEHYY  FD+NR AL SLYQD SMLTFEGQ+  G+  I  KL SLPF QC
Sbjct  1    MDADAVAKAFVEHYYRTFDTNRPALVSLYQDGSMLTFEGQQFLGAAAIAGKLGSLPFAQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I TVDCQPSGP GGMLVFVSG+L+   ++H LKFSQMF L+P   G+FYV ND+FRL
Sbjct  61   HHDINTVDCQPSGPQGGMLVFVSGSLRTGPDEHPLKFSQMFQLLPA-GGNFYVQNDMFRL  119

Query  399  NY  404
            NY
Sbjct  120  NY  121



>ref|XP_008349288.1| PREDICTED: nuclear transport factor 2-like [Malus domestica]
Length=125

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD++R  L SLYQ +SML+FEGQK+ G+ +I +KL  LPF QC+H 
Sbjct  6    EMVGRAFVDHYYHLFDTDRAXLSSLYQPSSMLSFEGQKLFGANDISSKLNQLPFDQCKHL  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS P+GG++VFVSG+L+L GE+H L+FSQMFHL+PTP+G+F+V NDIFRLNY
Sbjct  66   ISTIDSQPSSPSGGIVVFVSGSLELPGEEHHLRFSQMFHLIPTPEGTFFVQNDIFRLNY  124



>ref|XP_009769269.1| PREDICTED: nuclear transport factor 2 [Nicotiana sylvestris]
 ref|XP_009769270.1| PREDICTED: nuclear transport factor 2 [Nicotiana sylvestris]
Length=125

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY++FD++R ++G+LYQ +SML+FEGQK+QGS++I AKL +LPF QC+HA
Sbjct  6    EMVGRAFVDHYYNLFDNDRSSIGTLYQPSSMLSFEGQKLQGSEDISAKLNALPFGQCRHA  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  +GG++VFVSG++QL GE + L+FSQMFHL+PT +GSF+V NDIFRLNY
Sbjct  66   ISTIDSQPSSFSGGVIVFVSGSIQLLGEDYPLRFSQMFHLIPTMEGSFFVQNDIFRLNY  124



>gb|EPS58345.1| hypothetical protein M569_16470, partial [Genlisea aurea]
Length=101

 Score =   170 bits (430),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFV+HYYS FD+NR  L  LYQD+SMLTFEGQ+I G+QNI AKL +LPFQQC
Sbjct  3    MDPDAVAKAFVDHYYSTFDANRAGLAVLYQDSSMLTFEGQQILGAQNISAKLNALPFQQC  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ  335
            QH I+TVDCQPSGPAGG+LVFVSG LQLAGEQH+L+FSQ
Sbjct  63   QHHISTVDCQPSGPAGGVLVFVSGNLQLAGEQHSLRFSQ  101



>ref|XP_007025997.1| NTF2-like [Theobroma cacao]
 gb|EOY28619.1| NTF2-like [Theobroma cacao]
Length=125

 Score =   170 bits (431),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + KAFV+HYY +FD++R AL SLYQ  SMLTFEGQKIQG  +I AKL  LPF QC+H 
Sbjct  6    DLVGKAFVDHYYHLFDNDRPALSSLYQPTSMLTFEGQKIQGVDDIAAKLNQLPFDQCRHE  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QP    GG++VFVSG+LQL GE+H L+FSQMFHL+P  QGSF+V NDIFRLNY
Sbjct  66   ISTIDSQPCSFTGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPMLQGSFFVQNDIFRLNY  124



>ref|XP_002518524.1| nuclear transport factor, putative [Ricinus communis]
 gb|EEF43911.1| nuclear transport factor, putative [Ricinus communis]
Length=125

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV HYY++FD++R +L SLY  +SMLTFEGQKI G  +I +KL +LPF QC+HA
Sbjct  6    ETVGKAFVNHYYNLFDNDRSSLASLYHPSSMLTFEGQKILGVDDISSKLNNLPFDQCKHA  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  AGG++VFVSG+LQLAGE+H L+FSQMFHL+P+ QG  +V NDIFRLNY
Sbjct  66   ISTIDTQPSSFAGGIVVFVSGSLQLAGEEHPLRFSQMFHLIPSVQGGLFVQNDIFRLNY  124



>ref|XP_004232740.1| PREDICTED: nuclear transport factor 2 [Solanum lycopersicum]
Length=125

 Score =   169 bits (427),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY++FD++R ++G+LYQ +SM +FEGQK+ GS++I AKL +LPF QC+H 
Sbjct  6    EIVGRAFVDHYYNLFDNDRSSVGALYQPSSMFSFEGQKLLGSEDISAKLNALPFGQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  AGG++VFVSG++QL GE H L+FSQMFHL+PT +GSF+V NDIFRLNY
Sbjct  66   ISTIDSQPSSFAGGIIVFVSGSIQLLGEDHPLRFSQMFHLIPTVEGSFFVQNDIFRLNY  124



>ref|XP_010926828.1| PREDICTED: nuclear transport factor 2 isoform X1 [Elaeis guineensis]
Length=129

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FDSNR  L +LYQD SMLTFEG K QG+Q I AKL SLPFQQC
Sbjct  1    MDPDAVAKAFVEHYYRTFDSNRAGLANLYQDGSMLTFEGAKTQGAQAIAAKLASLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ-------MFHLMPTP  359
             H I+TVDCQPSGPAGGM+VFVSG+LQLAGEQH LKFSQ        + L+P P
Sbjct  61   MHNISTVDCQPSGPAGGMVVFVSGSLQLAGEQHPLKFSQDIPILDGAYMLLPEP  114



>ref|XP_006348083.1| PREDICTED: nuclear transport factor 2-like [Solanum tuberosum]
Length=125

 Score =   168 bits (425),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY++FD++R ++G+LYQ +SM +FEGQK+ G+++I AKL +LPF QC+H 
Sbjct  6    EIVGRAFVDHYYNLFDNDRSSIGTLYQPSSMFSFEGQKLLGNEDISAKLNALPFGQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  AGG++VFVSG++QL GE H L+FSQMFHL+PT +GSF+V NDIFRLNY
Sbjct  66   ISTIDSQPSSFAGGIIVFVSGSIQLLGEDHPLRFSQMFHLIPTVEGSFFVQNDIFRLNY  124



>ref|XP_009759023.1| PREDICTED: nuclear transport factor 2-like [Nicotiana sylvestris]
Length=153

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            M+PDA+A AFVEHYYS FDSNR  L +LYQ+ SML+FEG KIQG+Q+IVAKLTSLPFQQC
Sbjct  1    MNPDAVATAFVEHYYSTFDSNRAGLANLYQENSMLSFEGVKIQGAQHIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMF  341
            +H I TVDCQPSGP GGMLVFVSG LQL GE+H LKFSQ+F
Sbjct  61   KHQINTVDCQPSGPIGGMLVFVSGNLQLPGEEHVLKFSQVF  101



>gb|KHG02820.1| Nuclear transport factor 2 -like protein [Gossypium arboreum]
Length=124

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + KAFV+HYY +FD++R AL SLY+ +S LTFEG KIQG ++I AKL SLPF QC+H 
Sbjct  6    DLVGKAFVDHYYHLFDNDRPALSSLYKPSSTLTFEGHKIQGVEDITAKLISLPFDQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  +GG++VF+SG+LQL+GE+H L+FSQMFHL+P  +G+FYV NDIFRLNY
Sbjct  66   ISTIDSQPSF-SGGIVVFISGSLQLSGEEHHLRFSQMFHLIPMLEGNFYVQNDIFRLNY  123



>ref|XP_009589959.1| PREDICTED: nuclear transport factor 2 [Nicotiana tomentosiformis]
Length=125

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY++FD++R ++ +LYQ +SML+FEGQK+ GS++I +KL +LPF QC+H 
Sbjct  6    ELVGRAFVDHYYNLFDNDRSSISTLYQPSSMLSFEGQKLHGSEDISSKLNALPFGQCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  AG ++VFVSG++QL GE H L+FSQMFHL+PT +GSF+V NDIFRLNY
Sbjct  66   ISTIDSQPSAFAGAIIVFVSGSIQLLGEDHPLRFSQMFHLIPTVEGSFFVQNDIFRLNY  124



>gb|KDP20787.1| hypothetical protein JCGZ_21258 [Jatropha curcas]
Length=125

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV HYY +FD++R AL SLYQ +SML+FEGQKI G  +I AKL  LPF QC+H 
Sbjct  6    ELIGKAFVNHYYQLFDNDRLALASLYQPSSMLSFEGQKILGVNDISAKLNDLPFDQCKHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  AGG++VFVSG+LQL GE+H L+FSQMFHL+P  QG  +V NDIFRLNY
Sbjct  66   ISTIDSQPSSFAGGIVVFVSGSLQLPGEEHLLRFSQMFHLIPEQQGGLFVQNDIFRLNY  124



>ref|XP_006438005.1| hypothetical protein CICLE_v10033081mg [Citrus clementina]
 gb|ESR51245.1| hypothetical protein CICLE_v10033081mg [Citrus clementina]
Length=105

 Score =   164 bits (415),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY+ FD+NR  L +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLA  305
            QH+ITTVDCQPSGPAGGMLVFVSG LQLA
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVSGNLQLA  89



>ref|XP_011086173.1| PREDICTED: nuclear transport factor 2 [Sesamum indicum]
Length=125

