BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024L17

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV88074.1|  sucrose transporter-like protein                        154   1e-40   Ipomoea batatas [batate]
ref|XP_009759496.1|  PREDICTED: sucrose transport protein SUC3 is...    128   4e-31   Nicotiana sylvestris
ref|XP_011075471.1|  PREDICTED: sucrose transport protein SUC3 is...    127   6e-31   Sesamum indicum [beniseed]
gb|AAT40489.1|  putative sucrose transporter-like protein               125   7e-30   Solanum demissum
emb|CAD58887.1|  sucrose transporter                                    124   2e-29   Plantago major [cart-track plant]
ref|XP_009593381.1|  PREDICTED: sucrose transport protein SUC3 is...    122   4e-29   Nicotiana tomentosiformis
ref|XP_009593380.1|  PREDICTED: sucrose transport protein SUC3 is...    122   5e-29   Nicotiana tomentosiformis
ref|NP_001234321.1|  sucrose transporter-like protein                   122   6e-29   
gb|AAX49396.1|  sucrose transporter 2                                   120   3e-28   Eucommia ulmoides
ref|NP_001275438.1|  sucrose transporter-like protein                   120   3e-28   Solanum tuberosum [potatoes]
gb|AHA80796.2|  sucrose transport protein 2                             118   1e-27   Paeonia suffruticosa [moutan peony]
gb|AFO84088.1|  sucrose transport protein                               112   2e-25   Actinidia chinensis
gb|AHG94616.1|  sucrose transporter                                     112   2e-25   Camellia sinensis [black tea]
gb|KDP41167.1|  hypothetical protein JCGZ_15574                         111   6e-25   Jatropha curcas
emb|CDP00304.1|  unnamed protein product                                111   6e-25   Coffea canephora [robusta coffee]
ref|XP_009129114.1|  PREDICTED: sucrose transport protein SUC3-li...    107   2e-23   Brassica rapa
ref|XP_010683228.1|  PREDICTED: sucrose transport protein SUC3          107   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046167.1|  Sucrose transporter 2 isoform 7                    105   2e-23   
emb|CDY09350.1|  BnaA02g26600D                                          106   2e-23   Brassica napus [oilseed rape]
emb|CDY36888.1|  BnaC08g09590D                                          106   2e-23   Brassica napus [oilseed rape]
gb|AHN92214.1|  sucrose transporter 2                                   106   2e-23   
ref|XP_007222035.1|  hypothetical protein PRUPE_ppa003041mg             106   3e-23   Prunus persica
ref|XP_008221653.1|  PREDICTED: sucrose transport protein SUC3 is...    106   3e-23   Prunus mume [ume]
ref|XP_007046163.1|  Sucrose transporter 2 isoform 3                    105   5e-23   
ref|XP_007046161.1|  Sucrose transporter 2 isoform 1                    105   6e-23   
gb|ABI34287.1|  Sucrose transporter-like protein, putative              100   8e-23   Solanum demissum
ref|XP_006438655.1|  hypothetical protein CICLE_v10030996mg             104   1e-22   Citrus clementina [clementine]
ref|NP_001275773.1|  sucrose transporter 2                              104   1e-22   Citrus sinensis [apfelsine]
gb|KJB30371.1|  hypothetical protein B456_005G139700                    104   2e-22   Gossypium raimondii
ref|XP_010256864.1|  PREDICTED: sucrose transport protein SUC3 is...    104   2e-22   Nelumbo nucifera [Indian lotus]
gb|KJB30370.1|  hypothetical protein B456_005G139700                    102   2e-22   Gossypium raimondii
gb|KCW86820.1|  hypothetical protein EUGRSUZ_B03418                     103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_011075472.1|  PREDICTED: sucrose transport protein SUC3 is...    103   2e-22   Sesamum indicum [beniseed]
ref|XP_010256856.1|  PREDICTED: sucrose transport protein SUC3 is...    104   2e-22   Nelumbo nucifera [Indian lotus]
ref|NP_178389.1|  sucrose transport protein SUC3                        103   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KHG22972.1|  Sucrose transport SUC3 -like protein                    103   3e-22   Gossypium arboreum [tree cotton]
gb|ADW94618.1|  sucrose transporter 5                                   103   3e-22   Populus tremula x Populus alba [gray poplar]
dbj|BAJ34415.1|  unnamed protein product                                103   3e-22   Eutrema halophilum
ref|XP_011025852.1|  PREDICTED: sucrose transport protein SUC3-li...    103   3e-22   Populus euphratica
gb|ABJ51934.1|  sucrose transporter 2A                                  103   3e-22   Hevea brasiliensis [jebe]
ref|XP_010044720.1|  PREDICTED: sucrose transport protein SUC3          103   4e-22   Eucalyptus grandis [rose gum]
ref|XP_006395753.1|  hypothetical protein EUTSA_v10003879mg             103   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008339922.1|  PREDICTED: sucrose transport protein SUC3-like     103   5e-22   
gb|KHG16131.1|  Sucrose transport SUC3 -like protein                    102   8e-22   Gossypium arboreum [tree cotton]
ref|XP_002876843.1|  hypothetical protein ARALYDRAFT_484195             102   9e-22   
ref|XP_008389501.1|  PREDICTED: sucrose transport protein SUC3-li...    102   9e-22   
gb|ABA08445.1|  sucrose transporter type 2                              102   1e-21   Manihot esculenta [manioc]
ref|XP_002520110.1|  sucrose transport protein, putative                102   1e-21   
ref|XP_008389500.1|  PREDICTED: sucrose transport protein SUC3-li...    102   1e-21   Malus domestica [apple tree]
emb|CAM33449.1|  Sucrose Transporter 2C                                 101   2e-21   Hevea brasiliensis subsp. brasiliensis
ref|XP_009360369.1|  PREDICTED: sucrose transport protein SUC3 is...    101   2e-21   
ref|XP_006290789.1|  hypothetical protein CARUB_v10016892mg             101   2e-21   Capsella rubella
ref|XP_009360368.1|  PREDICTED: sucrose transport protein SUC3 is...    101   2e-21   Pyrus x bretschneideri [bai li]
emb|CAN62386.1|  hypothetical protein VITISV_011127                     101   2e-21   Vitis vinifera
emb|CDY41670.1|  BnaC02g34840D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_010651816.1|  PREDICTED: sucrose transporter-like isoform X1     101   2e-21   Vitis vinifera
gb|ABI34280.1|  sucrose transporter-like protein, putative            95.5    5e-21   Solanum demissum
ref|XP_002311596.1|  sucrose transporter family protein                 100   6e-21   
gb|AFU61908.1|  sucrose transporter 2                                 99.8    7e-21   Fragaria x ananassa
ref|XP_004297320.1|  PREDICTED: sucrose transport protein SUC3        99.8    8e-21   Fragaria vesca subsp. vesca
gb|ABJ51932.1|  sucrose transporter 2B                                99.8    8e-21   Hevea brasiliensis [jebe]
emb|CDY03029.1|  BnaC07g21980D                                        99.4    9e-21   
ref|XP_009152233.1|  PREDICTED: sucrose transport protein SUC3 is...  99.4    1e-20   Brassica rapa
gb|ADW94619.1|  sucrose transporter 6                                 99.0    1e-20   Populus tremula x Populus alba [gray poplar]
emb|CDY45192.1|  BnaA06g33960D                                        98.2    2e-20   Brassica napus [oilseed rape]
ref|NP_001268068.1|  sucrose transporter-like                         98.6    2e-20   Vitis vinifera
ref|XP_011021610.1|  PREDICTED: sucrose transport protein SUC3 is...  98.6    2e-20   Populus euphratica
ref|XP_008465743.1|  PREDICTED: sucrose transport protein SUC3        98.6    2e-20   Cucumis melo [Oriental melon]
ref|XP_010527885.1|  PREDICTED: sucrose transport protein SUC3 is...  98.6    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527884.1|  PREDICTED: sucrose transport protein SUC3 is...  98.2    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010096375.1|  Sucrose transport protein SUC3                   97.8    4e-20   Morus notabilis
ref|XP_010502296.1|  PREDICTED: sucrose transport protein SUC3 is...  97.4    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010425056.1|  PREDICTED: sucrose transport protein SUC3-li...  96.3    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004511224.1|  PREDICTED: sucrose transport protein SUC3-like   96.3    1e-19   Cicer arietinum [garbanzo]
ref|XP_004143775.1|  PREDICTED: sucrose transport protein SUC3-like   95.9    2e-19   Cucumis sativus [cucumbers]
gb|KFK33468.1|  hypothetical protein AALP_AA5G017000                  95.5    2e-19   Arabis alpina [alpine rockcress]
gb|KJB80160.1|  hypothetical protein B456_013G083700                  95.5    3e-19   Gossypium raimondii
gb|AFM28287.1|  SUT2                                                  95.1    3e-19   Medicago truncatula
gb|KJB50672.1|  hypothetical protein B456_008G181900                  92.8    2e-18   Gossypium raimondii
gb|KJB50671.1|  hypothetical protein B456_008G181900                  92.8    2e-18   Gossypium raimondii
ref|XP_007046165.1|  Sucrose transporter 2 isoform 5                  90.1    6e-18   
gb|ADK46943.1|  sucrose transporter                                   91.3    7e-18   Cucumis sativus [cucumbers]
ref|XP_010940403.1|  PREDICTED: sucrose transport protein SUT4-li...  90.5    8e-18   Elaeis guineensis
ref|XP_008802417.1|  PREDICTED: sucrose transport protein SUT4-li...  90.5    1e-17   
ref|XP_004954470.1|  PREDICTED: sucrose transport protein SUT4-like   90.9    1e-17   Setaria italica
ref|XP_008802401.1|  PREDICTED: sucrose transport protein SUT4-li...  90.5    1e-17   Phoenix dactylifera
ref|XP_010940402.1|  PREDICTED: sucrose transport protein SUT4-li...  90.5    1e-17   Elaeis guineensis
ref|XP_006827165.1|  hypothetical protein AMTR_s00010p00254010        89.0    4e-17   Amborella trichopoda
ref|XP_006602307.1|  PREDICTED: sucrose transport protein SUC3-like   87.4    1e-16   
ref|XP_010935628.1|  PREDICTED: sucrose transport protein SUT4-li...  86.3    3e-16   Elaeis guineensis
ref|XP_010935627.1|  PREDICTED: sucrose transport protein SUT4-li...  86.3    3e-16   Elaeis guineensis
ref|XP_002315798.1|  sucrose transporter family protein               86.3    4e-16   
ref|XP_008778274.1|  PREDICTED: sucrose transport protein SUT4-li...  85.5    5e-16   Phoenix dactylifera
ref|XP_008778269.1|  PREDICTED: sucrose transport protein SUT4-li...  85.5    6e-16   Phoenix dactylifera
gb|KHN32884.1|  Sucrose transport protein SUC3                        84.7    1e-15   Glycine soja [wild soybean]
ref|XP_007153820.1|  hypothetical protein PHAVU_003G067600g           84.0    2e-15   Phaseolus vulgaris [French bean]
gb|ABO21770.1|  sucrose transporter protein                           83.2    4e-15   Ananas comosus
ref|NP_001048591.1|  Os02g0827200                                     82.4    6e-15   
dbj|BAC67164.1|  sucrose transporter                                  82.4    7e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453083.1|  hypothetical protein SORBIDRAFT_04g038030        82.4    8e-15   Sorghum bicolor [broomcorn]
gb|EPS58915.1|  hypothetical protein M569_15897                       79.7    9e-15   Genlisea aurea
gb|KHN06837.1|  Sucrose transport protein SUC3                        82.4    1e-14   Glycine soja [wild soybean]
ref|XP_003530692.2|  PREDICTED: sucrose transport protein SUC3-like   80.5    4e-14   Glycine max [soybeans]
ref|XP_010236019.1|  PREDICTED: sucrose transport protein SUT4 is...  80.5    4e-14   Brachypodium distachyon [annual false brome]
ref|XP_009381726.1|  PREDICTED: sucrose transport protein SUT1-like   79.0    9e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394456.1|  PREDICTED: sucrose transport protein SUT4 is...  79.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB30372.1|  hypothetical protein B456_005G139700                  78.6    1e-13   Gossypium raimondii
ref|XP_009405154.1|  PREDICTED: sucrose transport protein SUT3-like   78.2    2e-13   
gb|EEC66911.1|  hypothetical protein OsI_33504                        76.3    5e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001141577.1|  uncharacterized protein LOC100273693             76.6    5e-13   Zea mays [maize]
sp|Q944W2.1|SUT3_ORYSI  RecName: Full=Sucrose transport protein S...  76.6    5e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001146651.1|  sucrose transporter2                             76.6    7e-13   Zea mays [maize]
ref|XP_008643522.1|  PREDICTED: sucrose transporter2 isoform X3       76.6    7e-13   Zea mays [maize]
ref|XP_002467275.1|  hypothetical protein SORBIDRAFT_01g022430        76.3    7e-13   Sorghum bicolor [broomcorn]
ref|XP_008643521.1|  PREDICTED: sucrose transporter2 isoform X2       76.6    8e-13   Zea mays [maize]
ref|NP_001064555.1|  Os10g0404500                                     75.9    8e-13   
ref|XP_004986599.1|  PREDICTED: sucrose transport protein SUT3-like   75.5    1e-12   
dbj|BAK07459.1|  predicted protein                                    75.5    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003577278.1|  PREDICTED: sucrose transport protein SUT2        74.7    2e-12   Brachypodium distachyon [annual false brome]
gb|KEH25698.1|  sucrose proton symporter 2                            74.7    2e-12   Medicago truncatula
ref|XP_003573890.1|  PREDICTED: sucrose transport protein SUT3-like   74.7    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_004515129.1|  PREDICTED: sucrose transport protein SUC8-like   74.3    2e-12   
gb|AFW74126.1|  hypothetical protein ZEAMMB73_722694                  74.3    3e-12   
ref|XP_008643520.1|  PREDICTED: sucrose transporter2 isoform X1       74.3    4e-12   Zea mays [maize]
ref|XP_006648160.1|  PREDICTED: sucrose transport protein SUT4-like   73.9    5e-12   
ref|XP_002266122.1|  PREDICTED: sucrose transport protein SUC2        73.2    7e-12   Vitis vinifera
tpg|DAA54801.1|  TPA: hypothetical protein ZEAMMB73_386084            70.5    7e-12   
dbj|BAK01156.1|  predicted protein                                    73.2    8e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU87542.1|  sucrose transporter 4                                 73.2    1e-11   Lolium perenne [perennial ryegrass]
gb|ABF06450.1|  putative sucrose transport protein SUT1               69.7    1e-11   Nicotiana langsdorffii x Nicotiana sanderae
tpg|DAA54803.1|  TPA: hypothetical protein ZEAMMB73_386084            69.3    2e-11   
ref|NP_001177082.1|  Os12g0641400                                     69.3    2e-11   
gb|AAO13696.1|  sucrose transporter                                   68.6    2e-11   Solanum lycopersicum
tpg|DAA43616.1|  TPA: hypothetical protein ZEAMMB73_332694            69.3    2e-11   
gb|KHN32800.1|  Sucrose transport protein                             70.9    3e-11   Glycine soja [wild soybean]
gb|ABF06451.1|  putative sucrose transport protein SUT1               68.6    3e-11   Nicotiana langsdorffii x Nicotiana sanderae
gb|AFO84089.1|  sucrose transport protein                             71.2    3e-11   Actinidia deliciosa [Chinese gooseberry]
gb|AIU94753.1|  sucrose proton symporter                              71.2    3e-11   Morus alba var. multicaulis
gb|ADL14375.1|  sucrose transporter 1                                 71.2    3e-11   Leymus chinensis
ref|XP_003558709.1|  PREDICTED: sucrose transport protein SUT1        71.2    4e-11   Brachypodium distachyon [annual false brome]
ref|XP_010917013.1|  PREDICTED: sucrose transport protein SUT1 is...  70.9    4e-11   
gb|AIU97954.1|  sucrose transporter 6-like protein                    66.6    5e-11   Morus alba var. multicaulis
ref|XP_004515590.1|  PREDICTED: sucrose transport protein SUC2-like   70.9    5e-11   Cicer arietinum [garbanzo]
ref|XP_010917011.1|  PREDICTED: sucrose transport protein SUT3 is...  70.9    5e-11   Elaeis guineensis
gb|AAL32020.1|  sucrose transporter                                   70.5    6e-11   Vitis vinifera
gb|AJO70162.1|  sucrose transporter 4                                 70.5    6e-11   Camellia sinensis [black tea]
ref|XP_008797155.1|  PREDICTED: sucrose transport protein SUT1-like   70.5    6e-11   
gb|ADW94617.1|  sucrose transporter 4                                 70.5    6e-11   Populus tremula x Populus alba [gray poplar]
ref|XP_010917012.1|  PREDICTED: sucrose transport protein SUT1 is...  70.5    7e-11   Elaeis guineensis
gb|KHN32801.1|  Sucrose transport protein                             69.7    8e-11   Glycine soja [wild soybean]
ref|XP_004985542.1|  PREDICTED: sucrose transport protein SUT1-like   70.1    8e-11   Setaria italica