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV+HYY +FD+NR AL SLYQ  SMLTFEGQ+I G   I AKL  LPF QC H 
Sbjct  6    EMVGKAFVDHYYHLFDNNRTALLSLYQPTSMLTFEGQRIHGVDGISAKLNQLPFDQCCHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+TVD Q S  AGG++VFVSG+LQL GE+H L+FSQMFHL+PT QGS++V ND+FRLNY
Sbjct  66   ISTVDSQVSAFAGGIVVFVSGSLQLQGEEHPLRFSQMFHLIPTGQGSYFVQNDMFRLNY  124



>ref|XP_002267081.2| PREDICTED: nuclear transport factor 2 [Vitis vinifera]
Length=140

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = +3

Query  21   GGGGAKMDP--DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKL  194
            G G  +M+   + L +AFV+HYY +FD++R +L SLY   SMLTFEG K+QG   I  KL
Sbjct  10   GRGREEMEEQVEGLGRAFVDHYYYLFDNDRSSLPSLYHSTSMLTFEGHKVQGVDEISQKL  69

Query  195  TSLPFQQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFY  374
              LPF QCQH I+T+D QPS   GG++VFVSG+L+L GE+H L+FSQMFHL+P+ +GSF+
Sbjct  70   NLLPFDQCQHVISTIDSQPSSFTGGIMVFVSGSLKLPGEEHQLRFSQMFHLVPSSEGSFF  129

Query  375  VYNDIFRLNYA  407
            V NDIFRLNY 
Sbjct  130  VQNDIFRLNYG  140



>ref|XP_008803212.1| PREDICTED: nuclear transport factor 2 [Phoenix dactylifera]
Length=133

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
            G +   + +AKAFV HYY +FD+NR AL  LY   SML+FEGQKIQG++ I  KL  LPF
Sbjct  8    GVEDQLEMVAKAFVNHYYHLFDTNRAALAPLYHHTSMLSFEGQKIQGAEEIGQKLAQLPF  67

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            + C+H I+T+D QPS   GG+LVFVSG LQL GE+H LKFSQMF L+PT  GSF+V ND+
Sbjct  68   EHCRHFISTIDSQPSPFGGGILVFVSGNLQLQGEEHQLKFSQMFQLIPTQHGSFFVQNDM  127

Query  390  FRLNY  404
            FRLNY
Sbjct  128  FRLNY  132



>ref|XP_010533830.1| PREDICTED: nuclear transport factor 2 [Tarenaya hassleriana]
Length=133

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFVEHYYS+FD +R +L  LY   SMLTFEGQKI G+++I  KL  LPF QC+H 
Sbjct  10   EEVGKAFVEHYYSLFDKDRSSLSCLYDSTSMLTFEGQKINGAEDISNKLNHLPFDQCRHL  69

Query  228  ITTVDCQP----SGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFR  395
            I+TVDCQP     G   G++VFVSG+LQL GE+H L+FSQMF L+PTPQGSF+V NDIFR
Sbjct  70   ISTVDCQPSSLSGGGGCGIVVFVSGSLQLQGEEHPLRFSQMFQLIPTPQGSFFVQNDIFR  129

Query  396  LNY  404
            LNY
Sbjct  130  LNY  132



>ref|XP_002317209.2| hypothetical protein POPTR_0011s00470g [Populus trichocarpa]
 gb|EEE97821.2| hypothetical protein POPTR_0011s00470g [Populus trichocarpa]
Length=146

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV+HYY++FD++R +L SLYQ  SMLTFEGQKI G ++I  KL +LPF  C+H 
Sbjct  27   EVVGKAFVDHYYNLFDNDRSSLASLYQPTSMLTFEGQKIVGVEDISCKLNNLPFGNCKHI  86

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            I+T+D QPS   GG++VFVSG+LQL GE+H L+FSQMFHL+PT  G F+V ND FRLNY 
Sbjct  87   ISTIDSQPSAHGGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPTQDGCFFVQNDFFRLNYG  146



>ref|XP_006449086.1| hypothetical protein CICLE_v10016912mg [Citrus clementina]
 gb|ESR62326.1| hypothetical protein CICLE_v10016912mg [Citrus clementina]
Length=177

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + K FV HYY +FD++R +L SLYQ  SMLTFEGQKI G  +I  K   LPF QC+H 
Sbjct  58   ELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKIFGVDDISTKFNQLPFDQCRHM  117

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QP    GG+L+FVSG+LQLAGE H L+FSQMFHL+PTP+GSF V NDIFRLNY
Sbjct  118  ISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY  176



>ref|XP_010930886.1| PREDICTED: nuclear transport factor 2-like [Elaeis guineensis]
Length=132

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
            G +   + +AKAFV HYY +FD+NR AL +LY   SML+FEGQK  G ++I  KLT LPF
Sbjct  7    GIEEQHEMVAKAFVNHYYHLFDTNRAALATLYHHTSMLSFEGQKFLGVEDIGRKLTQLPF  66

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            +QC+H I+T+D Q S   GG+LVFVSG LQL+GE+H LKFSQMF L+P P GSF V NDI
Sbjct  67   EQCKHFISTIDSQLSPFGGGILVFVSGNLQLSGEEHQLKFSQMFQLIPLPHGSFCVQNDI  126

Query  390  FRLNY  404
            FRLNY
Sbjct  127  FRLNY  131



>ref|XP_004145100.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus]
Length=132

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +3

Query  30   GAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPF  209
            G + + D + KAFVEHYY +FD+ R +L SLYQ  SMLTFEGQ+I G  +I +KL  LPF
Sbjct  7    GMEEEGDIIGKAFVEHYYQLFDNERASLSSLYQPDSMLTFEGQQILGVHDISSKLQQLPF  66

Query  210  QQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            ++C+H ++T+D QPS   G +L+FVSG++++  E+H L+FSQMFHL+P+P+G+ +V NDI
Sbjct  67   ERCRHVVSTIDTQPSSVHGSILIFVSGSIEIPEEEHPLRFSQMFHLVPSPEGNLFVQNDI  126

Query  390  FRLNY  404
            FRLNY
Sbjct  127  FRLNY  131



>ref|XP_006644825.1| PREDICTED: nuclear transport factor 2-like [Oryza brachyantha]
Length=142

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 3/121 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D +A+AFVE+YY  FD+NR AL +LY   SML+FEG  + G++ I  KL +LPF+QC+HA
Sbjct  22   DVVARAFVEYYYQTFDANRAALAALYGHTSMLSFEGHMVAGAEEIGRKLAALPFEQCRHA  81

Query  228  ITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            + TVDCQP+ P+  GG+LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFRLN
Sbjct  82   VCTVDCQPT-PSFPGGILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFRLN  140

Query  402  Y  404
            Y
Sbjct  141  Y  141



>dbj|BAK07582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=140

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 3/121 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + +AFVE+YY MFD+NRGAL SLY   S+L+FEG ++ G+  I  KL  LPF+QC+H+
Sbjct  20   DVVGRAFVEYYYQMFDANRGALASLYGGTSVLSFEGHRVAGAGEIGLKLAQLPFEQCRHS  79

Query  228  ITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            I T+DCQP+ P+  GG+LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFRLN
Sbjct  80   ICTIDCQPT-PSFPGGILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFRLN  138

Query  402  Y  404
            Y
Sbjct  139  Y  139



>ref|XP_006467992.1| PREDICTED: nuclear transport factor 2-like [Citrus sinensis]
 gb|KDO75537.1| hypothetical protein CISIN_1g033171mg [Citrus sinensis]
Length=125

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + K FV HYY +FD++R +L SLYQ  SMLTFEGQK  G  +I  K   LPF QC+H 
Sbjct  6    ELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHM  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QP    GG+L+FVSG+LQLAGE H L+FSQMFHL+PTP+GSF V NDIFRLNY
Sbjct  66   ISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY  124



>ref|XP_004153658.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus]
 gb|KGN64547.1| hypothetical protein Csa_1G064690 [Cucumis sativus]
Length=125

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + KAFVEHYY +FD+ R +L SLYQ  SMLTFEGQ+I G  +I +KL  LPF++C+H 
Sbjct  6    DIIGKAFVEHYYQLFDNERASLSSLYQPDSMLTFEGQQILGVHDISSKLQQLPFERCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            ++T+D QPS   G +L+FVSG++++  E+H L+FSQMFHL+P+P+G+ +V NDIFRLNY
Sbjct  66   VSTIDTQPSSVHGSILIFVSGSIEIPEEEHPLRFSQMFHLVPSPEGNLFVQNDIFRLNY  124



>ref|XP_011000696.1| PREDICTED: nuclear transport factor 2 [Populus euphratica]
Length=146

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV+HYY++FD++R +L SLYQ  SMLTFEGQKI G+ +I  KL +LPF  C+H 
Sbjct  27   EVVGKAFVDHYYNLFDNDRSSLASLYQPTSMLTFEGQKIVGAVDISCKLNNLPFGNCKHM  86

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            I+T+D QPS   GG++VFVSG+LQL GE+H L+FSQMFHL+PT  G F+V ND FRLNY 
Sbjct  87   ISTIDSQPSAYGGGIVVFVSGSLQLPGEEHHLRFSQMFHLIPTQDGCFFVQNDFFRLNYG  146



>ref|XP_010665517.1| PREDICTED: nuclear transport factor 2 [Beta vulgaris subsp. vulgaris]
Length=124

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD+ R +L +LY  AS+L FEGQK QG + I +KL  LPF QC+HA
Sbjct  5    EGVGRAFVDHYYHLFDNERPSLITLYHPASLLNFEGQKFQGIEEISSKLNGLPFDQCRHA  64

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            I+T+D QPS   GG++VFVSG+LQL GE+H L+FSQMFHL+PT QGS+ V NDIFRLNY 
Sbjct  65   ISTIDSQPSSINGGIVVFVSGSLQLTGEEHQLRFSQMFHLIPTGQGSYAVQNDIFRLNYC  124



>ref|XP_008441397.1| PREDICTED: nuclear transport factor 2 [Cucumis melo]
Length=126

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + KAFVEHYY +FD+ R +L SLYQ  SMLTFEGQ+I G  +I  KL  LPF++C+H 
Sbjct  7    DIIGKAFVEHYYHLFDNERASLSSLYQPDSMLTFEGQQILGVNDISTKLQQLPFERCRHV  66

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            ++T+D QPS   G +L+FVSG++++  E+H L++SQMFHL+P+PQG+ +V NDIFRLNY
Sbjct  67   VSTIDTQPSSVPGSILIFVSGSIEIPEEEHPLRYSQMFHLVPSPQGNLFVQNDIFRLNY  125



>ref|NP_001044479.1| Os01g0788200 [Oryza sativa Japonica Group]
 dbj|BAB90110.1| putative nuclear transport factor Ntf2p [Oryza sativa Japonica 
Group]
 dbj|BAF06393.1| Os01g0788200 [Oryza sativa Japonica Group]
 gb|EEC71616.1| hypothetical protein OsI_04028 [Oryza sativa Indica Group]
 gb|EEE55511.1| hypothetical protein OsJ_03719 [Oryza sativa Japonica Group]
Length=146

 Score =   160 bits (406),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D +A+AFVE+YY  FD+NR AL +LY   SML+FEG  + G++ I  KL  LPF+QC+HA
Sbjct  26   DVVARAFVEYYYQTFDTNRAALAALYGQTSMLSFEGHMVAGAEEIGRKLLGLPFEQCRHA  85

Query  228  ITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            + TVDCQP+ P+  GG+LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFRLN
Sbjct  86   VCTVDCQPT-PSFPGGILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFRLN  144

Query  402  Y  404
            Y
Sbjct  145  Y  145



>ref|XP_003564383.1| PREDICTED: nuclear transport factor 2-like [Brachypodium distachyon]
Length=141

 Score =   160 bits (406),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 4/132 (3%)
 Frame = +3

Query  15   TDGGGGAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKL  194
            +DG GG   + D +A+AFVE+YY  FD++R AL +LY   SML+FEG ++ G++ I  KL
Sbjct  11   SDGNGGGS-EHDVVARAFVEYYYHTFDTDRAALAALYGSTSMLSFEGHRVAGAEEIGTKL  69

Query  195  TSLPFQQCQHAITTVDCQ--PSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGS  368
              LPF+QC+H++ TVDCQ  PS PA G+LVFVSG L+LAGE+H L+FSQMF L+P   GS
Sbjct  70   AQLPFEQCRHSVVTVDCQPTPSFPA-GILVFVSGNLRLAGEEHQLRFSQMFQLVPNEHGS  128

Query  369  FYVYNDIFRLNY  404
            F+V NDIFRLNY
Sbjct  129  FFVQNDIFRLNY  140



>gb|EMT17766.1| Nuclear transport factor 2 [Aegilops tauschii]
Length=137

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            + D + +AFVE+YY  FD+NRGAL +LY   S+L+FEG ++ G++ I  KL  LPF+QC+
Sbjct  15   ECDVVGRAFVEYYYQTFDANRGALATLYGGTSVLSFEGHRVAGAEEIGLKLAQLPFEQCR  74

Query  222  HAITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFR  395
            H+I T+DCQP+ P+  GG+LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFR
Sbjct  75   HSICTIDCQPT-PSFPGGILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFR  133

Query  396  LNY  404
            LNY
Sbjct  134  LNY  136



>ref|XP_009601176.1| PREDICTED: nuclear transport factor 2-like isoform X3 [Nicotiana 
tomentosiformis]
Length=109

 Score =   159 bits (402),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+++AKAFV+HYYS FD+NR AL +LYQ++SML+FEGQK QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPESVAKAFVDHYYSTFDTNRAALANLYQESSMLSFEGQKYQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSF  371
            +H I+T DCQ SG + GMLVFVSG LQ+ GE+H LKFSQM  L+    GSF
Sbjct  61   KHHISTTDCQLSG-SNGMLVFVSGNLQIPGEEHPLKFSQM--LLDLVDGSF  108



>emb|CDM84518.1| unnamed protein product [Triticum aestivum]
Length=140

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            + D + +AFVE+YY  FD+NRGAL +LY   S+L+FEG ++ G+  I  KL  LPF+QC+
Sbjct  18   ECDVVGRAFVEYYYQTFDANRGALATLYGGTSVLSFEGHRVAGAAEIGLKLAQLPFEQCR  77

Query  222  HAITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFR  395
            H+I T+DCQP+ P+  GG+LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFR
Sbjct  78   HSICTIDCQPT-PSFPGGILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFR  136

Query  396  LNY  404
            LNY
Sbjct  137  LNY  139



>ref|XP_004970220.1| PREDICTED: nuclear transport factor 2-like [Setaria italica]
Length=232

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            DA+A+AFVE+YY+ FD++RGAL +LY   SML+FEG  + G++ I  KL  LPF QC+H+
Sbjct  112  DAVARAFVEYYYNTFDASRGALAALYGHTSMLSFEGHAVAGAEAIGRKLAQLPFDQCRHS  171

Query  228  ITTVDCQPSGP-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I TVDCQPS    G +LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFRLNY
Sbjct  172  ICTVDCQPSPSFPGSILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFRLNY  231



>ref|XP_010052820.1| PREDICTED: nuclear transport factor 2 [Eucalyptus grandis]
 gb|KCW76932.1| hypothetical protein EUGRSUZ_D01295 [Eucalyptus grandis]
Length=125

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + +AFV+HYY +FD++R AL SLYQ  SMLTFEGQK+ G+  I  K   LPF +CQH 
Sbjct  6    ELVGRAFVDHYYQLFDTDRAALSSLYQPTSMLTFEGQKVLGAHAISEKFMQLPFDKCQHH  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            I+T+D QPS  +GG++VFVSG+L L GE+H L+F QMFHL+P+  GSF+V ND+FRLNY
Sbjct  66   ISTIDSQPSSTSGGIVVFVSGSLALPGEEHQLRFGQMFHLIPSTGGSFFVQNDMFRLNY  124



>ref|XP_009110722.1| PREDICTED: nuclear transport factor 2 [Brassica rapa]
 emb|CDY21000.1| BnaA08g25250D [Brassica napus]
Length=133

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A+AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF QC+H 
Sbjct  11   EEVARAFVNHYYHLFDNDRSSLSTLYNPTSLLTFEGQKIYGVEDIFNKLKQLPFDQCRHL  70

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG++QL GE H L+FSQ FHL+P PQGSF++ N++FRL
Sbjct  71   ISTVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLVPLPQGSFFIQNEMFRL  130

Query  399  NY  404
            NY
Sbjct  131  NY  132



>ref|XP_011397956.1| Nuclear transport factor 2 [Auxenochlorella protothecoides]
 gb|KFM25068.1| Nuclear transport factor 2 [Auxenochlorella protothecoides]
Length=122

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            DP+A+AKAF +HYY+ FDSNR  L  LYQD S+L+FEGQK QG+Q IV KL SLPFQ CQ
Sbjct  3    DPEAVAKAFTDHYYATFDSNRANLLGLYQDQSLLSFEGQKFQGAQQIVQKLASLPFQNCQ  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H I++ D QPS  +GG+LVFV+G L   GE + LKFSQ FHL P   GSF V ND+FRLN
Sbjct  63   HRISSTDAQPS-VSGGVLVFVTGQLITEGESNPLKFSQTFHLAPL-NGSFVVTNDLFRLN  120

Query  402  YA  407
            YA
Sbjct  121  YA  122



>gb|KDO81863.1| hypothetical protein CISIN_1g033259mg [Citrus sinensis]
Length=99

 Score =   155 bits (393),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD++AKAFVEHYY+ FD+NR  L +LYQ+ SMLTFEGQKIQGSQNIVAKLTSLPFQQC
Sbjct  1    MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVS  287
            QH+ITTVDCQPSGPAGGMLVFVS
Sbjct  61   QHSITTVDCQPSGPAGGMLVFVS  83



>ref|XP_009601175.1| PREDICTED: nuclear transport factor 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=117

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDP+++AKAFV+HYYS FD+NR AL +LYQ++SML+FEGQK QGSQNIVAKLTSLPFQQC
Sbjct  1    MDPESVAKAFVDHYYSTFDTNRAALANLYQESSMLSFEGQKYQGSQNIVAKLTSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ  335
            +H I+T DCQ SG + GMLVFVSG LQ+ GE+H LKFSQ
Sbjct  61   KHHISTTDCQLSG-SNGMLVFVSGNLQIPGEEHPLKFSQ  98



>gb|EMS66303.1| Nuclear transport factor 2 [Triticum urartu]
Length=137

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            + D + +AFVE+YY  FD NRGAL +LY   S+L+FEG ++ G+  I  KL  LPF+QC+
Sbjct  15   ECDVVGRAFVEYYYQTFDGNRGALAALYGGTSVLSFEGHRVAGAAEIGLKLAQLPFEQCR  74