emb|CAB75881.1|  sucrose transporter 2                                70.1    8e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93580.1|  predicted protein                                    70.1    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAB75882.1|  sucrose transporter 1                                70.1    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ20123.1|  sucrose transporter 1                                70.1    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006599449.1|  PREDICTED: sucrose transport protein SUC8-like   69.7    1e-10   Glycine max [soybeans]
gb|ABX10015.1|  sucrose transporter                                   69.7    1e-10   Lolium perenne [perennial ryegrass]
gb|KHN32799.1|  Sucrose transport protein SUC2                        69.7    1e-10   Glycine soja [wild soybean]
ref|XP_003548077.1|  PREDICTED: sucrose transport protein SUC8-like   69.7    1e-10   Glycine max [soybeans]
ref|XP_006386430.1|  hypothetical protein POPTR_0002s10710g           67.0    1e-10   
gb|AIE90172.1|  sucrose transporter 2A                                69.7    1e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CAA57727.1|  sucrose transporter                                  69.7    1e-10   Nicotiana tabacum [American tobacco]
ref|XP_009777676.1|  PREDICTED: sucrose transport protein-like        69.7    1e-10   Nicotiana sylvestris
emb|CAQ58421.1|  sucrose transporter                                  69.7    1e-10   Nicotiana tabacum [American tobacco]
emb|CAQ58420.1|  sucrose transporter                                  69.7    1e-10   Nicotiana tabacum [American tobacco]
gb|ABB30162.2|  sucrose transport protein SUF4                        69.7    1e-10   Pisum sativum [garden pea]
ref|XP_009630281.1|  PREDICTED: sucrose transport protein-like        69.3    1e-10   Nicotiana tomentosiformis
gb|AFS33111.1|  SUF4b                                                 69.3    1e-10   Pisum sativum [garden pea]
gb|ACO87669.1|  sucrose transport protein                             69.3    1e-10   Brachypodium sylvaticum
tpg|DAA43619.1|  TPA: hypothetical protein ZEAMMB73_332694            69.3    1e-10   
ref|XP_008648004.1|  PREDICTED: sucrose transporter1 isoform X1       69.3    2e-10   
gb|AAL90455.1|AF408845_1  sucrose transporter SUT1D                   69.3    2e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CAA57726.1|  sucrose transporter                                  68.9    2e-10   Solanum lycopersicum
emb|CAA48915.1|  sucrose transport protein                            68.9    2e-10   Solanum tuberosum [potatoes]
ref|NP_001137486.1|  sucrose transporter4                             68.9    2e-10   Zea mays [maize]
tpg|DAA54802.1|  TPA: sucrose transport protein                       68.9    2e-10   
ref|XP_001766981.1|  predicted protein                                68.6    2e-10   
gb|AAT51689.1|  sucrose transport protein                             68.6    2e-10   Zea mays [maize]
gb|AGZ83099.1|  sucrose transporter 4                                 68.6    2e-10   Zea mays subsp. mays [corn]
gb|ACJ85843.1|  unknown                                               66.6    2e-10   Medicago truncatula
ref|XP_001777456.1|  predicted protein                                68.6    2e-10   
gb|ACX71839.1|  sucrose transporter 4                                 68.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_002443677.1|  hypothetical protein SORBIDRAFT_08g023310        68.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_011016949.1|  PREDICTED: sucrose transport protein SUC4        68.6    2e-10   Populus euphratica
gb|KJB28907.1|  hypothetical protein B456_005G075300                  68.2    2e-10   Gossypium raimondii
ref|XP_001768298.1|  predicted protein                                68.6    3e-10   
ref|NP_001289830.1|  sucrose transport protein                        68.6    3e-10   Solanum lycopersicum
ref|XP_006599448.1|  PREDICTED: sucrose transport protein SUC8-li...  68.6    3e-10   Glycine max [soybeans]
ref|XP_003518345.1|  PREDICTED: sucrose transport protein SUC8-like   68.6    3e-10   Glycine max [soybeans]
emb|CBI31990.3|  unnamed protein product                              68.6    3e-10   Vitis vinifera
ref|XP_006851036.1|  hypothetical protein AMTR_s00025p00229310        68.6    3e-10   
ref|XP_007141313.1|  hypothetical protein PHAVU_008G185300g           68.6    3e-10   Phaseolus vulgaris [French bean]
ref|XP_006599447.1|  PREDICTED: sucrose transport protein SUC8-li...  68.6    3e-10   Glycine max [soybeans]
gb|KHG00539.1|  Sucrose transport SUC2 -like protein                  68.6    3e-10   Gossypium arboreum [tree cotton]
ref|XP_010063792.1|  PREDICTED: putative sucrose transport protei...  68.6    3e-10   Eucalyptus grandis [rose gum]
gb|KJB81364.1|  hypothetical protein B456_013G140900                  68.2    3e-10   Gossypium raimondii
ref|XP_007151866.1|  hypothetical protein PHAVU_004G082200g           68.6    3e-10   Phaseolus vulgaris [French bean]
ref|XP_006351170.1|  PREDICTED: sucrose transport protein-like        68.6    3e-10   Solanum tuberosum [potatoes]
gb|KJB28906.1|  hypothetical protein B456_005G075300                  68.2    3e-10   Gossypium raimondii
ref|XP_001778997.1|  predicted protein                                68.6    3e-10   
gb|KJB81363.1|  hypothetical protein B456_013G140900                  68.2    3e-10   Gossypium raimondii
ref|XP_011074299.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...  68.6    3e-10   
ref|XP_011097249.1|  PREDICTED: sucrose transport protein SUC2-like   68.2    4e-10   Sesamum indicum [beniseed]
gb|KJB81361.1|  hypothetical protein B456_013G140900                  68.2    4e-10   Gossypium raimondii
gb|AAU11810.1|  sucrose transporter                                   68.2    4e-10   Juglans regia
ref|XP_007151901.1|  hypothetical protein PHAVU_004G085400g           67.8    4e-10   Phaseolus vulgaris [French bean]
gb|AIE90174.1|  sucrose transporter 2D                                67.8    4e-10   Triticum aestivum [Canadian hard winter wheat]
dbj|BAA89458.1|  sucrose transporter protein                          67.8    4e-10   Daucus carota [carrots]
ref|XP_003548078.1|  PREDICTED: sucrose transport protein SUC1-like   67.8    4e-10   Glycine max [soybeans]
emb|CAQ58422.1|  sucrose transporter                                  67.8    4e-10   Nicotiana tabacum [American tobacco]
emb|CAC19689.1|  sucrose/proton symporter                             67.8    4e-10   Daucus carota [carrots]
ref|XP_008378695.1|  PREDICTED: sucrose transport protein SUC4-like   68.2    5e-10   
ref|XP_006433712.1|  hypothetical protein CICLE_v100009412mg          65.1    5e-10   
emb|CAA76369.1|  sucrose/H+ symporter                                 67.8    5e-10   Daucus carota [carrots]
ref|XP_008444969.1|  PREDICTED: sucrose transport protein SUC4 is...  67.8    5e-10   Cucumis melo [Oriental melon]
gb|ACV95498.1|  sucrose transporter                                   67.8    5e-10   Saccharum hybrid cultivar ROC22
gb|KHG01351.1|  Sucrose transport SUC2 -like protein                  67.8    5e-10   Gossypium arboreum [tree cotton]
ref|NP_001284446.1|  sucrose transport protein SUC4                   67.8    5e-10   Cucumis melo [Oriental melon]
gb|KHN00701.1|  Sucrose transport protein SUC2                        67.4    5e-10   Glycine soja [wild soybean]
gb|AHA80795.2|  sucrose transport protein 1                           67.8    5e-10   Paeonia suffruticosa [moutan peony]
gb|AFK34473.1|  unknown                                               66.6    5e-10   Medicago truncatula
gb|ABF94212.1|  sucrose transporter, putative, expressed              67.8    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003518348.1|  PREDICTED: sucrose transport protein SUC1-like   67.4    6e-10   Glycine max [soybeans]
ref|XP_002961568.1|  hypothetical protein SELMODRAFT_76990            67.4    6e-10   
ref|XP_002971245.1|  hypothetical protein SELMODRAFT_94770            67.4    6e-10   
gb|ABF94214.1|  sucrose transporter, putative, expressed              67.4    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141050.1|  sucrose transporter BoSUT1                       67.4    6e-10   Zea mays [maize]
gb|ABF94213.1|  sucrose transporter, putative, expressed              67.4    7e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KFK25020.1|  hypothetical protein AALP_AA8G056600                  67.8    7e-10   Arabis alpina [alpine rockcress]
ref|XP_007151899.1|  hypothetical protein PHAVU_004G0852000g          64.7    7e-10   Phaseolus vulgaris [French bean]
ref|XP_004501070.1|  PREDICTED: sucrose transport protein SUC4-like   67.4    7e-10   Cicer arietinum [garbanzo]
gb|ADB04246.1|  sucrose transporter                                   67.4    7e-10   Cucumis sativus [cucumbers]
ref|XP_004148402.1|  PREDICTED: sucrose transport protein SUC4-like   67.4    7e-10   Cucumis sativus [cucumbers]
gb|KFK25021.1|  hypothetical protein AALP_AA8G056600                  67.8    7e-10   Arabis alpina [alpine rockcress]
ref|XP_001777654.1|  predicted protein                                67.4    7e-10   
ref|XP_007151897.1|  hypothetical protein PHAVU_004G085100g           67.4    7e-10   Phaseolus vulgaris [French bean]
emb|CAA76367.1|  sucrose/H+ symporter                                 67.0    7e-10   Daucus carota [carrots]
gb|AAD53000.1|U64967_1  sucrose-proton symporter                      67.4    7e-10   Beta vulgaris [beet]
gb|KGN62782.1|  hypothetical protein Csa_2G372770                     67.0    7e-10   Cucumis sativus [cucumbers]
gb|ABB30164.1|  sucrose transport protein SUT1                        67.0    7e-10   Phaseolus vulgaris [French bean]
ref|NP_001049111.1|  Os03g0170900                                     67.4    7e-10   
gb|AAF04294.1|AF191024_1  sucrose transporter 1                       67.0    8e-10   Maurandya barclayana
sp|A2ZN77.2|SUT2_ORYSI  RecName: Full=Sucrose transport protein S...  67.0    8e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001290021.1|  sucrose transport protein                        67.0    8e-10   Beta vulgaris subsp. vulgaris [field beet]
sp|Q0ILJ3.2|SUT2_ORYSJ  RecName: Full=Sucrose transport protein S...  67.0    8e-10   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA24071.1|  sucrose transporter                                  67.0    8e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFW89525.1|  hypothetical protein ZEAMMB73_311282                  67.0    8e-10   
ref|XP_008660500.1|  PREDICTED: sucrose transport protein SUT1-like   67.0    8e-10   
ref|XP_002465781.1|  hypothetical protein SORBIDRAFT_01g045720        67.0    8e-10   Sorghum bicolor [broomcorn]
ref|XP_007020266.1|  Sucrose transport protein SUC2 isoform 1         67.0    8e-10   
gb|ABA99632.2|  sucrose/H+ symporter family protein, expressed        67.0    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104840.1|  sucrose transporter1                             67.0    9e-10   
gb|ACY69230.1|  sucrose transporter 1                                 67.0    9e-10   Sorghum bicolor [broomcorn]
gb|EYU22863.1|  hypothetical protein MIMGU_mgv1a023262mg              66.6    9e-10   Erythranthe guttata [common monkey flower]
gb|EEE53686.1|  hypothetical protein OsJ_37034                        67.0    9e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ADE22272.1|  sucrose transporter protein                           67.0    9e-10   Saccharum hybrid cultivar [sugarcane]
ref|XP_010495086.1|  PREDICTED: sucrose transport protein SUC8-like   64.3    9e-10   Camelina sativa [gold-of-pleasure]
gb|EAY84061.1|  hypothetical protein OsI_39292                        67.0    9e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004963349.1|  PREDICTED: sucrose transport protein SUT2-like   66.6    1e-09   Setaria italica
gb|AHB33870.1|  sucrose transporter                                   66.6    1e-09   Fraxinus excelsior
ref|XP_011465639.1|  PREDICTED: sucrose transport protein SUC2-like   66.2    1e-09   Fragaria vesca subsp. vesca
ref|XP_001752965.1|  predicted protein                                66.6    1e-09   
ref|XP_008245088.1|  PREDICTED: sucrose transport protein             66.6    1e-09   Prunus mume [ume]
ref|XP_002978868.1|  hypothetical protein SELMODRAFT_109895           66.6    1e-09   
ref|XP_002988481.1|  hypothetical protein SELMODRAFT_183916           66.6    1e-09   
ref|XP_006664797.1|  PREDICTED: sucrose transport protein SUT2-like   66.6    1e-09   Oryza brachyantha
ref|XP_004298889.1|  PREDICTED: sucrose transport protein SUC2-like   66.6    1e-09   Fragaria vesca subsp. vesca
ref|NP_001236298.1|  sucrose transporter                              66.6    1e-09   
gb|AHB33871.1|  sucrose transporter                                   66.6    1e-09   Quercus robur [English oak]
ref|NP_199174.1|  putative sucrose transport protein SUC6             66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EYU22864.1|  hypothetical protein MIMGU_mgv1a004602mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
gb|ADW94613.1|  sucrose transporter 1                                 66.6    1e-09   Populus trichocarpa [western balsam poplar]
gb|AHH34929.1|  sucrose transporter 6                                 66.2    1e-09   Theobroma cacao [chocolate]
ref|XP_007201709.1|  hypothetical protein PRUPE_ppa004033mg           66.6    1e-09   
dbj|BAO02526.1|  predicted sucrose transporter-like protein ortholog  66.2    1e-09   Nicotiana alata [flowering tobacco]
ref|XP_007009466.1|  Sucrose transport protein SUC2                   66.2    1e-09   
gb|KDP34602.1|  hypothetical protein JCGZ_11979                       66.6    1e-09   Jatropha curcas
ref|XP_006376318.1|  putative sucrose-H+ symporter family protein     66.6    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011038161.1|  PREDICTED: sucrose transport protein SUC8-like   66.6    1e-09   Populus euphratica
gb|ADW94614.1|  sucrose transporter 1                                 66.2    1e-09   
gb|AFM28284.1|  SUT1-1                                                66.2    1e-09   
emb|CAC19851.1|  sucrose trasporter                                   66.2    1e-09   
gb|EYU34230.1|  hypothetical protein MIMGU_mgv1a005175mg              66.2    1e-09   
gb|AAC99332.1|  sucrose transporter                                   66.2    1e-09   
ref|XP_008381009.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...  66.2    1e-09   
ref|XP_004951473.1|  PREDICTED: sucrose transport protein SUT2-like   62.8    1e-09   
emb|CAG70682.1|  putative sucrose-H+ symporter                        66.2    1e-09   
gb|AAM13409.1|AF408843_1  sucrose transporter SUT1B                   66.2    2e-09   
gb|AAV41028.1|  sucrose transporter                                   66.2    2e-09   
ref|XP_011001730.1|  PREDICTED: sucrose transport protein SUC8-like   66.2    2e-09   
ref|XP_009348838.1|  PREDICTED: sucrose transport protein-like        66.2    2e-09   
ref|XP_010695439.1|  PREDICTED: sucrose transport protein SUC4        66.2    2e-09   
ref|XP_009339088.1|  PREDICTED: sucrose transport protein-like        66.2    2e-09   
ref|XP_009348390.1|  PREDICTED: sucrose transport protein-like        66.2    2e-09   
gb|AAM13408.1|AF408842_1  sucrose transporter SUT1A                   66.2    2e-09   
gb|AAD45390.1|AF167415_1  sucrose transporter SUT2A                   66.2    2e-09   
gb|ADF28098.1|  sucrose transporter                                   66.2    2e-09   
ref|XP_009375259.1|  PREDICTED: sucrose transport protein-like        66.2    2e-09   
ref|XP_006371473.1|  hypothetical protein POPTR_0019s11560g           65.9    2e-09   
gb|ACX33146.1|  sucrose transporter 1                                 66.2    2e-09   
ref|XP_006285493.1|  hypothetical protein CARUB_v10006922mg           65.9    2e-09   
ref|XP_010490497.1|  PREDICTED: sucrose transport protein SUC4        66.2    2e-09   
gb|ADW94616.1|  sucrose transporter 3                                 66.2    2e-09   
gb|ADL63119.1|  sucrose transporter 1x                                65.9    2e-09   
gb|ADL63118.1|  sucrose transporter 1x                                65.9    2e-09   
emb|CDX80991.1|  BnaC03g02450D                                        65.9    2e-09   
ref|XP_002326003.2|  sucrose transporter family protein               65.9    2e-09   
gb|ACG33134.1|  sucrose transporter BoSUT1                            65.9    2e-09   
ref|XP_007020264.1|  Sucrose-proton symporter 2 isoform 2             65.9    2e-09   
gb|ACF79455.1|  unknown                                               65.9    2e-09   
ref|XP_009130919.1|  PREDICTED: putative sucrose transport protei...  65.9    2e-09   
gb|EPS65755.1|  sucrose transporter                                   65.5    2e-09   
ref|XP_004290438.1|  PREDICTED: sucrose transport protein SUC2-like   65.9    2e-09   
gb|ADW94615.1|  sucrose transporter 1                                 65.9    2e-09   
gb|KCW71038.1|  hypothetical protein EUGRSUZ_F04138                   65.5    2e-09   
gb|AFU61907.1|  sucrose transporter 1                                 65.9    2e-09   
ref|XP_010063780.1|  PREDICTED: sucrose transport protein SUC8-like   65.5    3e-09   
ref|XP_002978870.1|  hypothetical protein SELMODRAFT_177267           65.5    3e-09   
gb|KJB28739.1|  hypothetical protein B456_005G067000                  65.5    3e-09   
gb|KHG14831.1|  Sucrose transport SUC2 -like protein                  65.5    3e-09   
gb|ABB89051.1|  putative sucrose transporter SUT3                     65.5    3e-09   
gb|KJB59620.1|  hypothetical protein B456_009G264400                  65.5    3e-09   
ref|NP_179074.1|  sucrose transport protein SUC8                      65.5    3e-09   
ref|XP_002988479.1|  hypothetical protein SELMODRAFT_269407           65.5    3e-09   
ref|XP_010458319.1|  PREDICTED: sucrose transport protein SUC4-like   65.5    3e-09   
ref|XP_002871200.1|  sucrose-proton symporter 6                       65.5    3e-09   
gb|AAO38059.1|  sucrose transporter SUC1                              62.8    3e-09   
ref|XP_007020263.1|  Sucrose-proton symporter 2 isoform 1             65.1    3e-09   
gb|ACO55747.1|  sucrose transporter                                   65.5    3e-09   
ref|XP_002887046.1|  predicted protein                                65.1    3e-09   
ref|NP_196235.1|  sucrose transport protein SUC9                      65.1    3e-09   
ref|XP_008382139.1|  PREDICTED: sucrose transport protein-like        65.1    3e-09   
gb|AAF65765.1|AF242307_1  sucrose transport protein                   65.1    3e-09   
ref|XP_006286640.1|  hypothetical protein CARUB_v10002510mg           65.1    3e-09   
ref|XP_009103222.1|  PREDICTED: sucrose transport protein SUC2        65.1    3e-09   
ref|XP_002885931.1|  hypothetical protein ARALYDRAFT_319456           64.7    4e-09   
ref|XP_002526849.1|  sucrose transport protein, putative              65.1    4e-09   
emb|CAA83436.1|  sucrose carrier                                      65.1    4e-09   
ref|XP_006473216.1|  PREDICTED: sucrose transport protein SUC2 is...  64.7    4e-09   
ref|XP_010521130.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...  65.1    4e-09   
ref|XP_006434633.1|  hypothetical protein CICLE_v10000828mg           65.1    4e-09   
ref|XP_004952871.1|  PREDICTED: sucrose transport protein SUT5-like   65.1    4e-09   
ref|XP_011464770.1|  PREDICTED: sucrose transport protein SUC4        65.1    4e-09   
emb|CDP00966.1|  unnamed protein product                              65.1    4e-09   
ref|NP_001275850.1|  citrus sucrose transporter 1                     65.1    4e-09   
ref|XP_006589462.1|  PREDICTED: sucrose transport protein             65.1    4e-09   
gb|ABK60190.2|  sucrose transporter 3                                 65.1    4e-09   
emb|CAM34330.1|  sucrose transporter 6                                65.1    4e-09   
ref|NP_177334.1|  sucrose transport protein SUC5                      64.7    4e-09   
ref|XP_006434634.1|  hypothetical protein CICLE_v10000828mg           64.7    4e-09   
ref|XP_010428037.1|  PREDICTED: sucrose transport protein SUC1-like   64.7    4e-09   
ref|XP_006473215.1|  PREDICTED: sucrose transport protein SUC2 is...  64.7    4e-09   
ref|XP_009629211.1|  PREDICTED: sucrose transport protein SUC4-li...  64.7    5e-09   
ref|XP_006416169.1|  hypothetical protein EUTSA_v10009321mg           64.7    5e-09   
gb|AHH34921.1|  sucrose transporter 1 isoform 1                       64.7    5e-09   
ref|XP_006827163.1|  hypothetical protein AMTR_s00010p00253920        61.2    5e-09   
sp|Q03411.1|SUT_SPIOL  RecName: Full=Sucrose transport protein; A...  64.7    5e-09   
ref|XP_010415904.1|  PREDICTED: sucrose transport protein SUC1-like   64.7    5e-09   
ref|XP_007137288.1|  hypothetical protein PHAVU_009G114700g           64.7    5e-09   
ref|XP_009629206.1|  PREDICTED: sucrose transport protein SUC4-li...  64.7    5e-09   
ref|XP_008790395.1|  PREDICTED: sucrose transport protein SUT2-li...  64.7    5e-09   
ref|XP_007020259.1|  Sucrose-proton symporter 2 isoform 1             64.7    5e-09   
gb|AAU21439.1|  putative sucrose carrier                              64.7    5e-09   
ref|XP_008790394.1|  PREDICTED: sucrose transport protein SUT2-li...  64.7    5e-09   
ref|XP_002510005.1|  sucrose transport protein, putative              64.7    5e-09   
gb|AHH34922.1|  sucrose transporter 1 isoform 2                       64.7    5e-09   
ref|XP_007020260.1|  Sucrose-proton symporter 2 isoform 2             64.7    5e-09   
ref|XP_008790396.1|  PREDICTED: sucrose transport protein SUT2-li...  64.3    5e-09   
ref|XP_006302149.1|  hypothetical protein CARUB_v10020153mg           64.7    6e-09   
ref|NP_001268066.1|  sucrose transporter-like                         64.3    6e-09   
ref|XP_008802408.1|  PREDICTED: sucrose transport protein SUT4-li...  64.7    6e-09   
ref|XP_003575214.1|  PREDICTED: sucrose transport protein SUT5-like   64.3    6e-09   
dbj|BAC67163.1|  sucrose transporter                                  64.3    6e-09   
ref|XP_008790392.1|  PREDICTED: sucrose transport protein SUT2-li...  64.3    6e-09   
gb|ADY11193.1|  sucrose transporter                                   64.3    6e-09   
gb|AAD55269.1|AF182445_1  sucrose transporter                         64.3    6e-09   
ref|XP_010664062.1|  PREDICTED: sucrose transporter-like isoform X1   64.3    6e-09   
gb|AAF04295.2|AF191025_1  sucrose transporter 1                       64.3    6e-09   
gb|ABJ51933.1|  sucrose transporter 1                                 64.3    6e-09   
emb|CDY22612.1|  BnaC08g42460D                                        64.3    6e-09   
ref|XP_010471205.1|  PREDICTED: sucrose transport protein SUC5-like   64.3    6e-09   
gb|AHG94615.1|  sucrose transporter                                   64.3    6e-09   
ref|XP_007151903.1|  hypothetical protein PHAVU_004G085500g           64.3    6e-09   
gb|KCW71037.1|  hypothetical protein EUGRSUZ_F04137                   64.3    7e-09   
ref|XP_010063779.1|  PREDICTED: sucrose transport protein SUC2-like   64.3    7e-09   
ref|XP_007143634.1|  hypothetical protein PHAVU_007G088200g           64.3    7e-09   
gb|ADK62516.1|  sucrose transporter 1y                                64.3    7e-09   
emb|CAA59113.1|  SUC1-sucrose proton symporter                        64.3    7e-09   
emb|CAA53390.2|  sucrose transporter                                  64.3    7e-09   
ref|XP_010471204.1|  PREDICTED: sucrose transport protein SUC1        64.3    7e-09   
emb|CAE53179.1|  sucrose transporter                                  64.3    7e-09   
ref|XP_006390731.1|  hypothetical protein EUTSA_v10018412mg           63.9    7e-09   
gb|ABB30166.1|  putative sucrose transport protein SUT3               63.9    7e-09   
gb|ABB30165.1|  sucrose transport protein SUF1                        64.3    7e-09   
ref|XP_007151902.1|  hypothetical protein PHAVU_004G085500g           63.9    8e-09   
ref|XP_009335489.1|  PREDICTED: sucrose transport protein SUC4-like   63.9    8e-09   
ref|XP_006392336.1|  hypothetical protein EUTSA_v10023799mg           63.9    8e-09   
ref|XP_009765486.1|  PREDICTED: sucrose transport protein SUC4-li...  63.9    8e-09   
ref|XP_008357583.1|  PREDICTED: sucrose transport protein SUC4-like   63.9    8e-09   
gb|KDO81342.1|  hypothetical protein CISIN_1g010639mg                 63.9    8e-09   
gb|KDO81344.1|  hypothetical protein CISIN_1g010639mg                 63.9    8e-09   
emb|CAC33492.1|  sucrose carrier                                      63.2    8e-09   
ref|XP_006472375.1|  PREDICTED: sucrose transport protein SUC4-li...  63.9    8e-09   
ref|XP_010936248.1|  PREDICTED: sucrose transport protein SUT2-like   63.9    8e-09   
emb|CAJ33718.1|  sucrose transporter 1                                63.9    8e-09   
ref|NP_001031242.1|  putative sucrose transport protein SUC7          63.9    9e-09   
gb|KDO81341.1|  hypothetical protein CISIN_1g010639mg                 63.9    9e-09   
ref|XP_002862880.1|  hypothetical protein ARALYDRAFT_497263           63.9    9e-09   
ref|XP_002887397.1|  hypothetical protein ARALYDRAFT_476315           63.9    9e-09   
ref|NP_001031241.1|  putative sucrose transport protein SUC7          63.5    9e-09   
ref|XP_009127880.1|  PREDICTED: sucrose transport protein SUC1        63.9    9e-09   
gb|AGO64129.1|  sucrose transporter                                   63.9    9e-09   
ref|XP_006852724.1|  hypothetical protein AMTR_s00033p00073720        63.9    9e-09   
ref|XP_009615003.1|  PREDICTED: sucrose transport protein SUC4-li...  63.9    9e-09   
ref|XP_007018362.1|  Sucrose proton symporter                         63.9    9e-09   
gb|AJO70163.1|  sucrose transporter 5                                 63.9    1e-08   
gb|KDO81345.1|  hypothetical protein CISIN_1g010639mg                 63.5    1e-08   
gb|KHF99226.1|  Sucrose transport SUC2 -like protein                  63.9    1e-08   
ref|NP_001234344.1|  sucrose transporter                              63.9    1e-08   
dbj|BAO96215.1|  sucrose transporter 4                                63.9    1e-08   
emb|CDY03675.1|  BnaA02g15620D                                        63.9    1e-08   
ref|NP_001268070.1|  sucrose transporter-like                         63.9    1e-08   
gb|ACB47398.1|  sucrose transporter                                   63.9    1e-08   
ref|XP_006390730.1|  hypothetical protein EUTSA_v10018412mg           63.9    1e-08   
emb|CAN67869.1|  hypothetical protein VITISV_020809                   63.5    1e-08   
ref|XP_006417511.1|  hypothetical protein EUTSA_v10007390mg           63.5    1e-08   
gb|AAY87138.1|  putative sucrose transporter                          63.5    1e-08   
ref|XP_010673573.1|  PREDICTED: sucrose transport protein SUC2-like   63.5    1e-08   
ref|XP_009765485.1|  PREDICTED: sucrose transport protein SUC4-li...  63.5    1e-08   
ref|NP_177333.1|  sucrose transport protein SUC1                      63.5    1e-08   
gb|AAL58071.1|  sucrose transporter SUC1                              63.5    1e-08   
gb|AFM28289.1|  SUT4-2                                                63.5    1e-08   
ref|XP_006399085.1|  hypothetical protein EUTSA_v10015600mg           63.5    1e-08   
ref|XP_006392340.1|  hypothetical protein EUTSA_v10023916mg           63.5    1e-08   
ref|XP_009615002.1|  PREDICTED: sucrose transport protein SUC4-li...  63.5    1e-08   
dbj|BAI60050.1|  sucrose transporter                                  63.5    1e-08   
ref|XP_002445925.1|  hypothetical protein SORBIDRAFT_07g028120        63.5    1e-08   
gb|AAB60751.1|  Similar to Vicia sucrose transport protein (gb|Z9...  63.5    1e-08   
gb|AAL58072.1|  sucrose transporter SUC2                              63.5    1e-08   
gb|AAG09191.1|AF175321_1  sucrose transporter SUT4                    63.5    1e-08   
gb|KFK41606.1|  hypothetical protein AALP_AA2G150200                  63.5    1e-08   
ref|XP_009115609.1|  PREDICTED: sucrose transport protein SUC2        63.5    1e-08   
ref|NP_172467.1|  sucrose transporter 4                               63.5    1e-08   
ref|XP_002887396.1|  sucrose-proton symporter 1                       63.5    1e-08   
emb|CDX98907.1|  BnaC09g49280D                                        63.5    1e-08   
gb|ADL29729.1|  sugar transporter                                     63.5    1e-08   
ref|XP_006417508.1|  hypothetical protein EUTSA_v10007390mg           63.5    1e-08   
dbj|BAD44273.1|  hypothetical protein                                 63.5    1e-08   
ref|NP_176830.1|  putative sucrose transport protein SUC7             63.5    1e-08   
ref|XP_010425916.1|  PREDICTED: putative sucrose transport protei...  63.2    1e-08   
ref|XP_010060140.1|  PREDICTED: sucrose transport protein SUC4        63.5    1e-08   
gb|AAD34610.1|AF149981_1  sucrose transporter-like protein            63.5    1e-08   
ref|XP_010503137.1|  PREDICTED: sucrose transport protein SUC8-li...  63.2    1e-08   
ref|XP_006307275.1|  hypothetical protein CARUB_v10008890mg           63.5    1e-08   
emb|CDX72840.1|  BnaC06g32880D                                        63.5    1e-08   
ref|XP_009105851.1|  PREDICTED: sucrose transport protein SUC1-like   63.2    1e-08   
ref|XP_009779331.1|  PREDICTED: sucrose transport protein SUC8-like   63.5    1e-08   
ref|XP_002889777.1|  sucrose transporter SUT4                         63.2    1e-08   
gb|KFK44362.1|  hypothetical protein AALP_AA1G247500                  63.2    1e-08   
ref|XP_006301807.1|  hypothetical protein CARUB_v10022273mg           63.2    1e-08   
ref|XP_010475856.1|  PREDICTED: sucrose transport protein SUC4-like   63.2    1e-08   
ref|NP_001275070.1|  sucrose transporter 4                            63.2    1e-08   
ref|XP_008219162.1|  PREDICTED: sucrose transport protein SUC4        63.2    1e-08   
ref|XP_007223388.1|  hypothetical protein PRUPE_ppa004620mg           63.2    1e-08   
emb|CDY62732.1|  BnaC05g49240D                                        63.2    1e-08   
gb|EMT17451.1|  Sucrose transport protein SUC3                        63.5    1e-08   
ref|XP_002893246.1|  sucrose-proton symporter 2                       63.2    2e-08   
gb|AJO70164.1|  sucrose transporter 6                                 63.2    2e-08   
ref|XP_010491171.1|  PREDICTED: sucrose transport protein SUC8-like   63.2    2e-08   
ref|XP_009148315.1|  PREDICTED: sucrose transport protein SUC4        63.2    2e-08   
emb|CDX93458.1|  BnaA06g05900D                                        63.2    2e-08   
ref|XP_004496382.1|  PREDICTED: sucrose transport protein-like        63.2    2e-08   
ref|XP_009357240.1|  PREDICTED: sucrose transport protein SUC4-like   63.2    2e-08   
ref|NP_173685.1|  sucrose transport protein SUC2                      63.2    2e-08   
emb|CDY60441.1|  BnaA10g30480D                                        63.2    2e-08   
ref|XP_010939304.1|  PREDICTED: sucrose transport protein SUT2-like   63.2    2e-08   
ref|XP_010544043.1|  PREDICTED: sucrose transport protein SUC4-like   63.2    2e-08   
emb|CAA53150.1|  sucrose-proton symporter                             63.2    2e-08   
ref|XP_009122220.1|  PREDICTED: putative sucrose transport protei...  62.8    2e-08   
gb|AAM10322.1|  At1g22710/T22J18_12                                   63.2    2e-08   
ref|XP_008339011.1|  PREDICTED: sucrose transport protein SUC4-like   62.8    2e-08   
ref|XP_010425915.1|  PREDICTED: putative sucrose transport protei...  62.8    2e-08   
ref|NP_001280809.1|  sucrose transport protein SUC4-like              62.8    2e-08   
ref|XP_010503136.1|  PREDICTED: sucrose transport protein SUC8-li...  62.8    2e-08   
gb|EMS35632.1|  Sucrose transport protein SUT5                        62.8    2e-08   
gb|AAO26335.1|  putative sucrose transporter                          60.5    2e-08   
ref|XP_010428038.1|  PREDICTED: sucrose transport protein SUC5-like   62.8    2e-08   
emb|CDY53828.1|  BnaA09g57200D                                        62.8    2e-08   
ref|XP_009792133.1|  PREDICTED: sucrose transport protein SUC4-like   62.8    2e-08   
ref|XP_009118285.1|  PREDICTED: sucrose transport protein SUC4-like   62.8    2e-08   
ref|XP_010553671.1|  PREDICTED: sucrose transport protein SUC4-like   62.8    2e-08   
gb|ABA08443.1|  sucrose transporter type 4                            62.8    2e-08   
ref|XP_002973765.1|  hypothetical protein SELMODRAFT_232150           62.4    2e-08   
gb|ADL63117.1|  sucrose transporter 2y                                62.4    3e-08   
ref|XP_002975813.1|  hypothetical protein SELMODRAFT_232600           62.4    3e-08   
ref|XP_010460033.1|  PREDICTED: sucrose transport protein SUC2-like   62.4    3e-08   
ref|XP_010477533.1|  PREDICTED: sucrose transport protein SUC2        62.4    3e-08   
gb|KFK43298.1|  hypothetical protein AALP_AA1G105900                  62.4    3e-08   
ref|XP_006307270.1|  hypothetical protein CARUB_v10008884mg           62.4    3e-08   
ref|XP_010540294.1|  PREDICTED: sucrose transport protein SUC2-like   62.4    3e-08   