Query  222  HAITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFR  395
            H+I T+DCQP+ P+  G +LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFR
Sbjct  75   HSICTIDCQPT-PSFPGAILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFR  133

Query  396  LNY  404
            LNY
Sbjct  134  LNY  136



>emb|CDY57043.1| BnaC08g14980D [Brassica napus]
Length=133

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A+AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF QC+H 
Sbjct  11   EEVARAFVNHYYHLFDNDRFSLFTLYSSTSLLTFEGQKIYGVEDIFNKLKQLPFDQCRHL  70

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG++QL GE H L+FSQ FHL+P PQGSF+V N++FRL
Sbjct  71   ISTVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLVPLPQGSFFVQNEMFRL  130

Query  399  NY  404
            NY
Sbjct  131  NY  132



>tpg|DAA57309.1| TPA: hypothetical protein ZEAMMB73_859508 [Zea mays]
Length=136

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  3    ESENTDGGGGAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNI  182
            + +   G  GA  D DA+A+AFV++YY  FD++R AL  LY   SML+FEG  + G++ I
Sbjct  2    DGQGNSGSAGAG-DCDAVARAFVDYYYRTFDASRAALAVLYGQTSMLSFEGHAVAGAEEI  60

Query  183  VAKLTSLPFQQCQHAITTVDCQPSGPA--GGMLVFVSGTLQLAGEQHALKFSQMFHLMPT  356
              KL  LP +QC+HA+ T+D QPS P+  G +LVFVSGTLQLAGE+H L+FSQMF L+P 
Sbjct  61   GRKLAQLPLEQCRHAVCTLDSQPS-PSFPGSVLVFVSGTLQLAGEEHQLRFSQMFQLVPN  119

Query  357  PQGSFYVYNDIFRLNY  404
             QGSF+V NDIFRLNY
Sbjct  120  EQGSFFVQNDIFRLNY  135



>ref|XP_010458557.1| PREDICTED: nuclear transport factor 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010458558.1| PREDICTED: nuclear transport factor 2-like isoform X2 [Camelina 
sativa]
Length=125

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF QC+H+
Sbjct  3    EEVASAFVNHYYHLFDNDRSSLSTLYNATSLLTFEGQKIYGVEDISNKLKQLPFDQCRHS  62

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG++VFVSG+LQL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  63   ISTVDSQPSSIAGGCGGIIVFVSGSLQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  122

Query  399  NY  404
            NY
Sbjct  123  NY  124



>ref|XP_010458556.1| PREDICTED: nuclear transport factor 2-like isoform X1 [Camelina 
sativa]
Length=132

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF QC+H+
Sbjct  10   EEVASAFVNHYYHLFDNDRSSLSTLYNATSLLTFEGQKIYGVEDISNKLKQLPFDQCRHS  69

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG++VFVSG+LQL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  70   ISTVDSQPSSIAGGCGGIIVFVSGSLQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  129

Query  399  NY  404
            NY
Sbjct  130  NY  131



>ref|XP_006304291.1| hypothetical protein CARUB_v10010585mg, partial [Capsella rubella]
 gb|EOA37189.1| hypothetical protein CARUB_v10010585mg, partial [Capsella rubella]
Length=144

 Score =   153 bits (387),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +3

Query  36   KMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQ  215
            K   + +A AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF Q
Sbjct  18   KGSEEEVAIAFVNHYYHLFDNDRSSLSTLYNPTSLLTFEGQKICGVEDISNKLKQLPFDQ  77

Query  216  CQHAITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYND  386
            C+H+I+TVD QPS   G  GG++VFVSG+LQL GE H L+FSQ FHL+P  QGSF+V N+
Sbjct  78   CRHSISTVDSQPSSIAGGCGGIIVFVSGSLQLHGEDHPLRFSQTFHLIPVLQGSFFVQNE  137

Query  387  IFRLNY  404
            +FRLNY
Sbjct  138  MFRLNY  143



>ref|XP_010492974.1| PREDICTED: nuclear transport factor 2-like [Camelina sativa]
Length=132

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L +LY   S+LTFEGQKI G ++I  KL  LPF QC+H+
Sbjct  10   EDVASAFVNHYYHLFDNDRPSLSTLYNPTSLLTFEGQKIYGVEDISNKLKQLPFDQCRHS  69

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG++VFVSG+LQL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  70   ISTVDSQPSSIAGGCGGIIVFVSGSLQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  129

Query  399  NY  404
            NY
Sbjct  130  NY  131



>ref|XP_003687149.1| hypothetical protein TPHA_0I02110 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE64715.1| hypothetical protein TPHA_0I02110 [Tetrapisispora phaffii CBS 
4417]
Length=123

 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD + LA+ F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG++NIV KLTSLPFQ+ 
Sbjct  1    MDFNGLAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETTQLQGTKNIVEKLTSLPFQKV  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P+G +LV ++G L +  EQ+A +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  61   THRITTLDAQPASPSGDVLVMITGDLLIDEEQNAQRFSQVFHLIPEG-NSYYVFNDIFRL  119

Query  399  NYA  407
            NY+
Sbjct  120  NYS  122



>ref|NP_001154326.1| nuclear transport factor 2-like protein [Arabidopsis thaliana]
 gb|AEE28753.1| nuclear transport factor 2-like protein [Arabidopsis thaliana]
Length=132

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L SLY   S+LTFEGQ I G  NI  KL  LPF QC H 
Sbjct  10   EEVASAFVNHYYHLFDNDRSSLSSLYNPTSLLTFEGQTIYGVDNISNKLKQLPFDQCHHL  69

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG++QL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  70   ISTVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  129

Query  399  NY  404
            NY
Sbjct  130  NY  131



>ref|XP_006417345.1| hypothetical protein EUTSA_v10010016mg [Eutrema salsugineum]
 gb|ESQ35698.1| hypothetical protein EUTSA_v10010016mg [Eutrema salsugineum]
Length=132

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A+AFV HYY +FD++R +L +LY   S+LTFEGQK+ G ++I  KL  LPF QC+H 
Sbjct  10   EEVARAFVNHYYHLFDNDRSSLCTLYNPTSLLTFEGQKVYGVEDISNKLKQLPFDQCRHL  69

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG+LQL GE H L+FSQ FHL+P  +GSF+V N++FRL
Sbjct  70   ISTVDSQPSSMAGGCGGILVFVSGSLQLHGEDHPLRFSQTFHLIPLLKGSFFVQNEMFRL  129

Query  399  NY  404
            NY
Sbjct  130  NY  131



>ref|NP_984109.1| ADR013Wp [Ashbya gossypii ATCC 10895]
 sp|Q75AA5.1|NTF2_ASHGO RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Ashbya 
gossypii ATCC 10895]
 gb|AAS51933.1| ADR013Wp [Ashbya gossypii ATCC 10895]
 gb|AEY96233.1| FADR013Wp [Ashbya gossypii FDAG1]
Length=125

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD  ALA+ F E YY+ FD++R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    MDFSALAQQFTEFYYNQFDTDRSQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+A +FSQ+FHLMP    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPNGDVLVMITGDLLIDDEQNAQRFSQVFHLMPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_008674948.1| PREDICTED: uncharacterized protein LOC103651127 [Zea mays]
Length=247

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  18   DGGGGAKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLT  197
            + G     D DA+A+AFV++YY  FD++R AL  LY   SML+FEG  + G++ I  KL 
Sbjct  117  NSGSAGAGDCDAVARAFVDYYYRTFDASRAALAVLYGQTSMLSFEGHAVAGAEEIGRKLA  176

Query  198  SLPFQQCQHAITTVDCQPSGP-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFY  374
             LP +QC+HA+ T+D QPS    G +LVFVSGTLQLAGE+H L+FSQMF L+P  QGSF+
Sbjct  177  QLPLEQCRHAVCTLDSQPSPSFPGSVLVFVSGTLQLAGEEHQLRFSQMFQLVPNEQGSFF  236

Query  375  VYNDIFRLNY  404
            V NDIFRLNY
Sbjct  237  VQNDIFRLNY  246



>ref|XP_010101476.1| Nuclear transport factor 2 [Morus notabilis]
 gb|EXB88459.1| Nuclear transport factor 2 [Morus notabilis]
Length=124

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + + FV++YY +FD++R  L SLYQ  SMLTFEG+KI G  NI  KL  LPF QC+H 
Sbjct  6    EVVGRKFVDYYYHLFDNDRAKLSSLYQPNSMLTFEGEKILGDINISCKLNQLPFDQCKHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            I+TVD QPS   G ++V VSG++QL  E+H L+FSQMFHL+P  QG+F V NDIFRLNY+
Sbjct  66   ISTVDSQPSS-TGAIVVLVSGSIQLPCEEHPLRFSQMFHLVPVAQGNFVVQNDIFRLNYS  124



>gb|ACN33761.1| unknown [Zea mays]
 gb|AFW61582.1| hypothetical protein ZEAMMB73_227664 [Zea mays]
Length=134

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPDA+AKAFVEHYY  FD+NR AL  LYQ+ SMLTFEGQK QG   I  KL SLPFQ C
Sbjct  3    MDPDAVAKAFVEHYYRTFDTNRAALVGLYQETSMLTFEGQKFQGPSAIAGKLGSLPFQAC  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQM  338
            +H I TVDCQPSGP GGMLVFVSG+++   E+H +KFSQ+
Sbjct  63   EHQIVTVDCQPSGPQGGMLVFVSGSIRTGPEEHPIKFSQV  102



>ref|XP_004173691.1| PREDICTED: nuclear transport factor 2-like, partial [Cucumis 
sativus]
Length=119

 Score =   150 bits (379),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D + KAFVEHYY +FD+ R +L SLYQ  SMLTFEGQ+I G  +I +KL  LPF++C+H 
Sbjct  6    DIIGKAFVEHYYQLFDNERASLSSLYQPDSMLTFEGQQILGVHDISSKLQQLPFERCRHV  65

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDI  389
            ++T+D QPS   G +L+FVSG++++  E+H L+FSQMFHL+P+P+G+ +V NDI
Sbjct  66   VSTIDTQPSSVHGSILIFVSGSIEIPEEEHPLRFSQMFHLVPSPEGNLFVQNDI  119



>ref|XP_002889874.1| T23J18.22 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66133.1| T23J18.22 [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L SLY   S+LTFEGQKI G +NI  KL  LPF QC+H 
Sbjct  347  EEVASAFVNHYYHIFDNDRSSLSSLYNPTSLLTFEGQKIYGVENISNKLKQLPFDQCRHL  406

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG+LQL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  407  ISTVDSQPSSIAGGCGGILVFVSGSLQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  466

Query  399  NY  404
            NY
Sbjct  467  NY  468



>gb|AGO11785.1| AaceriADR013Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=125

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD  ALA+ F E YY+ FD++R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    MDFSALAQQFTEFYYNQFDTDRSQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHLMP    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLMPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_002954251.1| hypothetical protein VOLCADRAFT_76233 [Volvox carteri f. nagariensis]
 gb|EFJ44675.1| hypothetical protein VOLCADRAFT_76233 [Volvox carteri f. nagariensis]
Length=123

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            +P+A+  AF++++Y++F +NR AL SLYQD+S+LTFEG K QG QNI+ KLT++PFQ+  
Sbjct  3    NPEAVGNAFLDYFYNLFATNRAALASLYQDSSLLTFEGAKFQGQQNIINKLTTMPFQKVA  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
                TVD QPS  +GG+L+FV+G L   GE   LKFSQ FHLMPTP  SF V ND+FRLN
Sbjct  63   VQRDTVDIQPS-ISGGILIFVTGKLMPEGESIPLKFSQAFHLMPTPASSFVVTNDMFRLN  121

Query  402  Y  404
            Y
Sbjct  122  Y  122



>emb|CCK72705.1| hypothetical protein KNAG_0L00840 [Kazachstania naganishii CBS 
8797]
Length=125

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD +ALA+ F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG++ IV KLTSLPFQ+ 
Sbjct  3    MDFNALAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETTQLQGTKAIVEKLTSLPFQRV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+   G +LV ++G L +  EQ+A +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   SHRITTLDAQPASANGDVLVMITGDLLIDEEQNAQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_447218.1| hypothetical protein [Candida glabrata CBS 138]
 sp|Q6FRC6.1|NTF2_CANGA RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Candida 
glabrata CBS 138]
 emb|CAG60151.1| unnamed protein product [Candida glabrata]
Length=125

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD +ALA+ F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    MDFNALAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETSQLQGAKSIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   AHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_005847428.1| hypothetical protein CHLNCDRAFT_134320 [Chlorella variabilis]
 gb|EFN55326.1| hypothetical protein CHLNCDRAFT_134320 [Chlorella variabilis]
Length=119

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            DP+A   AF +HYY+ FD+ R  L  LYQD SMLTFEGQK QG+Q I+ KLTSLPFQQC+
Sbjct  3    DPEA---AFTDHYYATFDTARANLAGLYQDQSMLTFEGQKFQGTQAILGKLTSLPFQQCK  59

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H IT++D QPS  +GG+LVFV+G L   GE + LKFSQ FHL P   GSF V ND+FRLN
Sbjct  60   HHITSLDAQPS-LSGGVLVFVTGQLLPEGETNPLKFSQTFHLAPV-GGSFVVTNDLFRLN  117

Query  402  Y  404
            Y
Sbjct  118  Y  118



>ref|XP_003646328.1| hypothetical protein Ecym_4471 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39511.1| hypothetical protein Ecym_4471 [Eremothecium cymbalariae DBVPG#7215]
Length=125

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD   LA+ F E YY+ FD++R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    MDFSTLAQQFTEFYYNQFDTDRTQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHLMP    S+YV+NDIFRL
Sbjct  63   SHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLMPEA-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>emb|CDO93876.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=125

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D  +LA+ F E YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+A +FSQ+FHLMP    S+YVYNDIFRL
Sbjct  63   AHRITTLDAQPASPNGDVLVMITGDLLIDEEQNAQRFSQVFHLMPEG-SSYYVYNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_002456464.1| hypothetical protein SORBIDRAFT_03g036780 [Sorghum bicolor]
 gb|EES01584.1| hypothetical protein SORBIDRAFT_03g036780 [Sorghum bicolor]
Length=136

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            D +A+AFVEHYY  FD++R AL +LY   SML+FEG  + G++ I  KL  LPF+QC+H 
Sbjct  16   DVVARAFVEHYYRTFDADRAALAALYGQTSMLSFEGHAVAGAEEICRKLAQLPFEQCRHT  75

Query  228  ITTVDCQPSGP-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
            + TVDCQPS    G +LVFVSG LQLAGE+H L+FSQMF L+P  QGSF+V NDIFRLNY
Sbjct  76   VCTVDCQPSPSFPGSILVFVSGNLQLAGEEHQLRFSQMFQLVPNEQGSFFVQNDIFRLNY  135



>emb|CDF91739.1| ZYBA0S13-02454g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH16842.1| Nuclear transport factor 2 [Zygosaccharomyces bailii ISA1307]
 emb|CDH12347.1| Nuclear transport factor 2 [Zygosaccharomyces bailii ISA1307]
Length=125

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD + LA+ F + YY+ FDS+R  LG+LY+D SMLTFE  ++QG++NIV KL SLPFQ+ 
Sbjct  3    MDFNTLAQQFTQFYYNQFDSDRSQLGNLYRDESMLTFETSQLQGAKNIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   GHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_001643859.1| hypothetical protein Kpol_499p29 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO16001.1| hypothetical protein Kpol_499p29 [Vanderwaltozyma polyspora DSM 
70294]
Length=125

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD + LA+ F + YY+ FD++R  LG+LY+D SMLTFE  ++QG++NIV KL SLPFQ+ 
Sbjct  3    MDFNGLAQQFTDFYYNQFDTDRSQLGNLYRDESMLTFETTQLQGAKNIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   SHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>gb|KIZ07699.1| Nuclear transport factor 2 [Monoraphidium neglectum]
Length=123

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            DP+ + KAF+E+YY +F SNR AL SLYQD S+ TFEG K QG   IVAKLTSLPF Q +
Sbjct  4    DPEQVGKAFLEYYYGLFGSNRAALASLYQDQSLFTFEGAKCQGPAAIVAKLTSLPFNQAK  63

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
             A  + D QPS  +GG++VFV+G +Q  GE +ALKFSQ+FHLMP    SF V ND+FRLN
Sbjct  64   VATISTDFQPS-ISGGIIVFVTGQVQTEGESNALKFSQVFHLMPV-GSSFVVTNDMFRLN  121

Query  402  Y  404
            Y
Sbjct  122  Y  122



>ref|XP_003683389.1| hypothetical protein TDEL_0H03190 [Torulaspora delbrueckii]
 emb|CCE94178.1| hypothetical protein TDEL_0H03190 [Torulaspora delbrueckii]
Length=125

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D +ALA+ F E YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPF + 
Sbjct  3    LDFNALAQQFTEFYYNQFDSDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFARV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P+G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPSGDVLVMITGDLLIDEEQNPQRFSQVFHLIPEG-SSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>gb|EMS56705.1| Nuclear transport factor 2 [Triticum urartu]
Length=129

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD+++KAFV+HYY  FDSNR AL  LYQD SMLTFEG+K  G   I  KL SLPFQQC
Sbjct  1    MDPDSVSKAFVQHYYHTFDSNRAALVGLYQDGSMLTFEGEKFGGPAAIAGKLGSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQ  335
            QH I TVDCQPSGP GG+LVFVSGT+     +H LKFSQ
Sbjct  61   QHKIDTVDCQPSGPQGGVLVFVSGTITTGPGEHPLKFSQ  99



>gb|AAF16635.1|AC011661_13 T23J18.22 [Arabidopsis thaliana]
Length=522

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + +A AFV HYY +FD++R +L SLY   S+LTFEGQ I G  NI  KL  LPF QC H 
Sbjct  337  EEVASAFVNHYYHLFDNDRSSLSSLYNPTSLLTFEGQTIYGVDNISNKLKQLPFDQCHHL  396

Query  228  ITTVDCQPS---GPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            I+TVD QPS   G  GG+LVFVSG++QL GE H L+FSQ FHL+P  QGSF+V N++FRL
Sbjct  397  ISTVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL  456

Query  399  NYA  407
            NY 
Sbjct  457  NYV  459



>dbj|BAO41027.1| nuclear transport factor 2 [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP72489.1| nuclear transport factor 2 [Kluyveromyces marxianus]
Length=125