>gb|AAV88074.1| sucrose transporter-like protein [Ipomoea batatas]
Length=511

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            MME V+IKVPY NLKQEVEL GA+ELHQRR Q DS  SP RVSNGDSTDS HHQSPVQ S
Sbjct  1    MMEAVTIKVPYRNLKQEVELVGADELHQRRLQIDSQSSPPRVSNGDSTDSSHHQSPVQSS  60

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQ  505
            LLTLILSCTVAAGV FGWALQLSLLTPYIQ
Sbjct  61   LLTLILSCTVAAGVQFGWALQLSLLTPYIQ  90



>ref|XP_009759496.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Nicotiana 
sylvestris]
Length=605

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEE---LHQRRSQADSAFSPHRVSNGDSTDSXH--HQSP  403
            M+ VSI+VPY NLKQEVEL   +E          +DS+ SP RVSNG+S DS       P
Sbjct  1    MDAVSIRVPYKNLKQEVELVNVDESSRFTHLEIHSDSS-SPPRVSNGESHDSHSPPQPPP  59

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            V+ SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  60   VRNSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  107



>ref|XP_011075471.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Sesamum 
indicum]
Length=602

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRR-SQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            M+ VSI+VPY NLK+EVEL  A+E  +RR S    + SPH +S G   D  H   P   S
Sbjct  1    MDAVSIRVPYKNLKKEVELVAADESPRRRFSGIHDSSSPHGLSGGGVVDQ-HQAPPNHCS  59

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI H FSSFIWL
Sbjct  60   LLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHEFSSFIWL  103



>gb|AAT40489.1| putative sucrose transporter-like protein [Solanum demissum]
Length=603

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDS--XHHQSPVQI  412
            M+ VSI+VPY NLKQEVEL   +E    + +  S  S  R SNG+  DS       PV+ 
Sbjct  1    MDAVSIRVPYKNLKQEVELTNVDESRFTQLEIRSDSSSPRASNGEMNDSHLPLPPPPVRN  60

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   SLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  105



>emb|CAD58887.1| sucrose transporter [Plantago major]
Length=599

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            MM+ VSI+VPY NLKQEVEL  A++   +R +     SP  + + DS    HH      S
Sbjct  1    MMDAVSIRVPYKNLKQEVELVSADDDSHQRHRVQIQSSPEPLESPDS--DRHHTPQKNCS  58

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+TLILSCT+AAGV FGWALQLSLLTPYIQTLG+ HAFSSFIWL
Sbjct  59   LMTLILSCTIAAGVQFGWALQLSLLTPYIQTLGVEHAFSSFIWL  102



>ref|XP_009593381.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Nicotiana 
tomentosiformis]
Length=605

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 81/108 (75%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEE---LHQRRSQADSAFSPHRVSNGDSTDSXH--HQSP  403
            M+ VSI+VPY NLKQEVEL   +E         ++DS+ SP RVSNG+S DS       P
Sbjct  1    MDAVSIRVPYKNLKQEVELVNVDESSRFTHLEIRSDSSSSP-RVSNGESRDSHSPPQPPP  59

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            V+ SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  60   VRNSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  107



>ref|XP_009593380.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Nicotiana 
tomentosiformis]
Length=618

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 81/108 (75%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEE---LHQRRSQADSAFSPHRVSNGDSTDSXH--HQSP  403
            M+ VSI+VPY NLKQEVEL   +E         ++DS+ SP RVSNG+S DS       P
Sbjct  1    MDAVSIRVPYKNLKQEVELVNVDESSRFTHLEIRSDSSSSP-RVSNGESRDSHSPPQPPP  59

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            V+ SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  60   VRNSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  107



>ref|NP_001234321.1| sucrose transporter-like protein [Solanum lycopersicum]
 gb|AAG12987.1|AF166498_1 sucrose transporter-like protein [Solanum lycopersicum]
Length=604

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHH--QSPVQ  409
            M+ VSI+VPY NLKQ EVEL   +E    + +  S  S  RVSNG+  DS       PV+
Sbjct  1    MDAVSIRVPYKNLKQQEVELTNVDESRFAQLEIRSDSSSPRVSNGEMNDSNLPLPPPPVR  60

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   NSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  106



>gb|AAX49396.1| sucrose transporter 2 [Eucommia ulmoides]
Length=604

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 76/108 (70%), Gaps = 7/108 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGD-----STDSXHHQSP  403
            M+ V+I+VPY NLKQEVEL G EE   RR Q D + S +  SNG+        S    +P
Sbjct  1    MDAVTIRVPYRNLKQEVELVGIEEQPPRRVQIDQSSSGN--SNGNVSNHSPNSSPSDLAP  58

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             Q +L +LIL CTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   KQNTLFSLILCCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  106



>ref|NP_001275438.1| sucrose transporter-like protein [Solanum tuberosum]
 gb|AAP43631.1| sucrose transporter-like protein [Solanum tuberosum]
Length=605

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDS--XHHQSPVQ  409
            M+ VSI+VPY NLKQ EVEL   +E    + +  S  S  R SNG+  DS       PV+
Sbjct  1    MDAVSIRVPYKNLKQQEVELTNVDESRFTQLEIRSDSSSPRASNGEMNDSHLPLPPPPVR  60

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   NSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  106



>gb|AHA80796.2| sucrose transport protein 2 [Paeonia suffruticosa]
Length=601

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 76/109 (70%), Gaps = 12/109 (11%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNG-----DSTDSXHHQS  400
            M+ VSI+VPY NLKQ EVEL G EE  QRR + DS     RVSNG      S  S   Q 
Sbjct  1    MDSVSIRVPYRNLKQAEVELIGQEE-AQRRIELDS-----RVSNGISNFPTSAPSSPPQG  54

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SLLTLILSC +AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  55   SKGCSLLTLILSCMIAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  103



>gb|AFO84088.1| sucrose transport protein [Actinidia chinensis]
Length=608

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 73/109 (67%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ--EVELAGAEELHQRRSQADSAFSPH-RVSNGDSTD---SXHHQS  400
            M+ V I+VPY NLK   EVEL G +E ++             RVS+G ++D   S  H  
Sbjct  1    MDSVPIRVPYKNLKHASEVELVGVDESNRLHLHNHHHHEDKSRVSDGTNSDLSCSPSHSP  60

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P    L+TLILSCT+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   PKHTPLMTLILSCTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  109



>gb|AHG94616.1| sucrose transporter [Camellia sinensis]
Length=605

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTD-----SXHHQSP  403
            M+ VSI+VPY NL+QEVEL G EE      Q +      R SNG  +D     S  H  P
Sbjct  1    MDSVSIRVPYKNLRQEVELVGLEEAQPHHHQIE-VXEKSRFSNGIDSDLPSSSSPSHPPP  59

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               +L TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  60   KHAALATLILSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  107



>gb|KDP41167.1| hypothetical protein JCGZ_15574 [Jatropha curcas]
Length=615

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 79/116 (68%), Gaps = 17/116 (15%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVE--LAGAEELHQRRSQADSAFSPH------RVSNGDSTDSXHH  394
            M+  SI+VPY NLK+EVE  + G EE H  R   DS  S        ++ NG S+ S   
Sbjct  1    MDTGSIRVPYRNLKKEVEVEMIGVEEQHNHRIHLDSPSSSSSLNSTSQMPNGHSSFS---  57

Query  395  QSPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SP+++     SL+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  58   -SPIEVRSKHYSLITLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  112



>emb|CDP00304.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 75/114 (66%), Gaps = 15/114 (13%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQR-----------RSQADSAFSPHRVSNGDSTDS  385
            M+ VSI+VPY +LKQEVEL   +  H R            S ++S   P   +NGD+ + 
Sbjct  1    MDAVSIRVPYRSLKQEVELIATQNRHNRIVSSLVNNSDMNSSSNSPSPPPPTANGDAENQ  60

Query  386  XHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                S    SLLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   QEKGS----SLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  110



>ref|XP_009129114.1| PREDICTED: sucrose transport protein SUC3-like isoform X1 [Brassica 
rapa]
Length=572

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
             K  E VSI VPY NL+++VE+      HQ  S + S   P   S+G +           
Sbjct  3    GKSGESVSISVPYRNLRKDVEVEMVSAKHQNESASSS---PLNRSDGAAVAK-------D  52

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  53   CSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  98



>ref|XP_010683228.1| PREDICTED: sucrose transport protein SUC3 [Beta vulgaris subsp. 
vulgaris]
Length=592

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 19/111 (17%)
 Frame = +2

Query  245  VVSIKVPYLNLKQ--EVELAGAEELHQRRSQADSAFSPHRVSNGDSTD--------SXHH  394
            VVSI+VPY NLKQ  EVE+ G ++     S A+S     RVSNG   D        S   
Sbjct  8    VVSIRVPYKNLKQAAEVEMVGFDD----DSPANS-----RVSNGVGDDDLPAIHRNSNDL  58

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +S  + SL+ LILSCTVAAGV FGWALQLSLLTPY+QTLG+ HAFSSFIWL
Sbjct  59   RSEKKSSLMMLILSCTVAAGVQFGWALQLSLLTPYVQTLGVGHAFSSFIWL  109



>ref|XP_007046167.1| Sucrose transporter 2 isoform 7 [Theobroma cacao]
 gb|EOY01999.1| Sucrose transporter 2 isoform 7 [Theobroma cacao]
Length=443

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 17/119 (14%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDSTDS  385
            A   + VSI+VPY NLK++ E+   +E H R             S+    R+ NG+S  S
Sbjct  2    AGTSDSVSIRVPYRNLKKQSEVEMIDEPHHRIELNSSPNSPSISSSSPSARIPNGNSNVS  61

Query  386  XHHQSPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SP+ +     SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   ----SPIGVRSKDCSLMTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  116



>emb|CDY09350.1| BnaA02g26600D [Brassica napus]
Length=536

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
             K  E VSI VPY NL+++VE+      HQ  S + S   P   S+G +           
Sbjct  3    GKSGESVSISVPYRNLRKDVEVEMVSTKHQNDSASSS---PLNRSDGAAVAK-------D  52

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  53   CSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  98



>emb|CDY36888.1| BnaC08g09590D [Brassica napus]
Length=535

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
             K  E VSI VPY NL+++VE+      HQ  S + S   P   S+G +           
Sbjct  3    GKSGESVSISVPYRNLRKDVEVEMVSTKHQNDSASSS---PLNRSDGAAVAK-------D  52

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  53   CSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  98



>gb|AHN92214.1| sucrose transporter 2 [Prunus persica]
Length=593

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = +2

Query  251  SIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQI--SLL  421
            SI+VPY NL++ EVE+ G +E H R     S+ S  RV NG    S     P     +L 
Sbjct  9    SIRVPYRNLREAEVEMMGTDEAHHRIDLNSSSSSSPRVLNGTGDLSPPPSQPGHKHNTLT  68

Query  422  TLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   TLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  110



>ref|XP_007222035.1| hypothetical protein PRUPE_ppa003041mg [Prunus persica]
 gb|EMJ23234.1| hypothetical protein PRUPE_ppa003041mg [Prunus persica]
Length=609

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = +2

Query  251  SIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQI--SLL  421
            SI+VPY NL++ EVE+ G +E H R     S+ S  RV NG    S     P     +L 
Sbjct  9    SIRVPYRNLREAEVEMMGTDEAHHRIDLNSSSSSSPRVLNGTGDLSPPPSQPGHKHNTLT  68

Query  422  TLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   TLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  110



>ref|XP_008221653.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Prunus 
mume]
Length=609

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = +2

Query  251  SIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP--VQISLL  421
            SI+VPY NL++ EVE+ G +E H R     S+ S  RV NG    S     P     +L 
Sbjct  9    SIRVPYRNLREAEVEMMGTDEAHHRIDLNSSSSSSPRVLNGTGDLSPPPSQPGHKHNTLT  68

Query  422  TLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   TLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  110



>ref|XP_007046163.1| Sucrose transporter 2 isoform 3 [Theobroma cacao]
 gb|EOY01995.1| Sucrose transporter 2 isoform 3 [Theobroma cacao]
Length=601

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 17/119 (14%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDSTDS  385
            A   + VSI+VPY NLK++ E+   +E H R             S+    R+ NG+S  S
Sbjct  2    AGTSDSVSIRVPYRNLKKQSEVEMIDEPHHRIELNSSPNSPSISSSSPSARIPNGNSNVS  61

Query  386  XHHQSPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SP+ +     SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   ----SPIGVRSKDCSLMTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  116



>ref|XP_007046161.1| Sucrose transporter 2 isoform 1 [Theobroma cacao]
 ref|XP_007046162.1| Sucrose transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY01993.1| Sucrose transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY01994.1| Sucrose transporter 2 isoform 1 [Theobroma cacao]
 gb|AHH34923.1| sucrose transporter 2 isoform 1 [Theobroma cacao]
Length=616

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 17/119 (14%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDSTDS  385
            A   + VSI+VPY NLK++ E+   +E H R             S+    R+ NG+S  S
Sbjct  2    AGTSDSVSIRVPYRNLKKQSEVEMIDEPHHRIELNSSPNSPSISSSSPSARIPNGNSNVS  61

Query  386  XHHQSPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SP+ +     SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   ----SPIGVRSKDCSLMTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  116



>gb|ABI34287.1| Sucrose transporter-like protein, putative [Solanum demissum]
Length=161

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDS--XHHQSPVQI  412
            M+ VSI+VPY NLKQEVEL   +E    + +  S  S  R SNG+  DS       PV+ 
Sbjct  1    MDAVSIRVPYKNLKQEVELTNVDESRFTQLEIRSDSSSPRASNGEMNDSHLPLPPPPVRN  60

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQ  505
            SLLTLILSCTVAAGV FGWALQLSLLTPYIQ
Sbjct  61   SLLTLILSCTVAAGVQFGWALQLSLLTPYIQ  91



>ref|XP_006438655.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
 gb|ESR51895.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
Length=606

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQ----EVELAGAEELHQR--RSQADSAFSPHRVSNGDSTDSXHHQ  397
            M E  S KVPY NLK+    EVE+  A+E H R   +   S+      S   +  S    
Sbjct  1    MSETRSFKVPYRNLKKGTAAEVEMIEADEFHHRIDLNSNASSPPSSSHSPIPNGTSNFAV  60

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             P Q SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   RPKQCSLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  110



>ref|NP_001275773.1| sucrose transporter 2 [Citrus sinensis]
 gb|AAM29153.1| sucrose transporter 2 [Citrus sinensis]
Length=607

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQ----EVELAGAEELHQR--RSQADSAFSPHRVSNGDSTDSXHHQ  397
            M E  S KVPY NLK+    EVE+  A+E H R   +   S+      S   +  S    
Sbjct  1    MSETRSFKVPYRNLKKGTAAEVEMIEADEFHHRIDLNSNASSPPSSSHSPIPNGTSNFAV  60

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             P Q SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   RPKQCSLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  110



>gb|KJB30371.1| hypothetical protein B456_005G139700 [Gossypium raimondii]
Length=616

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 73/115 (63%), Gaps = 9/115 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDST-D  382
            A M + V I+ PY NL +E+E+   ++ H R           A S+    RV NG++   
Sbjct  2    AGMSDSVPIRFPYRNLNKELEVEMIDDPHFRIDLNSSPNSPSASSSSPASRVPNGNANLS  61

Query  383  SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S  H      SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   SPIHAGSKDCSLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  116



>ref|XP_010256864.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Nelumbo 
nucifera]
Length=593

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV  406
            A  M+  SI+VPY N+KQ E+EL G ++ H        A  P+  SN  S  S     P 
Sbjct  2    AGKMDSFSIRVPYKNIKQAELELVGLDDAHHPIDLNSRA--PNGTSN-VSGSSPSAPGPN  58

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              +L TLILSC VAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   YSNLKTLILSCMVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  105



>gb|KJB30370.1| hypothetical protein B456_005G139700 [Gossypium raimondii]
Length=455

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 9/113 (8%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDST-DSX  388
            M + V I+ PY NL +E+E+   ++ H R           A S+    RV NG++   S 
Sbjct  1    MSDSVPIRFPYRNLNKELEVEMIDDPHFRIDLNSSPNSPSASSSSPASRVPNGNANLSSP  60

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             H      SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   IHAGSKDCSLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  113



>gb|KCW86820.1| hypothetical protein EUGRSUZ_B03418 [Eucalyptus grandis]
Length=540

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +2

Query  251  SIKVPYLNLK--QEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQISLLT  424
            SI+VPY NL+  QEVE+   ++    R + DS  +    S      +     P   SL+T
Sbjct  10   SIRVPYRNLRDDQEVEMMSVDDDAHHRIELDSPHAAAAPSARAPNGAGGDFRPAHCSLVT  69

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  70   LILSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  110



>ref|XP_011075472.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Sesamum 
indicum]
Length=580

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRR-SQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            M+ VSI+VPY NLK+EVEL  A+E  +RR S    + SPH +S G   D  H   P   S
Sbjct  1    MDAVSIRVPYKNLKKEVELVAADESPRRRFSGIHDSSSPHGLSGGGVVDQ-HQAPPNHCS  59

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQ  505
            LLTLILSCTVAAGV FGWALQLSLLTPYIQ
Sbjct  60   LLTLILSCTVAAGVQFGWALQLSLLTPYIQ  89



>ref|XP_010256856.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV  406
            A  M+  SI+VPY N+KQ E+EL G ++ H        A  P+  SN  S  S     P 
Sbjct  2    AGKMDSFSIRVPYKNIKQAELELVGLDDAHHPIDLNSRA--PNGTSN-VSGSSPSAPGPN  58

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              +L TLILSC VAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   YSNLKTLILSCMVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  105



>ref|NP_178389.1| sucrose transport protein SUC3 [Arabidopsis thaliana]
 sp|O80605.1|SUC3_ARATH RecName: Full=Sucrose transport protein SUC3; AltName: Full=Sucrose 
permease 3; AltName: Full=Sucrose transporter 2; AltName: 
Full=Sucrose-proton symporter 3 [Arabidopsis thaliana]
 gb|AAC32907.1| putative sucrose/H+ symporter [Arabidopsis thaliana]
 emb|CAB92307.1| sucrose transporter [Arabidopsis thaliana]
 dbj|BAE99038.1| Sucrose transporter [Arabidopsis thaliana]
 gb|AEC05635.1| sucrose transport protein SUC3 [Arabidopsis thaliana]
Length=594

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ-I  412
            M + VSI VPY NL++E+EL    +   R++++ S+      S  + +DS   +S  +  
Sbjct  1    MSDSVSISVPYRNLRKEIELETVTK--HRQNESGSSSFSESASPSNHSDSADGESVSKNC  58

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   SLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  103



>gb|KHG22972.1| Sucrose transport SUC3 -like protein [Gossypium arboreum]
Length=566

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 72/115 (63%), Gaps = 9/115 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDST-D  382
            A M + V I+ PY NL +E+E+   ++ H R           A S+    RV NG++   
Sbjct  2    AGMSDSVPIRFPYRNLNKELEVEITDDPHFRIDLNSSPNSPSASSSSPSSRVPNGNANLS  61

Query  383  SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S  H      S +TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   SPIHAGSKDFSFITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  116



>gb|ADW94618.1| sucrose transporter 5 [Populus tremula x Populus alba]
Length=597

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 74/114 (65%), Gaps = 24/114 (21%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRV-------SNGD--STDS  385
            ME   I+VPY NLK+E  VE+ G E         +S  SP R+       S+ D  S  +
Sbjct  1    MESAPIRVPYRNLKKEIEVEMVGLE--------MESPPSPPRIQSPLTHNSDADLRSQST  52

Query  386  XHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             HH     ISL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  53   RHH-----ISLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  101



>dbj|BAJ34415.1| unnamed protein product [Thellungiella halophila]
Length=523

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 10/104 (10%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQEVELAGAEELHQRR--SQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            + VSI VPY NL+++VEL    + HQ    S + S  + H  ++G++            S
Sbjct  6    DSVSISVPYRNLRKDVELEMVTK-HQMEPASSSSSPLNHHDSADGETVSK-------NCS  57

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  58   LVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  101



>ref|XP_011025852.1| PREDICTED: sucrose transport protein SUC3-like isoform X1 [Populus 
euphratica]
Length=597

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 74/114 (65%), Gaps = 24/114 (21%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRV-------SNGD--STDS  385
            ME   I+VPY NLK+E  VE+ G E         +S  SP R+       S+ D  S  +
Sbjct  1    MESAPIRVPYRNLKKEIEVEMVGLE--------MESPPSPPRIQSPLTHNSDADLRSQST  52

Query  386  XHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             HH     ISL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  53   RHH-----ISLITLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  101



>gb|ABJ51934.1| sucrose transporter 2A [Hevea brasiliensis]
Length=611

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 9/112 (8%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEE--LHQRRSQADSAFSPH-------RVSNGDSTDSXH  391
            M+ VSI+VPY NLK+EVE+       LH    Q D++ S         ++ NGDS+ S  
Sbjct  1    MDSVSIRVPYRNLKKEVEVEMVGVEELHLHPIQLDNSSSSSSSPNSASQIPNGDSSFSAR  60

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             ++    SL+TLILSCTVAAGV FGWALQLSLLTPYIQTLG  HAFSSFIWL
Sbjct  61   SKTTKYFSLITLILSCTVAAGVQFGWALQLSLLTPYIQTLGTKHAFSSFIWL  112



>ref|XP_010044720.1| PREDICTED: sucrose transport protein SUC3 [Eucalyptus grandis]
 gb|KCW86819.1| hypothetical protein EUGRSUZ_B03418 [Eucalyptus grandis]
Length=609

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +2

Query  251  SIKVPYLNLK--QEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQISLLT  424
            SI+VPY NL+  QEVE+   ++    R + DS  +    S      +     P   SL+T
Sbjct  10   SIRVPYRNLRDDQEVEMMSVDDDAHHRIELDSPHAAAAPSARAPNGAGGDFRPAHCSLVT  69

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  70   LILSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  110



>ref|XP_006395753.1| hypothetical protein EUTSA_v10003879mg [Eutrema salsugineum]
 gb|ESQ33039.1| hypothetical protein EUTSA_v10003879mg [Eutrema salsugineum]
Length=591

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 10/104 (10%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQEVELAGAEELHQRR--SQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            + VSI VPY NL+++VEL    + HQ    S + S  + H  ++G++            S
Sbjct  6    DSVSISVPYRNLRKDVELEMVTK-HQMEPASSSSSPLNHHDSADGETVSK-------NCS  57

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  58   LVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  101



>ref|XP_008339922.1| PREDICTED: sucrose transport protein SUC3-like [Malus domestica]
Length=625

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  251  SIKVPYLNLKQ--EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQI--SL  418
            SI+VPY NL++  EVE+   +E H R        S  RV NG          P     +L
Sbjct  9    SIRVPYRNLRRDAEVEMMVTDEPHHRIDLNSPTXSSPRVPNGSGGGLSPPGQPGHKHHTL  68

Query  419  LTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   LTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  111



>gb|KHG16131.1| Sucrose transport SUC3 -like protein [Gossypium arboreum]
Length=617

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 10/116 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPH---------RVSNGDST-  379
            A   + VS+KVPY NL+++ E+   ++ + RR   +S+             R  NG+S  
Sbjct  2    AGTSDSVSVKVPYRNLRKDSEVEMIDDPYHRRIDLNSSPGSPSTSASPPSARFPNGNSNL  61

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             S  H      SL+TL LSCT+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   SSPIHVRSKDCSLITLALSCTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  117



>ref|XP_002876843.1| hypothetical protein ARALYDRAFT_484195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53102.1| hypothetical protein ARALYDRAFT_484195 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 71/108 (66%), Gaps = 11/108 (10%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSA----FSPHRVSNGDSTDSXHHQSP  403
            M   VSI VPY NL++E+EL    + HQ  S + S      +   V++G+S         
Sbjct  1    MSNSVSISVPYRNLRKEIELETVTKHHQDGSGSSSFSSSPLNHPDVADGESVSK------  54

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  55   -NCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  101



>ref|XP_008389501.1| PREDICTED: sucrose transport protein SUC3-like isoform X2 [Malus 
domestica]
 ref|XP_008389502.1| PREDICTED: sucrose transport protein SUC3-like isoform X2 [Malus 
domestica]
 ref|XP_008389503.1| PREDICTED: sucrose transport protein SUC3-like isoform X2 [Malus 
domestica]
Length=567

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 69/108 (64%), Gaps = 13/108 (12%)
 Frame = +2

Query  251  SIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRVSN-------GDSTDSXHHQSP  403
            SI+VPY NL++E  VE+   +E H R     S  S  RV N         S    H  + 
Sbjct  9    SIRVPYRNLRREAEVEMMVTDEPHHRIDLNSSTSSSPRVPNGGGGGGLSPSGQPGHKHN-  67

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               +LLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  68   ---TLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  112



>gb|ABA08445.1| sucrose transporter type 2 [Manihot esculenta]
Length=608

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 10/113 (9%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEEL--HQRRSQADSAFS--------PHRVSNGDSTDSX  388
            M+ VS++VPY NLK++VE+        H    Q D++ S          ++ N DS+ S 
Sbjct  1    MDTVSLRVPYRNLKKDVEVEMVGVEEQHHYPIQLDNSPSSSASSLNYTSQIPNSDSSFSV  60

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              ++    SL+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   RSKATKHYSLITLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  113