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D  +LA+ F E YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETTQVQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHLMP    S+YVYNDIFRL
Sbjct  63   AHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLMPEG-SSYYVYNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>gb|EHN02800.1| Ntf2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EJT42380.1| NTF2-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=125

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F + YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+A +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPNGDVLVMITGDLLIDEEQNAQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_005644363.1| nuclear transport factor 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE19819.1| nuclear transport factor 2 [Coccomyxa subellipsoidea C-169]
Length=122

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = +3

Query  45   PDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQH  224
            P+ +AKAF EHYY  FD NR AL  LYQD ++L+FEGQK QG   ++ KLTSLPFQQ +H
Sbjct  4    PEEVAKAFQEHYYKTFDQNRAALQPLYQDNAILSFEGQKFQGQAAVIGKLTSLPFQQVRH  63

Query  225  AITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNY  404
             I++VD QPS  + G++VFV+G L + GE + LKFSQ+FHL  +  GSF + NDIFRLNY
Sbjct  64   HISSVDAQPS-LSNGLIVFVTGQLLVDGEANPLKFSQVFHLAASG-GSFIITNDIFRLNY  121

Query  405  A  407
            A
Sbjct  122  A  122



>ref|XP_453665.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|Q6CQX4.1|NTF2_KLULA RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAH00761.1| KLLA0D13508p [Kluyveromyces lactis]
Length=125

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D  +LA+ F E YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETTQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHLMP    S+YVYNDIFRL
Sbjct  63   AHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLMPEG-SSYYVYNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_001700802.1| hypothetical protein CHLREDRAFT_113074 [Chlamydomonas reinhardtii]
 gb|EDP07056.1| predicted protein [Chlamydomonas reinhardtii]
Length=123

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            DP+A+ +AF++++Y +F +NR  L SLYQ++S+LTFEG K QG Q I+ KLT++PF    
Sbjct  3    DPEAVGRAFLDYFYGLFSTNRAGLASLYQESSLLTFEGNKFQGQQAIIQKLTTMPFSNVA  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
                T+D QPS  +GG+L+FV+G L   GE   LKFSQ FHLMPTP  SF V ND+FRLN
Sbjct  63   VQRDTIDIQPS-ISGGILIFVTGKLMPEGENMPLKFSQTFHLMPTPNNSFVVTNDMFRLN  121

Query  402  Y  404
            Y
Sbjct  122  Y  122



>gb|EMT05655.1| Nuclear transport factor 2 [Aegilops tauschii]
Length=185

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MDPD+++KAFV+HYY  FDSNR AL  LYQD SMLTFEG+K  G   I  KL SLPFQQC
Sbjct  1    MDPDSVSKAFVQHYYQTFDSNRAALVGLYQDGSMLTFEGEKFGGPAAIAGKLGSLPFQQC  60

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMF  341
            QH I TVDCQPSGP GG+LVFVSGT+     +H LKFSQ+ 
Sbjct  61   QHKIDTVDCQPSGPQGGVLVFVSGTITTGPGEHPLKFSQII  101



>ref|XP_003959797.1| hypothetical protein KAFR_0L00550 [Kazachstania africana CBS 
2517]
 emb|CCF60662.1| hypothetical protein KAFR_0L00550 [Kazachstania africana CBS 
2517]
Length=125

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    LDFNGLAQQFTEFYYNQFDSDRTQLGNLYRDQSMLTFETTQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   SHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>emb|CEP60375.1| LALA0S01e09296g1_1 [Lachancea lanzarotensis]
Length=125

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F E YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTLAQQFTEFYYNQFDTDRTQLGNLYREQSMLTFETTQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+ P G +LV ++G L +  EQ+A +FSQ+FHLMP    S+YV+NDIFRL
Sbjct  63   GHRISTLDAQPASPNGDVLVMITGDLLIDEEQNAQRFSQVFHLMPEG-SSYYVFNDIFRL  121

Query  399  NYA  407
            NYA
Sbjct  122  NYA  124



>ref|XP_011103155.1| ntf2p [Saccharomyces arboricola H-6]
 gb|EJS44030.1| ntf2p [Saccharomyces arboricola H-6]
Length=125

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F + YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|NP_010925.1| Ntf2p [Saccharomyces cerevisiae S288c]
 sp|P33331.2|NTF2_YEAST RecName: Full=Nuclear transport factor 2; Short=NTF-2; AltName: 
Full=Nuclear transport factor P10 [Saccharomyces cerevisiae 
S288c]
 gb|AAB64542.1| Ntf2p: Nuclear Transport Factor 2 [Saccharomyces cerevisiae]
 gb|AAS56774.1| YER009W [Saccharomyces cerevisiae]
 gb|EDN62976.1| nuclear transport factor [Saccharomyces cerevisiae YJM789]
 gb|EDV08837.1| nuclear transport factor [Saccharomyces cerevisiae RM11-1a]
 gb|EEU08681.1| Ntf2p [Saccharomyces cerevisiae JAY291]
 emb|CAY79175.1| Ntf2p [Saccharomyces cerevisiae EC1118]
 tpg|DAA07660.1| TPA: Ntf2p [Saccharomyces cerevisiae S288c]
 gb|EGA58954.1| Ntf2p [Saccharomyces cerevisiae FostersB]
 gb|EGA75293.1| Ntf2p [Saccharomyces cerevisiae AWRI796]
 gb|EGA79155.1| Ntf2p [Saccharomyces cerevisiae Vin13]
 gb|EGA83188.1| Ntf2p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EGA87241.1| Ntf2p [Saccharomyces cerevisiae VL3]
 dbj|GAA22833.1| K7_Ntf2p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN07535.1| Ntf2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW11048.1| Ntf2p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG86495.1| Ntf2p [Saccharomyces cerevisiae R008]
 gb|EWG91399.1| Ntf2p [Saccharomyces cerevisiae P301]
 gb|EWG96417.1| Ntf2p [Saccharomyces cerevisiae R103]
 gb|EWH18767.1| Ntf2p [Saccharomyces cerevisiae P283]
 gb|AHY75560.1| Ntf2p [Saccharomyces cerevisiae YJM993]
 gb|AJP38273.1| Ntf2p [Saccharomyces cerevisiae YJM1078]
Length=125

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F + YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_002498169.1| ZYRO0G03894p [Zygosaccharomyces rouxii]
 emb|CAR29236.1| ZYRO0G03894p [Zygosaccharomyces rouxii]
Length=125

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D   LA+ F + YY+ FD++R  LG+LY+D SMLTFE  ++QG++NIV KL SLPFQ+ 
Sbjct  3    LDFSTLAQQFTQFYYNQFDTDRSQLGNLYRDESMLTFETSQLQGTKNIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   GHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-SSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_004177428.1| hypothetical protein TBLA_0A01090 [Tetrapisispora blattae CBS 
6284]
 emb|CCH57909.1| hypothetical protein TBLA_0A01090 [Tetrapisispora blattae CBS 
6284]
Length=125

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    LDFNQLAQQFTEFYYNQFDSDRTQLGNLYRDESMLTFETSQVQGAKDIVEKLVSLPFQRV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+   G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   AHRITTLDAQPASSNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NYA
Sbjct  122  NYA  124



>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2
 pdb|1GY7|B Chain B, N77y Point Mutant Of S.Cerevisiae Ntf2
 pdb|1GY7|C Chain C, N77y Point Mutant Of S.Cerevisiae Ntf2
 pdb|1GY7|D Chain D, N77y Point Mutant Of S.Cerevisiae Ntf2
 pdb|1GYB|A Chain A, N77y Point Mutant Of Yntf2 Bound To Fxfg Nucleoporin 
Repeat
 pdb|1GYB|B Chain B, N77y Point Mutant Of Yntf2 Bound To Fxfg Nucleoporin 
Repeat
 pdb|1GYB|C Chain C, N77y Point Mutant Of Yntf2 Bound To Fxfg Nucleoporin 
Repeat
 pdb|1GYB|D Chain D, N77y Point Mutant Of Yntf2 Bound To Fxfg Nucleoporin 
Repeat
Length=125

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F + YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            QH ITT+D QP+ P G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   QHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_003678085.1| hypothetical protein NCAS_0I00720 [Naumovozyma castellii CBS 
4309]
 emb|CCC71740.1| hypothetical protein NCAS_0I00720 [Naumovozyma castellii CBS 
4309]
Length=125

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            MD + LA+ F + YY  FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    MDFNGLAQQFTDFYYQQFDSDRSQLGNLYREQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+ P+G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   AHRITTLDAQPASPSGDVLVMITGDLLIDEEQNPQRFSQVFHLIPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_001833727.1| nuclear transport factor 2 [Coprinopsis cinerea okayama7#130]
 gb|EAU88089.1| nuclear transport factor 2 [Coprinopsis cinerea okayama7#130]
Length=124

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +A+AK F E YY+ FD+NR  L SLY+D+SML++EG  IQG+QNIV K+TSLPFQ+ Q
Sbjct  3    DINAIAKQFTEFYYTTFDTNRSNLLSLYRDSSMLSWEGAPIQGAQNIVEKITSLPFQKVQ  62

Query  222  HAITTVDCQPSGPA-GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            H +TT+D QPS P    +LV V+G L +    + L +SQ+F L+P   GS+YV+NDIFRL
Sbjct  63   HKVTTLDAQPSSPTQASILVSVTGLLLVDDSPNPLNYSQVFQLIPD-GGSYYVFNDIFRL  121

Query  399  NY  404
            NY
Sbjct  122  NY  123



>emb|CDR46057.1| CYFA0S21e01794g1_1 [Cyberlindnera fabianii]
Length=126

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  33   AKMDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQ  212
            + +D + L + F E YY+ FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ
Sbjct  2    SNVDFNTLQEQFTEFYYNQFDSDRSQLGNLYRDQSMLTFETTQVQGAKDIVEKLVSLPFQ  61

Query  213  QCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIF  392
            +  H ITT+D QP+ PAG +LV V+G L +  E +  ++SQ+FHL+P    S+YV+NDIF
Sbjct  62   KVGHRITTLDAQPASPAGDVLVMVTGELLIDDETNPQRYSQVFHLIPDG-SSYYVFNDIF  120

Query  393  RLNY  404
            RLNY
Sbjct  121  RLNY  124



>ref|XP_002554769.1| KLTH0F13354p [Lachancea thermotolerans]
 emb|CAR24332.1| KLTH0F13354p [Lachancea thermotolerans CBS 6340]
Length=125

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F E YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTLAQQFTEFYYNQFDTDRTQLGNLYREQSMLTFETTQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+ P   +LV ++G L +  EQ+  +FSQ+FHLMP    S+YV+NDIFRL
Sbjct  63   AHRISTLDAQPASPNNDVLVMITGELLIDEEQNPQRFSQVFHLMPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NYA
Sbjct  122  NYA  124



>gb|EME41775.1| hypothetical protein DOTSEDRAFT_73992 [Dothistroma septosporum 
NZE10]
Length=126

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D + +AK FVE+YY  FDS+R  L  LY+D SMLTFE    QG+  IV KL  LPFQ+ +
Sbjct  3    DFENVAKQFVEYYYKQFDSDRSGLAPLYRDNSMLTFEATPCQGAPAIVQKLQELPFQKVE  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H + T+D QPS  +GG+LV VSG L +  E+  + ++Q F L+PTP+GS+Y++ND+FRL 
Sbjct  63   HQVATLDAQPSNESGGILVIVSGALLVEEEKRPMSYAQTFQLLPTPEGSYYIFNDVFRLV  122

Query  402  Y  404
            Y
Sbjct  123  Y  123



>ref|XP_005773382.1| hypothetical protein EMIHUDRAFT_415819, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005779334.1| hypothetical protein EMIHUDRAFT_430104, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD20953.1| hypothetical protein EMIHUDRAFT_415819, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD26905.1| hypothetical protein EMIHUDRAFT_430104, partial [Emiliania huxleyi 
CCMP1516]
Length=127

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +3

Query  54   LAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHAIT  233
            ++KAF +HYY++FD++R  L +LYQD SMLTFE  +  G Q I+ KLT+L F   QH +T
Sbjct  11   ISKAFCQHYYNVFDTDRAKLQTLYQDGSMLTFEDAQFMGMQAIMTKLTTLQFATVQHQVT  70

Query  234  TVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLNYA  407
            T D QP+ P GG+L F++G L + G  + L F Q FHLMPTPQGS+Y++ND+FRLNY 
Sbjct  71   TCDAQPT-PGGGILCFITGKLVVDGGANPLMFGQTFHLMPTPQGSWYIHNDLFRLNYT  127



>gb|EEQ42220.1| nuclear transport factor 2 [Candida albicans WO-1]
Length=123

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D +A+A  F   YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  2    IDFNAVATEFCNFYYNQFDSDRSKLGNLYRNESMLTFETSQLQGARDIVEKLASLPFQKV  61

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+   G +LV V+G L +  EQ+A ++SQ+FHL+P   GS+YV+NDIFRL
Sbjct  62   AHRISTLDAQPASANGDILVMVTGELLIDEEQNAQRYSQVFHLIP-DNGSYYVFNDIFRL  120

Query  399  NYA  407
            NY+
Sbjct  121  NYS  123



>ref|XP_002417594.1| nuclear transport factor 2, putative [Candida dubliniensis CD36]
 sp|Q9P926.1|NTF2_CANAX RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Candida 
albicans]
 gb|AAF66701.1|AF145758_1 nuclear transport factor Ntf2p [Candida albicans]
 emb|CAX45249.1| nuclear transport factor 2, putative [Candida dubliniensis CD36]
 gb|KGQ90666.1| nuclear transport factor 2 [Candida albicans P94015]
 gb|KGQ97993.1| nuclear transport factor 2 [Candida albicans P37005]
 gb|KGR02739.1| nuclear transport factor 2 [Candida albicans GC75]
 gb|KGR14233.1| nuclear transport factor 2 [Candida albicans P57072]
 gb|KGR17112.1| nuclear transport factor 2 [Candida albicans P78048]
 gb|KGR22642.1| nuclear transport factor 2 [Candida albicans P37037]
 gb|KGT71463.1| nuclear transport factor 2 [Candida albicans 12C]
 gb|KGU13252.1| nuclear transport factor 2 [Candida albicans P87]
 gb|KGU16581.1| nuclear transport factor 2 [Candida albicans 19F]
 gb|KGU17859.1| nuclear transport factor 2 [Candida albicans L26]
 gb|KGU32196.1| nuclear transport factor 2 [Candida albicans P34048]
 gb|KGU34373.1| nuclear transport factor 2 [Candida albicans P75063]
 gb|KGU36795.1| nuclear transport factor 2 [Candida albicans P57055]
 gb|KHC41014.1| nuclear transport factor 2 [Candida albicans P76055]
 gb|KHC41680.1| nuclear transport factor 2 [Candida albicans P76067]
 gb|KHC48139.1| nuclear transport factor 2 [Candida albicans Ca6]
 gb|KHC55972.1| nuclear transport factor 2 [Candida albicans P60002]
 gb|KHC60311.1| nuclear transport factor 2 [Candida albicans P37039]
 gb|KHC67620.1| nuclear transport factor 2 [Candida albicans P75010]
 gb|KHC74305.1| nuclear transport factor 2 [Candida albicans P75016]
 gb|KHC83755.1| nuclear transport factor 2 [Candida albicans SC5314]
 gb|KHC84407.1| nuclear transport factor 2 [Candida albicans P78042]
 gb|KHC89190.1| nuclear transport factor 2 [Candida albicans SC5314]
Length=124

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D +A+A  F   YY+ FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNAVATEFCNFYYNQFDSDRSQLGNLYRNESMLTFETSQLQGARDIVEKLASLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+   G +LV V+G L +  EQ+A ++SQ+FHL+P   GS+YV+NDIFRL
Sbjct  63   AHRISTLDAQPASANGDILVMVTGELLIDEEQNAQRYSQVFHLIP-DNGSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_001382549.1| hypothetical protein PICST_70878 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN64520.1| nuclear transport factor 2 [Scheffersomyces stipitis CBS 6054]
Length=124

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + +A  F   YY  FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTVATEFCHFYYQQFDSDRTQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+ P+G +LV V+G L +  EQ+A ++SQ+FHL+P    S+YV+NDIFRL
Sbjct  63   AHRISTLDAQPASPSGDILVMVTGELLIDEEQNAQRYSQVFHLIPDG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_002776831.1| Nuclear transport factor, putative [Perkinsus marinus ATCC 50983]
 gb|EER08647.1| Nuclear transport factor, putative [Perkinsus marinus ATCC 50983]
Length=128

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = +3

Query  33   AKMDPD--ALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLP  206
            A+++P   ++ + FV+HYY  FD+NR  L  LY D SMLTFEG++ QG+ NIV KL SLP
Sbjct  2    AQINPQFQSIGEQFVQHYYGTFDANRSNLTPLYGDTSMLTFEGEQFQGAANIVQKLVSLP  61

Query  207  FQQCQHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYND  386
            FQ+ QH +   DCQP+    G++VFV+G L +   Q+ LKF Q+FHL P+P G  Y  ND
Sbjct  62   FQKVQHQVIKADCQPNPSNNGVMVFVTGNLLVDDNQNPLKFGQVFHLAPSPSGGIYCLND  121

Query  387  IFRLN  401
            +FRLN
Sbjct  122  MFRLN  126



>emb|CCE44595.1| hypothetical protein CPAR2_403980 [Candida parapsilosis]
Length=124

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +A+A  F   YY+ FDS+R  LG+LY+  SMLTFE  ++QG+++IV KL+SLPFQ+  
Sbjct  4    DFNAVATEFCNFYYNQFDSDRTQLGNLYRPESMLTFETSQLQGARDIVEKLSSLPFQKVS  63

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H ++T+D QP+ P G +LV V+G L +  EQ+A ++SQ+FHL+P   GS+YV+NDIFRLN
Sbjct  64   HRVSTLDAQPASPNGDILVMVTGELLIDEEQNAQRYSQVFHLIPDG-GSYYVFNDIFRLN  122

Query  402  YA  407
            Y+
Sbjct  123  YS  124



>ref|XP_007780203.1| nuclear transport factor 2 [Coniosporium apollinis CBS 100218]
 gb|EON64886.1| nuclear transport factor 2 [Coniosporium apollinis CBS 100218]
Length=126