>ref|XP_002520110.1| sucrose transport protein, putative [Ricinus communis]
 gb|EEF42165.1| sucrose transport protein, putative [Ricinus communis]
Length=615

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 15/118 (13%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVE--LAGAEE-----LHQRRSQADSAFSPHRVSNGDSTD-SXHH  394
            M+ VSI+VPY NLK+EVE  + G +E     +H   S ++S+ S  ++ N DS+  +   
Sbjct  1    MDTVSIRVPYRNLKKEVEVEMIGVDEQQHHRIHLNDSSSNSSSSSSQIPNSDSSPIAVRS  60

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQ-------TLGIPHAFSSFIWL  547
            ++    SL+TLILSCTVAAGV FGWALQLSLLTPYIQ       TLGI HAFSSFIWL
Sbjct  61   KTTRHYSLMTLILSCTVAAGVQFGWALQLSLLTPYIQASPYSFVTLGIEHAFSSFIWL  118



>ref|XP_008389500.1| PREDICTED: sucrose transport protein SUC3-like isoform X1 [Malus 
domestica]
Length=612

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 69/108 (64%), Gaps = 13/108 (12%)
 Frame = +2

Query  251  SIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRVSN-------GDSTDSXHHQSP  403
            SI+VPY NL++E  VE+   +E H R     S  S  RV N         S    H  + 
Sbjct  9    SIRVPYRNLRREAEVEMMVTDEPHHRIDLNSSTSSSPRVPNGGGGGGLSPSGQPGHKHN-  67

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               +LLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  68   ---TLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  112



>emb|CAM33449.1| Sucrose Transporter 2C [Hevea brasiliensis subsp. brasiliensis]
Length=639

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 74/113 (65%), Gaps = 10/113 (9%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRS--QADSAFSPH--------RVSNGDSTDSX  388
            M+ +SI+VPY NLK+EVE+       Q     Q D++            ++ NGDS  S 
Sbjct  1    MDSLSIRVPYRNLKKEVEVEMVGVEEQNHHSIQLDNSSPSSASSPNSASQIPNGDSGFSV  60

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              ++    SL+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   RSKTAKHYSLITLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  113



>ref|XP_009360369.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Pyrus x 
bretschneideri]
Length=575

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = +2

Query  251  SIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV---QIS  415
            SI+VPY NL++E  VE+   +E H R     S  S  RV NG                 +
Sbjct  9    SIRVPYRNLRREAEVEMMVTDEPHHRIDLNSSTSSSPRVPNGGGGGGPSPSGQPGHKHNT  68

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   LLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  112



>ref|XP_006290789.1| hypothetical protein CARUB_v10016892mg [Capsella rubella]
 gb|EOA23687.1| hypothetical protein CARUB_v10016892mg [Capsella rubella]
Length=594

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 70/105 (67%), Gaps = 3/105 (3%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEELH-QRRSQADSAFSPHRVSNGDSTDSXHHQSPVQI  412
            M + VSI VPY NL++E+EL    + H      +  + S   +++ DS D          
Sbjct  1    MSDSVSISVPYRNLRKEIELETVTKHHLNESGSSSFSESASPLNHPDSADG--ESVAKDC  58

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   SLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  103



>ref|XP_009360368.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Pyrus x 
bretschneideri]
Length=612

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = +2

Query  251  SIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV---QIS  415
            SI+VPY NL++E  VE+   +E H R     S  S  RV NG                 +
Sbjct  9    SIRVPYRNLRREAEVEMMVTDEPHHRIDLNSSTSSSPRVPNGGGGGGPSPSGQPGHKHNT  68

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            LLTLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  69   LLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  112



>emb|CAN62386.1| hypothetical protein VITISV_011127 [Vitis vinifera]
Length=605

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = +2

Query  233  KMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHH----Q  397
            + M+  SI+VPY NLKQ EVEL  A+E    R  AD      RV NG S  S        
Sbjct  3    ETMDAPSIRVPYKNLKQAEVELVAADE---PRHGADLN---SRVPNGTSDPSSSPSSITH  56

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             P    L TLILSC +AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  57   PPKHGGLRTLILSCMIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  106



>emb|CDY41670.1| BnaC02g34840D [Brassica napus]
Length=533

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 14/106 (13%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
             K  E VSI VPY NL+++VE+      H   + + SA            D+   +    
Sbjct  3    GKSGESVSISVPYRNLRKDVEVEMVTTKHGNENASSSA-----------DDAAVAK---D  48

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  49   CSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  94



>ref|XP_010651816.1| PREDICTED: sucrose transporter-like isoform X1 [Vitis vinifera]
 gb|ADP37122.1| sucrose transporter [Vitis vinifera]
Length=605

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = +2

Query  233  KMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHH----Q  397
            + M+  SI+VPY NLKQ EVEL  A+E    R  AD      RV NG S  S        
Sbjct  3    ETMDAPSIRVPYKNLKQAEVELVAADE---PRHGADLN---SRVPNGTSDPSSSPSSITH  56

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             P    L TLILSC +AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  57   PPKHGGLRTLILSCMIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  106



>gb|ABI34280.1| sucrose transporter-like protein, putative [Solanum demissum]
Length=162

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 63/92 (68%), Gaps = 3/92 (3%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDS--XHHQSPVQ  409
            M+ VSI+VPY NLKQ EVEL   +E    + +  S  S  R SNG+  DS       PV+
Sbjct  1    MDAVSIRVPYKNLKQQEVELTNVDESRFTQLEIRSDSSSPRASNGEMNDSHLPLPPPPVR  60

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQ  505
             SLLTLILSCTVAAGV FGWALQLSLLTPYIQ
Sbjct  61   NSLLTLILSCTVAAGVQFGWALQLSLLTPYIQ  92



>ref|XP_002311596.1| sucrose transporter family protein [Populus trichocarpa]
 gb|EEE88963.1| sucrose transporter family protein [Populus trichocarpa]
Length=605

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 75/122 (61%), Gaps = 32/122 (26%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQE--VELAGAEELHQRRSQADSAFSPHRV-------SNGD--STDS  385
            ME   I+VPY NLK+E  VE+ G E         +S  SPHR+       S+ D  S  +
Sbjct  1    MESAPIRVPYRNLKKEIEVEMVGLE--------MESPPSPHRIQSPHTHNSDADLRSQST  52

Query  386  XHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQ--------TLGIPHAFSSFI  541
             HH     ISL+TL+LSCTVAAGV FGWALQLSLLTPYIQ        TLGI HAFSSFI
Sbjct  53   RHH-----ISLITLVLSCTVAAGVQFGWALQLSLLTPYIQATPSSLKLTLGIGHAFSSFI  107

Query  542  WL  547
            WL
Sbjct  108  WL  109



>gb|AFU61908.1| sucrose transporter 2 [Fragaria x ananassa]
Length=596

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQ-EVELAGAE-ELHQR----RSQADSAFSPHRVSNGDSTDSXHHQSP  403
            + VS++VPY NLK  EVE+ G + E H R     S    + S      GD +       P
Sbjct  6    DSVSVRVPYRNLKDTEVEMTGMDDEAHHRIDLNSSAPSPSSSKQSGGGGDLSPPQSMPVP  65

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             Q +L+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  66   NQNTLMTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  113



>ref|XP_004297320.1| PREDICTED: sucrose transport protein SUC3 [Fragaria vesca subsp. 
vesca]
Length=604

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQ-EVELAGAE-ELHQR----RSQADSAFSPHRVSNGDSTDSXHHQSP  403
            + VS++VPY NLK  EVE+ G + E H R     S    + S      GD +       P
Sbjct  6    DSVSVRVPYRNLKDTEVEMTGMDDEAHHRIDLNSSAPSPSSSKQSGGGGDLSPPQSMPVP  65

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             Q +L+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  66   NQNTLMTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  113



>gb|ABJ51932.1| sucrose transporter 2B [Hevea brasiliensis]
Length=611

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 10/113 (9%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRS--QADSAFSPH--------RVSNGDSTDSX  388
            M+ +SI+VPY NLK+EVE+       Q     Q D++            ++ NGDS    
Sbjct  1    MDSLSIRVPYRNLKKEVEVEMVGVEEQNHHSIQLDNSSPSSASSPNSASQIPNGDSGFPV  60

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              ++    SL+TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   RSKTAKHYSLITLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  113



>emb|CDY03029.1| BnaC07g21980D [Brassica napus]
Length=539

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV-  406
             K  + VSI VPY NL+++VE+    E+  +     ++ S    S+    +      PV 
Sbjct  3    GKSGDSVSISVPYRNLRKDVEV----EMATKHGNERASSSSSSSSSSSPLNGSDGGEPVA  58

Query  407  -QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   KDCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  106



>ref|XP_009152233.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Brassica 
rapa]
Length=592

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 71/108 (66%), Gaps = 11/108 (10%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV-  406
             K  + VSI VPY NL+++VE+    + H     + S+ SP   S+G          PV 
Sbjct  3    GKSGDSVSISVPYRNLRKDVEVEMVTK-HGNEHASSSSSSPLNGSDGGE--------PVA  53

Query  407  -QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  54   KDCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  101



>gb|ADW94619.1| sucrose transporter 6 [Populus tremula x Populus alba]
Length=601

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 15/112 (13%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVEL--------AGAEELHQRRSQADSAFSPHRVSNGD-STDSXH  391
            ME   I+VPY  LK+E+E+        +          +  S  +P+  SNGD  + +  
Sbjct  1    MESAPIRVPYRKLKKEIEVEMVSMEVESSPSPSPPPPPRIQSPLNPN--SNGDFRSQTTK  58

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            HQ    IS  TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   HQ----ISFTTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  106



>emb|CDY45192.1| BnaA06g33960D [Brassica napus]
Length=537

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
             K  + VSI VPY NL+++VE+    E+  +     ++ S   ++  D  +         
Sbjct  3    GKSGDSVSISVPYRNLRKDVEV----EMVTKHGNEHASSSSSPLNGSDGGEPVAKDC---  55

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  56   -SLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  100



>ref|NP_001268068.1| sucrose transporter-like [Vitis vinifera]
 gb|AAF08330.1|AF021809_1 putative sucrose transporter [Vitis vinifera]
Length=612

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = +2

Query  233  KMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
            + M+  SI+VPY NLKQ EVEL  A+E    R  AD      RV NG S  S    S   
Sbjct  3    ETMDAPSIRVPYKNLKQAEVELVAADE---PRHGADLN---SRVPNGTSDPSSSPSSIPH  56

Query  410  I----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                  L TLILSC +AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  57   PPKHGGLRTLILSCMIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  106



>ref|XP_011021610.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Populus 
euphratica]
Length=602

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRV-------SNGD-STDSXHH  394
            ME   I+VPY  LK+E+E+       +          P R+       SNGD  + +  H
Sbjct  1    MESAPIRVPYRKLKKEIEVEMVSLEVESSPSPSPPPPPPRIQSPLDPNSNGDFRSQTTKH  60

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q    IS  TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   Q----ISFTTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  107



>ref|XP_008465743.1| PREDICTED: sucrose transport protein SUC3 [Cucumis melo]
Length=606

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +2

Query  248  VSIKVPYLNL-KQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP----VQI  412
            VS KVPY NL   EVE+   +E HQ      ++ S     NG  T+     SP       
Sbjct  8    VSFKVPYRNLHDAEVEMVAVDE-HQLHGIDLNSPSSDGCPNGSQTEHSFSSSPHLRSKPN  66

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SL  LILSCT+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  67   SLTILILSCTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  111



>ref|XP_010527885.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Tarenaya 
hassleriana]
Length=600

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR---RSQADSAFSPHRVSNGDSTDSXHHQS  400
             K    VSI VPY NL++E+EL      HQ     S + S+ SPH+ S+     S    +
Sbjct  3    GKGDSAVSISVPYRNLRKEIELEMVTH-HQTGPSSSVSSSSSSPHQRSD-HPNQSDVETA  60

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SL TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   AQNCSLATLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  109



>ref|XP_010527884.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Tarenaya 
hassleriana]
Length=627

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR---RSQADSAFSPHRVSNGDSTDSXHHQS  400
             K    VSI VPY NL++E+EL      HQ     S + S+ SPH+ S+     S    +
Sbjct  3    GKGDSAVSISVPYRNLRKEIELEMVTH-HQTGPSSSVSSSSSSPHQRSD-HPNQSDVETA  60

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SL TLILSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   AQNCSLATLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  109



>ref|XP_010096375.1| Sucrose transport protein SUC3 [Morus notabilis]
 gb|EXB63850.1| Sucrose transport protein SUC3 [Morus notabilis]
Length=618

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 13/119 (11%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQ---------ADSAFSPHRVSNGDST  379
            A   + V+I+VPY NLK+ E+E+ G +E    R +         + S+ S  RVSNG++ 
Sbjct  2    AGKADSVTIRVPYRNLKEAELEMVGLDEPAHNRIELKSSFSRPSSSSSPSSPRVSNGETD  61

Query  380  DSXHHQSPVQI---SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             S    +P +    SL+TL+LSCTVAAGV FGWALQLSLLTPY+QTLGI HAFSSFIWL
Sbjct  62   LSSSTPNPPRSKHSSLVTLVLSCTVAAGVQFGWALQLSLLTPYVQTLGIGHAFSSFIWL  120



>ref|XP_010502296.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Camelina 
sativa]
Length=598

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEEL---HQRRSQADSAFSPHR--VSNGDSTDSXHHQS  400
            M + VSI VPY NL++E+EL         HQ  S + S        +++ DS D      
Sbjct  1    MSDSVSISVPYRNLRKEIELETVTTKLNHHQNESGSSSFSESAASPLNHPDSADGEAVSK  60

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   --NCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  107



>ref|XP_010425056.1| PREDICTED: sucrose transport protein SUC3-like isoform X1 [Camelina 
sativa]
Length=598

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +2

Query  236  MMEVVSIKVPYLNLKQEVELAGAEEL--HQRRSQADSAFSPHRVSNGDSTDSXHHQS-PV  406
            M + VSI VPY NL +E+EL        H +     S+FS    S  +  DS   +S   
Sbjct  1    MSDSVSISVPYRNLMKEIELETVTTKLNHHQNESGSSSFSDSAASPLNHPDSADGESVSK  60

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLG+ HAFSSFIWL
Sbjct  61   NCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGVSHAFSSFIWL  107



>ref|XP_004511224.1| PREDICTED: sucrose transport protein SUC3-like [Cicer arietinum]
Length=597

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 67/106 (63%), Gaps = 8/106 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
            A   + VSI+VPY NL+ +   A  E ++    +       HR+ + +S  S H      
Sbjct  2    AGKSDSVSIRVPYKNLRNDSSAAEVELVNVDEPR-------HRI-DLNSPRSEHLPQKNN  53

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             SL  L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  54   ASLTNLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  99



>ref|XP_004143775.1| PREDICTED: sucrose transport protein SUC3-like [Cucumis sativus]
 ref|XP_004157320.1| PREDICTED: sucrose transport protein SUC3-like [Cucumis sativus]
 gb|KGN51161.1| hypothetical protein Csa_5G469030 [Cucumis sativus]
Length=606

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +2

Query  248  VSIKVPYLNL-KQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP----VQI  412
            VS +VPY NL   EVE+   +E HQ      ++ S     NG   +     SP       
Sbjct  8    VSFRVPYRNLHDAEVEMVAVDE-HQLHGIDLNSPSSDGCPNGSQPEHSFPSSPHIRSKPS  66

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SL+ LILSCT+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  67   SLIILILSCTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  111



>gb|KFK33468.1| hypothetical protein AALP_AA5G017000 [Arabis alpina]
Length=588

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQEVEL--AGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            + V + VPY NLK++VEL      ++    S +D     +R  +G++            S
Sbjct  6    DSVLVSVPYRNLKKDVELEMVTKHQIESGSSSSDFPSDSNRPGDGENVMK-------NCS  58