 Score =   138 bits (347),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D   +A+ F E YY  FD NR ALG+LY++ SMLTFE    QG+ NIV KLTSLPFQQ +
Sbjct  3    DFQTIAQQFTEFYYKTFDENRQALGALYRENSMLTFENSPTQGAINIVDKLTSLPFQQVR  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H ++T+D QPS  A G+LV V+G L +  EQ  + ++Q F L+P   GSF+V+ND+FRL 
Sbjct  63   HQVSTLDAQPSNEANGILVLVTGALLVDEEQKPMSYTQAFQLLPDGAGSFFVFNDVFRLV  122

Query  402  YA  407
            Y+
Sbjct  123  YS  124



>ref|XP_003866378.1| Ntf2 nuclear envelope protein [Candida orthopsilosis Co 90-125]
 emb|CCG20938.1| Ntf2 nuclear envelope protein [Candida orthopsilosis Co 90-125]
Length=124

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +A+A  F   YY+ FDS+R  LG+LY+  SMLTFE  ++QG+++IV KL+SLPFQ+  
Sbjct  4    DFNAVATEFCNFYYNQFDSDRTQLGNLYRPESMLTFETSQLQGARDIVEKLSSLPFQKVA  63

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H ++T+D QP+ P G +LV V+G L +  EQ+A ++SQ+FHL+P   GS+YV+NDIFRLN
Sbjct  64   HRVSTLDAQPASPNGDILVMVTGELLIDEEQNAQRYSQVFHLIPDG-GSYYVFNDIFRLN  122

Query  402  YA  407
            Y+
Sbjct  123  YS  124



>ref|XP_007863703.1| nuclear transport factor 2 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58553.1| nuclear transport factor 2 [Gloeophyllum trabeum ATCC 11539]
Length=125

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +++AK F E YYS FD+NR  L SLY+DASML+FEGQ  QG+  I  KLTSLPFQ+ Q
Sbjct  3    DINSIAKQFTEFYYSTFDTNRAGLQSLYRDASMLSFEGQPTQGAAAIAEKLTSLPFQRVQ  62

Query  222  HAITTVDCQPSGPA-GGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            H ITT+D QPS P    ++V V+G L +   ++ L+FSQ+F L+P   GS+YV NDIFRL
Sbjct  63   HKITTLDAQPSSPTIASLIVSVTGLLLVDDGENPLQFSQVFQLIPE-GGSYYVLNDIFRL  121

Query  399  NY  404
            NY
Sbjct  122  NY  123



>emb|CEG84495.1| Putative Nuclear transport factor 2 [Rhizopus microsporus]
Length=123

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +A+A  FV  YY  FDSNR  L  LY++ SMLTFEG +IQG+ +IV KLTSLPFQ+ Q
Sbjct  3    DVNAVATQFVNFYYETFDSNRSNLQGLYRENSMLTFEGAQIQGTASIVEKLTSLPFQRVQ  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H ITT+D QPSGP G ++V VSG L +    + L F Q F L+    G +YV+NDIFRLN
Sbjct  63   HKITTIDAQPSGPNGSLIVTVSGLLVVDDSTNPLMFFQTFQLISENNG-YYVFNDIFRLN  121

Query  402  Y  404
            Y
Sbjct  122  Y  122



>ref|XP_003668228.1| hypothetical protein NDAI_0A08320 [Naumovozyma dairenensis CBS 
421]
 emb|CCD22985.1| hypothetical protein NDAI_0A08320 [Naumovozyma dairenensis CBS 
421]
Length=125

 Score =   137 bits (345),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + LA+ F E YY+ FD++R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    LDFNGLAQQFTEFYYNQFDTDRTQLGNLYREQSMLTFETSQLQGAKDIVEKLVSLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H ITT+D QP+   G +LV ++G L +  EQ+  +FSQ+FHL+P    S+YV+NDIFRL
Sbjct  63   AHRITTLDAQPASSNGDVLVMITGDLLIDDEQNPQRFSQVFHLIPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_005822283.1| hypothetical protein GUITHDRAFT_79942 [Guillardia theta CCMP2712]
 gb|EKX35303.1| hypothetical protein GUITHDRAFT_79942 [Guillardia theta CCMP2712]
Length=129

 Score =   137 bits (345),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 87/123 (71%), Gaps = 5/123 (4%)
 Frame = +3

Query  48   DALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQHA  227
            + + KAFV HYY  FD+NR  LGSLYQD SML++EG+KIQG  NI+ KLTSLPFQQ  H 
Sbjct  7    ETVGKAFVAHYYQAFDTNRAGLGSLYQDQSMLSWEGEKIQGQANILNKLTSLPFQQVAHQ  66

Query  228  ITTVDCQPSGPAGGMLVFVSGTLQLAGE---QHALKFSQMFHLMPTP-QGSFYVYNDIFR  395
            +T++D  P+    G+LV V G L++ GE   +  LK+SQ F LMP P  G F+V NDIFR
Sbjct  67   VTSMDSHPTA-GDGVLVHVCGNLKVEGEAEDRPPLKYSQTFVLMPLPGGGGFWVLNDIFR  125

Query  396  LNY  404
            LNY
Sbjct  126  LNY  128



>ref|XP_002619423.1| nuclear transport factor 2 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ36459.1| nuclear transport factor 2 [Clavispora lusitaniae ATCC 42720]
Length=173

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + +A  F   YY  FDS+R  LG+LY+D SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  52   IDFNTVATEFCNFYYQQFDSDRNQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKV  111

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP  P G +LV V+G L +  EQ+A ++SQ+FHL+P    S+YV+NDIFRL
Sbjct  112  AHRISTLDAQPGSPNGDILVMVTGELLIDEEQNAQRYSQVFHLIPDG-NSYYVFNDIFRL  170

Query  399  NYA  407
            NY+
Sbjct  171  NYS  173



>ref|XP_003036222.1| hypothetical protein SCHCODRAFT_14583 [Schizophyllum commune 
H4-8]
 gb|EFJ01320.1| hypothetical protein SCHCODRAFT_14583 [Schizophyllum commune 
H4-8]
Length=124

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +A+ + FV+ YY  FD++R AL SLY+D+SMLTFEG  IQG+  I AKLTSLPF + Q
Sbjct  3    DVNAVGQQFVQFYYQTFDTDRAALQSLYRDSSMLTFEGAPIQGAAAIAAKLTSLPFSRVQ  62

Query  222  HAITTVDCQPSGP-AGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
            H ITT+D QPS P    +LV V+G L +   Q+ L+FSQ+F L+P   G++YV+NDIFRL
Sbjct  63   HKITTLDAQPSSPTVQSILVNVTGMLIVDDSQNPLQFSQVFQLLPEA-GTYYVFNDIFRL  121

Query  399  NY  404
            NY
Sbjct  122  NY  123



>ref|XP_007375570.1| hypothetical protein SPAPADRAFT_61370 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW32294.1| hypothetical protein SPAPADRAFT_61370 [Spathaspora passalidarum 
NRRL Y-27907]
Length=124

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + +A  F   YY  FDS+R  LG+LY++ SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTVATEFCNFYYQQFDSDRTQLGNLYRNESMLTFETSQLQGAKDIVEKLASLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+ P G +LV V+G L +  EQ+A ++SQ+FHL+P    S+YV+NDIFRL
Sbjct  63   SHRISTLDAQPASPNGDILVMVTGELLIDEEQNAQRYSQVFHLIPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



>ref|XP_001713065.1| nuclear transport factor Nxt2 [Schizosaccharomyces pombe 972h-]
 sp|Q10100.2|NTF2_SCHPO RecName: Full=Nuclear transport factor 2; Short=NTF-2 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA92380.3| nuclear transport factor Nxt2 [Schizosaccharomyces pombe]
Length=123

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = +3

Query  42   DPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQCQ  221
            D +ALA  F + YY  FDS+R  L SLY++ SML+FEG ++QG++ IV KL SLPFQ+ Q
Sbjct  3    DYNALATQFTQFYYQTFDSDRSQLSSLYREESMLSFEGAQLQGTKAIVEKLVSLPFQRVQ  62

Query  222  HAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRLN  401
            H I+T+D QP+G  G ++V V+G L L  EQ A ++SQ+FHL+    G++YV ND+FRLN
Sbjct  63   HRISTLDAQPTGTTGSVIVMVTGELLLDEEQMAQRYSQVFHLV-NNNGNYYVLNDLFRLN  121

Query  402  Y  404
            Y
Sbjct  122  Y  122



>ref|XP_004199695.1| Piso0_002236 [Millerozyma farinosa CBS 7064]
 emb|CCE81576.1| Piso0_002236 [Millerozyma farinosa CBS 7064]
Length=124

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +3

Query  39   MDPDALAKAFVEHYYSMFDSNRGALGSLYQDASMLTFEGQKIQGSQNIVAKLTSLPFQQC  218
            +D + +A  F   YY+ FDS+R  LG+LY+  SMLTFE  ++QG+++IV KL SLPFQ+ 
Sbjct  3    VDFNTVATEFCNFYYNQFDSDRSQLGNLYRGHSMLTFETSQLQGAEDIVEKLASLPFQKV  62

Query  219  QHAITTVDCQPSGPAGGMLVFVSGTLQLAGEQHALKFSQMFHLMPTPQGSFYVYNDIFRL  398
             H I+T+D QP+ P G +LV V+G L +  EQ+A ++SQ+FHLMP    S+YV+NDIFRL
Sbjct  63   AHRISTLDAQPASPNGDILVMVTGELLIDEEQNAQRYSQVFHLMPEG-NSYYVFNDIFRL  121

Query  399  NYA  407
            NY+
Sbjct  122  NYS  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780