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   LVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWL  102



>gb|KJB80160.1| hypothetical protein B456_013G083700 [Gossypium raimondii]
 gb|KJB80161.1| hypothetical protein B456_013G083700 [Gossypium raimondii]
 gb|KJB80162.1| hypothetical protein B456_013G083700 [Gossypium raimondii]
Length=617

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 71/116 (61%), Gaps = 10/116 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVS---------NGDST-  379
            A   + VS+KVPY NL+++ E+   ++    R   +S+      S         NG+S  
Sbjct  2    AGTSDSVSVKVPYRNLRKDSEVEMIDDPCHSRIDLNSSPGSPSTSASPPSASFPNGNSNL  61

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             S  H      SL+TL LSCT+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  62   SSPIHVRSKDCSLITLALSCTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  117



>gb|AFM28287.1| SUT2 [Medicago truncatula]
 gb|KEH19781.1| sucrose transporter 2 [Medicago truncatula]
Length=600

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 67/111 (60%), Gaps = 13/111 (12%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQ-----EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHH  394
            A   + VSI+VPY NL+      EVEL G +             SP R   GD   + ++
Sbjct  2    AGKSDSVSIRVPYKNLRNDSSAAEVELVGIDGDGDEPRHRIDLNSPPR---GDQLPTKNN  58

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             S     L  L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  59   AS-----LTHLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  104



>gb|KJB50672.1| hypothetical protein B456_008G181900 [Gossypium raimondii]
Length=615

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 9/115 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQ----  397
            A M + +SI+VPY NLK E E+    + H +     S       S+  S+ + H      
Sbjct  2    AGMSDSLSIRVPYSNLKNESEVEMIVDPHFQMDLNSSPSFRSISSSSPSSRTPHGNFNLS  61

Query  398  SPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SP+ +     SL+TL+LSC +AAGV FGWALQLSLLTPYIQTLGI H FSSFIWL
Sbjct  62   SPIHVRSKDSSLMTLVLSCMIAAGVQFGWALQLSLLTPYIQTLGIGHTFSSFIWL  116



>gb|KJB50671.1| hypothetical protein B456_008G181900 [Gossypium raimondii]
Length=586

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 9/115 (8%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQ----  397
            A M + +SI+VPY NLK E E+    + H +     S       S+  S+ + H      
Sbjct  2    AGMSDSLSIRVPYSNLKNESEVEMIVDPHFQMDLNSSPSFRSISSSSPSSRTPHGNFNLS  61

Query  398  SPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SP+ +     SL+TL+LSC +AAGV FGWALQLSLLTPYIQTLGI H FSSFIWL
Sbjct  62   SPIHVRSKDSSLMTLVLSCMIAAGVQFGWALQLSLLTPYIQTLGIGHTFSSFIWL  116



>ref|XP_007046165.1| Sucrose transporter 2 isoform 5 [Theobroma cacao]
 gb|EOY01997.1| Sucrose transporter 2 isoform 5 [Theobroma cacao]
Length=419

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 54/69 (78%), Gaps = 9/69 (13%)
 Frame = +2

Query  356  RVSNGDSTDSXHHQSPVQI-----SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIP  520
            R+ NG+S  S    SP+ +     SL+TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI 
Sbjct  28   RIPNGNSNVS----SPIGVRSKDCSLMTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIG  83

Query  521  HAFSSFIWL  547
            HAFSSFIWL
Sbjct  84   HAFSSFIWL  92



>gb|ADK46943.1| sucrose transporter [Cucumis sativus]
Length=606

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +2

Query  248  VSIKVPYLNL-KQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP----VQI  412
            VS +VPY NL   EVE+   +E HQ      ++ S     NG   +     SP       
Sbjct  8    VSFRVPYRNLHDAEVEMVAVDE-HQLHGIDLNSPSSDGCPNGSQPEHSFPSSPHIRSKPS  66

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            SL+ LILS T+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  67   SLIILILSYTIAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  111



>ref|XP_010940403.1| PREDICTED: sucrose transport protein SUT4-like isoform X2 [Elaeis 
guineensis]
Length=526

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAG----AEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP  403
            M+ VSI+VPY +L   E+EL G      E+ + R    S                  Q  
Sbjct  1    MDAVSIRVPYRHLNDAELELVGLGDPNGEIGEPRGGVRSRPVSSSSPPPSLHSDSSPQPI  60

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             + SL TLILSC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   QRSSLKTLILSCMVGAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  108



>ref|XP_008802417.1| PREDICTED: sucrose transport protein SUT4-like isoform X3 [Phoenix 
dactylifera]
Length=560

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQS----P  403
            M+ VSI+VPY +L   E+EL G  + +   +++    S   VS+   + S  H      P
Sbjct  1    MDAVSIRVPYRHLNDAELELVGLGDPNGEINESGGGLSRRPVSSSAPSSSSPHSDDSPRP  60

Query  404  VQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            VQ S L TLI SC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   VQRSSLKTLIFSCMVGAGVQFGWALQLSLLTPYIQTLGIDHAFSSFIWL  109



>ref|XP_004954470.1| PREDICTED: sucrose transport protein SUT4-like [Setaria italica]
Length=603

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = +2

Query  206  SGRGGGKEAKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTD  382
            SG GGG       V +I+VPY +L+  E+EL        R   A      HR  NGD+  
Sbjct  3    SGAGGGG------VTAIRVPYRHLRDAEMELVSLNGT-PRAGDAPPKDPEHR--NGDAA-  52

Query  383  SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              HH+     S   L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  53   --HHEGSRGSSRTKLVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  105



>ref|XP_008802401.1| PREDICTED: sucrose transport protein SUT4-like isoform X1 [Phoenix 
dactylifera]
Length=605

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQS----P  403
            M+ VSI+VPY +L   E+EL G  + +   +++    S   VS+   + S  H      P
Sbjct  1    MDAVSIRVPYRHLNDAELELVGLGDPNGEINESGGGLSRRPVSSSAPSSSSPHSDDSPRP  60

Query  404  VQ-ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            VQ  SL TLI SC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   VQRSSLKTLIFSCMVGAGVQFGWALQLSLLTPYIQTLGIDHAFSSFIWL  109



>ref|XP_010940402.1| PREDICTED: sucrose transport protein SUT4-like isoform X1 [Elaeis 
guineensis]
Length=604

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAG----AEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP  403
            M+ VSI+VPY +L   E+EL G      E+ + R    S                  Q  
Sbjct  1    MDAVSIRVPYRHLNDAELELVGLGDPNGEIGEPRGGVRSRPVSSSSPPPSLHSDSSPQPI  60

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             + SL TLILSC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   QRSSLKTLILSCMVGAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  108



>ref|XP_006827165.1| hypothetical protein AMTR_s00010p00254010 [Amborella trichopoda]
 gb|ERM94402.1| hypothetical protein AMTR_s00010p00254010 [Amborella trichopoda]
Length=587

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 14/104 (13%)
 Frame = +2

Query  239  MEVVSIKVPYLNLK-QEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQIS  415
            M+   I+VPY +L   E+EL    EL     Q++S     + ++G+++ S          
Sbjct  1    MQSAPIRVPYRHLNASELELV---ELDGSSGQSESDIPHEKETSGENSGS----------  47

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L TLILS T+AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  48   LRTLILSSTIAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  91



>ref|XP_006602307.1| PREDICTED: sucrose transport protein SUC3-like [Glycine max]
Length=592

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 66/107 (62%), Gaps = 17/107 (16%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQ-----EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV  406
            ++VSI+VPY NL       E+EL    ++H R +        HR S      S    +  
Sbjct  7    DLVSIRVPYKNLHDDSSAPELELV---DVHHRGN--------HRNSP-PPNHSPSPPNSN  54

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
               LL L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  55   NAPLLHLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  101



>ref|XP_010935628.1| PREDICTED: sucrose transport protein SUT4-like isoform X2 [Elaeis 
guineensis]
Length=527

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV---  406
            M+ VSI+VPY +L   E+EL    + +   ++A    S   VS+   + S  H       
Sbjct  1    MDAVSIRVPYRHLNDAELELVRLGDPNGEINEARDGVSRRPVSSSIPSSSSPHSDDSSRS  60

Query  407  --QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              + SL TLI SC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   VQRSSLKTLIFSCMVGAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  109



>ref|XP_010935627.1| PREDICTED: sucrose transport protein SUT4-like isoform X1 [Elaeis 
guineensis]
Length=605

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPV---  406
            M+ VSI+VPY +L   E+EL    + +   ++A    S   VS+   + S  H       
Sbjct  1    MDAVSIRVPYRHLNDAELELVRLGDPNGEINEARDGVSRRPVSSSIPSSSSPHSDDSSRS  60

Query  407  --QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              + SL TLI SC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   VQRSSLKTLIFSCMVGAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  109



>ref|XP_002315798.1| sucrose transporter family protein [Populus trichocarpa]
 gb|EEF01969.1| sucrose transporter family protein [Populus trichocarpa]
Length=602

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 67/112 (60%), Gaps = 15/112 (13%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQEVELA-------GAEELHQRRSQADSAFSPHRVSNGD-STDSXHH  394
            ME   I+VPY  LK+E+E+         +        +  S  +P+  SNGD  + +  H
Sbjct  1    MESAPIRVPYRKLKKEIEVEMVSLEVESSPSPSPPPPRIQSPLNPN--SNGDFRSQTTKH  58

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQ-TLGIPHAFSSFIWL  547
            Q    IS  TL+LSCTVAAGV FGWALQLSLLTPYIQ T    HAFSSFIWL
Sbjct  59   Q----ISFTTLVLSCTVAAGVQFGWALQLSLLTPYIQATPSSRHAFSSFIWL  106



>ref|XP_008778274.1| PREDICTED: sucrose transport protein SUT4-like isoform X2 [Phoenix 
dactylifera]
Length=541

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAG----AEELHQRRS--QADSAFSPHRVSNGDSTDSXHHQ  397
            M+ VSI+VPY +L   E+EL        E+ + R   +     S     +         +
Sbjct  1    MDAVSIRVPYRHLNDAELELVALGDPNGEIDESRGGGRRRPVSSSSPPPSSSVHSDSSPR  60

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S  + SL TLILSC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  61   SIQRSSLKTLILSCMVGAGVQFGWALQLSLLTPYIQTLGIKHAFSSFIWL  110



>ref|XP_008778269.1| PREDICTED: sucrose transport protein SUT4-like isoform X1 [Phoenix 
dactylifera]
Length=606

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 64/113 (57%), Gaps = 13/113 (12%)
 Frame = +2

Query  239  MEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHR---------VSNGDSTDSX  388
            M+ VSI+VPY +L   E+EL     L     + D +    R           +       
Sbjct  1    MDAVSIRVPYRHLNDAELELV---ALGDPNGEIDESRGGGRRRPVSSSSPPPSSSVHSDS  57

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              +S  + SL TLILSC V AGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  58   SPRSIQRSSLKTLILSCMVGAGVQFGWALQLSLLTPYIQTLGIKHAFSSFIWL  110



>gb|KHN32884.1| Sucrose transport protein SUC3 [Glycine soja]
Length=594

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 62/102 (61%), Gaps = 13/102 (13%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQISLL  421
            ++VSI+VPY NL  +   A    L       + + SP   +N            +   LL
Sbjct  7    DLVSIRVPYKNLHDDSS-APERNLPPSPPPPNHSPSPPNNTN------------INAPLL  53

Query  422  TLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  54   HLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  95



>ref|XP_007153820.1| hypothetical protein PHAVU_003G067600g [Phaseolus vulgaris]
 gb|ESW25814.1| hypothetical protein PHAVU_003G067600g [Phaseolus vulgaris]
Length=598

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + SL+ L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  55   KASLVNLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  101



>gb|ABO21770.1| sucrose transporter protein [Ananas comosus]
Length=617

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S+ TL+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  71   SVKTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIQHAFSSFIWL  115



>ref|NP_001048591.1| Os02g0827200 [Oryza sativa Japonica Group]
 sp|Q6YK44.1|SUT4_ORYSJ RecName: Full=Sucrose transport protein SUT4; AltName: Full=Sucrose 
permease 4; AltName: Full=Sucrose transporter 4; Short=OsSUT4; 
AltName: Full=Sucrose-proton symporter 4 [Oryza sativa 
Japonica Group]
 sp|B8AF63.1|SUT4_ORYSI RecName: Full=Sucrose transport protein SUT4; AltName: Full=Sucrose 
permease 4; AltName: Full=Sucrose transporter 4; Short=OsSUT4; 
AltName: Full=Sucrose-proton symporter 4 [Oryza sativa 
Indica Group]
 gb|AAN15219.1| sucrose transporter SUT2 [Oryza sativa Japonica Group]
 dbj|BAF10505.1| Os02g0827200 [Oryza sativa Japonica Group]
 gb|EEC74284.1| hypothetical protein OsI_09532 [Oryza sativa Indica Group]
 gb|EEE58094.1| hypothetical protein OsJ_08963 [Oryza sativa Japonica Group]
Length=595

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 53/118 (45%), Positives = 66/118 (56%), Gaps = 22/118 (19%)
 Frame = +2

Query  206  SGRGGGKEAKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTD  382
            S  GGG       + +I++PY +L+  E+EL     L+    +  S   P         D
Sbjct  3    SAAGGGG------LTAIRLPYRHLRDAEMELV---SLNGGTPRGGSPKDP---------D  44

Query  383  SXHHQSPVQISLLT---LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + H Q P      T   L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  45   ATHQQGPPAARTTTTRKLVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  102



>dbj|BAC67164.1| sucrose transporter [Oryza sativa Japonica Group]
Length=595

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 53/118 (45%), Positives = 66/118 (56%), Gaps = 22/118 (19%)
 Frame = +2

Query  206  SGRGGGKEAKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTD  382
            S  GGG       + +I++PY +L+  E+EL     L+    +  S   P         D
Sbjct  3    SAAGGGG------LTAIRLPYRHLRDAEMELV---SLNGGTPRGGSPKDP---------D  44

Query  383  SXHHQSPVQISLLT---LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + H Q P      T   L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  45   ATHQQGPPAARTTTTRKLVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  102



>ref|XP_002453083.1| hypothetical protein SORBIDRAFT_04g038030 [Sorghum bicolor]
 gb|EES06059.1| hypothetical protein SORBIDRAFT_04g038030 [Sorghum bicolor]
Length=594

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 50/103 (49%), Positives = 60/103 (58%), Gaps = 20/103 (19%)
 Frame = +2

Query  251  SIKVPYLNLK----QEVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQISL  418
            +I+VPY +L+    + V L GA+        AD   S  R +N D T             
Sbjct  12   AIRVPYRHLRDAEMELVSLNGADAGPTPHKDADQPRS--RGANADRT-------------  56

Query  419  LTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
              L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  57   -KLVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  98



>gb|EPS58915.1| hypothetical protein M569_15897, partial [Genlisea aurea]
Length=287

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +2

Query  395  QSPVQ-ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + PV   SL TLILSCTVAAGV FGWALQLSLLTPY+QTLGI HA SSFIWL
Sbjct  1    RPPVNSCSLRTLILSCTVAAGVQFGWALQLSLLTPYVQTLGIGHAASSFIWL  52



>gb|KHN06837.1| Sucrose transport protein SUC3 [Glycine soja]
Length=946

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +   LL L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  400  INAPLLHLVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  447



>ref|XP_003530692.2| PREDICTED: sucrose transport protein SUC3-like [Glycine max]
Length=602

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+LSCTVAAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  63   LVLSCTVAAGVQFGWALQLSLLTPYIQTLGIGHAFSSFIWL  103



>ref|XP_010236019.1| PREDICTED: sucrose transport protein SUT4 isoform X1 [Brachypodium 
distachyon]
Length=616

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 7/108 (6%)
 Frame = +2

Query  245  VVSIKVPYLNLKQ-EVELAGAEELHQR----RSQADSAFSPHRVSNGDSTDSXHHQSPVQ  409
            V +I+VPY +L+  E+EL             R++A      HR   G+  D  +     +
Sbjct  11   VTAIRVPYRHLRDAEMELVSLNSNGSSNSSPRARASPRKDQHRPREGEQQDHGNAAEGRK  70

Query  410  ISL--LTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             S     ++L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  71   GSAPKYKVVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAVASFIWL  118



>ref|XP_009381726.1| PREDICTED: sucrose transport protein SUT1-like [Musa acuminata 
subsp. malaccensis]
Length=529

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFI  541
            SNGD  +     +P QISL+ LI SC VA GV +GWALQLSLLTPY+QTLG+ HA SS +
Sbjct  18   SNGDD-NGAAGPAPQQISLVRLIFSCMVAGGVQYGWALQLSLLTPYVQTLGLSHALSSIM  76

Query  542  WL  547
            WL
Sbjct  77   WL  78



>ref|XP_009394456.1| PREDICTED: sucrose transport protein SUT4 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=606

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 63/108 (58%), Gaps = 10/108 (9%)
 Frame = +2

Query  242  EVVSIKVPYLNLKQ-EVELAGAE-----ELHQRRSQADSAFSPHRVSNGDSTDSXHHQSP  403
            E V +++PY +L   EVELA  +     ++H+              S+  S      ++ 
Sbjct  4    EAVPVRLPYRHLDDAEVELARLDGDPNGQIHESEVSCSVPIPSSSPSSSSSPSRPRERTG  63

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             +    TLILSC VAAGV FGWALQLSLLTPYIQTLGI H FSSFIWL
Sbjct  64   WK----TLILSCMVAAGVQFGWALQLSLLTPYIQTLGIEHVFSSFIWL  107



>gb|KJB30372.1| hypothetical protein B456_005G139700 [Gossypium raimondii]
Length=594

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 9/101 (9%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQEVELAGAEELHQR--------RSQADSAFSPHRVSNGDST-D  382
            A M + V I+ PY NL +E+E+   ++ H R           A S+    RV NG++   
Sbjct  2    AGMSDSVPIRFPYRNLNKELEVEMIDDPHFRIDLNSSPNSPSASSSSPASRVPNGNANLS  61

Query  383  SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQ  505
            S  H      SL+TL+LSCTVAAGV FGWALQLSLLTPYIQ
Sbjct  62   SPIHAGSKDCSLITLVLSCTVAAGVQFGWALQLSLLTPYIQ  102



>ref|XP_009405154.1| PREDICTED: sucrose transport protein SUT3-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +2

Query  362  SNGDSTD----SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAF  529
            SN DS+D    S    +P  ISL+ L L+C VA GV +GWALQLSLLTPYIQTLG+ HA 
Sbjct  29   SNVDSSDVATSSQSRHTPKPISLVRLFLACMVAGGVQYGWALQLSLLTPYIQTLGLSHAL  88

Query  530  SSFIWL  547
            SS IWL
Sbjct  89   SSIIWL  94



>gb|EEC66911.1| hypothetical protein OsI_33504 [Oryza sativa Indica Group]
Length=411

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P QISL  L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  17   APPQISLSGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  66



>ref|NP_001141577.1| uncharacterized protein LOC100273693 [Zea mays]
 gb|ACF86653.1| unknown [Zea mays]
 tpg|DAA50041.1| TPA: hypothetical protein ZEAMMB73_840918 [Zea mays]
Length=508

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            QISLL L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  21   QISLLGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  67



>sp|Q944W2.1|SUT3_ORYSI RecName: Full=Sucrose transport protein SUT3; AltName: Full=Sucrose 
permease 3; AltName: Full=Sucrose transporter 3; Short=OsSUT3; 
AltName: Full=Sucrose-proton symporter 3 [Oryza sativa 
Indica Group]
 gb|AAL14982.1|AF419298_1 sucrose transporter [Oryza sativa Indica Group]
Length=506

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P QISL  L L+C VA GV +GWALQLSLLTPYIQTLGIPHA +S +WL
Sbjct  17   APPQISLSGLFLACMVAGGVQYGWALQLSLLTPYIQTLGIPHALTSVMWL  66



>ref|NP_001146651.1| sucrose transporter2 [Zea mays]
 gb|AAS91375.1| sucrose transporter 2 [Zea mays]
 gb|ACL54467.1| unknown [Zea mays]
 gb|AFW74124.1| Sucrose transporter 2 [Zea mays]
Length=592

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  56   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  96



>ref|XP_008643522.1| PREDICTED: sucrose transporter2 isoform X3 [Zea mays]
Length=611

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  56   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  96



>ref|XP_002467275.1| hypothetical protein SORBIDRAFT_01g022430 [Sorghum bicolor]
 gb|EER94273.1| hypothetical protein SORBIDRAFT_01g022430 [Sorghum bicolor]
Length=507

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +2

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            D   ++ P QIS++ L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  13   DGGGNKQP-QISIVGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  67



>ref|XP_008643521.1| PREDICTED: sucrose transporter2 isoform X2 [Zea mays]
 gb|AFW74125.1| hypothetical protein ZEAMMB73_722694 [Zea mays]
Length=630

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  56   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  96



>ref|NP_001064555.1| Os10g0404500 [Oryza sativa Japonica Group]
 sp|Q948L0.1|SUT3_ORYSJ RecName: Full=Sucrose transport protein SUT3; AltName: Full=Sucrose 
permease 3; AltName: Full=Sucrose transporter 3; Short=OsSUT3; 
AltName: Full=Sucrose-proton symporter 3 [Oryza sativa 
Japonica Group]
 dbj|BAB68368.1| sucrose transporter [Oryza sativa Japonica Group]
 gb|ABB47568.1| sucrose transporter 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26469.1| Os10g0404500 [Oryza sativa Japonica Group]
Length=506

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P QISL  L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  17   APPQISLSGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  66



>ref|XP_004986599.1| PREDICTED: sucrose transport protein SUT3-like [Setaria italica]
Length=500

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            QISL+ L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  13   QISLVRLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  59



>dbj|BAK07459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            QISL+ L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  22   QISLVGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  68



>ref|XP_003577278.1| PREDICTED: sucrose transport protein SUT2 [Brachypodium distachyon]
Length=503

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  PHRVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAF  529
            P R ++G  T S     P ++    L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF
Sbjct  3    PRRPNSGGGTSSAAAPPPKKVPSRFLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAF  62

Query  530  SSFIWL  547
            +S +WL
Sbjct  63   ASLVWL  68



>gb|KEH25698.1| sucrose proton symporter 2 [Medicago truncatula]
Length=511

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +2

Query  347  SPHRVSNGDSTDSXHHQS--PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIP  520
            +P   +N D   S    S  PV   L  +++  ++AAG+ FGWALQLSLLTPY+QTLG+P
Sbjct  8    TPPTKNNNDKASSLELDSVQPVSSPLRKMVVVASIAAGIQFGWALQLSLLTPYVQTLGVP  67

Query  521  HAFSSFIWL  547
            H +SSFIWL
Sbjct  68   HVWSSFIWL  76



>ref|XP_003573890.1| PREDICTED: sucrose transport protein SUT3-like [Brachypodium 
distachyon]
Length=506

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +ISL+ L L+C VA GV +GWALQLSLLTPY+QTLGIPHA +S +WL
Sbjct  21   KISLMGLFLACMVAGGVQYGWALQLSLLTPYVQTLGIPHALTSVMWL  67



>ref|XP_004515129.1| PREDICTED: sucrose transport protein SUC8-like [Cicer arietinum]
Length=437

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +2

Query  347  SPHRVSNGD---STDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGI  517
            SP + + GD   S+       PV   L  +I+  +VAAGV FGWALQLSLLTPY+QTLG+
Sbjct  5    SPTKSNRGDLKGSSLELDCVEPVASPLPKMIIVASVAAGVQFGWALQLSLLTPYVQTLGV  64

Query  518  PHAFSSFIWL  547
            PH ++SFIWL
Sbjct  65   PHIWASFIWL  74



>gb|AFW74126.1| hypothetical protein ZEAMMB73_722694 [Zea mays]
Length=511

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  56   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  96



>ref|XP_008643520.1| PREDICTED: sucrose transporter2 isoform X1 [Zea mays]
Length=640

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  56   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  96



>ref|XP_006648160.1| PREDICTED: sucrose transport protein SUT4-like [Oryza brachyantha]
Length=584

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L+L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  58   LVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  98



>ref|XP_002266122.1| PREDICTED: sucrose transport protein SUC2 [Vitis vinifera]
 gb|ADP37124.1| putative sucrose transporter [Vitis vinifera]
Length=506

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +2

Query  374  STDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S D+ HHQS     L  +IL  ++AAGV FGWALQLSLLTPY+Q LG+PH ++SFIWL
Sbjct  14   SEDAHHHQS---TPLSKIILVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWASFIWL  68



>tpg|DAA54801.1| TPA: hypothetical protein ZEAMMB73_386084 [Zea mays]
Length=175

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>dbj|BAK01156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=587

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 58/112 (52%), Gaps = 26/112 (23%)
 Frame = +2

Query  215  GGGKEAKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVSNGDSTDSXH  391
            GGG  A       I+VPY +++  E EL       QR  +      P  V+         
Sbjct  4    GGGATA-------IRVPYRHIRDAETELVRLNSDAQRPKEEQ----PSAVAGAPK-----  47

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                       ++L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  48   ---------YRVVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  90



>gb|ACU87542.1| sucrose transporter 4 [Lolium perenne]
Length=607

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++L+C VAAGV FGWALQLSLLTPYIQTLGI HA +SFIWL
Sbjct  71   VVLACMVAAGVQFGWALQLSLLTPYIQTLGIDHAMASFIWL  111



>gb|ABF06450.1| putative sucrose transport protein SUT1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=186

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  23   LWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  66



>tpg|DAA54803.1| TPA: hypothetical protein ZEAMMB73_386084 [Zea mays]
Length=174

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>ref|NP_001177082.1| Os12g0641400 [Oryza sativa Japonica Group]
 dbj|BAH95810.1| Os12g0641400 [Oryza sativa Japonica Group]
Length=170

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   KVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  67



>gb|AAO13696.1| sucrose transporter [Solanum lycopersicum]
Length=144

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  26   LWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHRFASFIWL  69



>tpg|DAA43616.1| TPA: hypothetical protein ZEAMMB73_332694 [Zea mays]
Length=212

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  356  RVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSS  535
            R + G +  +  H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +S
Sbjct  15   RGTGGAAAAAADHVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTS  72

Query  536  FIWL  547
            F+WL
Sbjct  73   FMWL  76



>gb|KHN32800.1| Sucrose transport protein [Glycine soja]
Length=380

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +IL  ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  11   LCKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  54



>gb|ABF06451.1| putative sucrose transport protein SUT1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=160

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  428  ILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  1    IMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  40



>gb|AFO84089.1| sucrose transport protein [Actinidia deliciosa]
Length=492

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  365  NGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIW  544
             G +  S     P ++ L  L    +VA G+ FGWALQLSLLTPY+Q LGIPHAF+S IW
Sbjct  2    KGPAETSRRRAGPARVPLRKLFRVASVAGGIQFGWALQLSLLTPYVQELGIPHAFASVIW  61

Query  545  L  547
            L
Sbjct  62   L  62



>gb|AIU94753.1| sucrose proton symporter [Morus alba var. multicaulis]
Length=519

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  365  NGDSTDSXHHQSPVQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFI  541
            NG S +S     P++   L  LI   ++AAGV FGWALQLSLLTPY+Q LGIPH +++FI
Sbjct  11   NGKSNNSSEVPPPLEAEPLRKLIAVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFI  70

Query  542  WL  547
            WL
Sbjct  71   WL  72



>gb|ADL14375.1| sucrose transporter 1 [Leymus chinensis]
Length=523

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            PV+ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  31   PVRISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  79



>ref|XP_003558709.1| PREDICTED: sucrose transport protein SUT1 [Brachypodium distachyon]
Length=518

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++PV+IS+  L+L+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  24   EAPVRISIGRLVLAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  74



>ref|XP_010917013.1| PREDICTED: sucrose transport protein SUT1 isoform X3 [Elaeis 
guineensis]
Length=493

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LI +C VA GV +GWALQLSLLTPY+QTLGI HA SS +WL
Sbjct  51   ISLTMLIFACMVAGGVQYGWALQLSLLTPYVQTLGISHALSSLMWL  96



>gb|AIU97954.1| sucrose transporter 6-like protein, partial [Morus alba var. 
multicaulis]
Length=103

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 13/102 (13%)
 Frame = +2

Query  230  AKMMEVVSIKVPYLNLKQ-EVELAGAEELHQRRSQADSAFSPHRVS---------NGDST  379
            A   + V+I+VPY NLK+ E+E+ G +E    R + +S+FS    S         NG++ 
Sbjct  2    AGKADSVTIRVPYRNLKEAELEMVGLDEPPHNRIELNSSFSRPTSSSSPSSPRVSNGETD  61

Query  380  DSXHHQSPVQI---SLLTLILSCTVAAGVXFGWALQLSLLTP  496
             S    +P +    SL+TL+LSCTVAAGV FGWALQLSLLTP
Sbjct  62   LSSSTPNPPRSKHSSLVTLVLSCTVAAGVQFGWALQLSLLTP  103



>ref|XP_004515590.1| PREDICTED: sucrose transport protein SUC2-like [Cicer arietinum]
Length=509

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +2

Query  347  SPHRVSNGDSTDSXHHQS---PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGI  517
            SP + ++GD   S        PV   L  +I   ++AAGV FGWALQLSLLTPY+Q+LG+
Sbjct  5    SPSKSNHGDPMGSSLELDCVQPVGSPLRKMIAVASIAAGVQFGWALQLSLLTPYVQSLGV  64

Query  518  PHAFSSFIWL  547
            PH +++FIWL
Sbjct  65   PHVWAAFIWL  74



>ref|XP_010917011.1| PREDICTED: sucrose transport protein SUT3 isoform X1 [Elaeis 
guineensis]
Length=544

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LI +C VA GV +GWALQLSLLTPY+QTLGI HA SS +WL
Sbjct  51   ISLTMLIFACMVAGGVQYGWALQLSLLTPYVQTLGISHALSSLMWL  96



>gb|AAL32020.1| sucrose transporter [Vitis vinifera]
Length=445

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +2

Query  374  STDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S D+ HH S     L  +IL  ++AAGV FGWALQLSLLTPY+Q LG+PH ++SFIWL
Sbjct  14   SEDAHHHLS---TPLSKIILVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWASFIWL  68



>gb|AJO70162.1| sucrose transporter 4 [Camellia sinensis]
Length=493

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  374  STDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ST S H        +  LIL  ++AAGV FGWALQLSLLTPY+Q LG+PH +SSFIWL
Sbjct  8    STASEHDPDAPSSPISKLILVSSIAAGVQFGWALQLSLLTPYVQVLGVPHTWSSFIWL  65



>ref|XP_008797155.1| PREDICTED: sucrose transport protein SUT1-like [Phoenix dactylifera]
Length=535

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LI +C VA GV +GWALQLSLLTPY+QTLGI HA SS +WL
Sbjct  42   ISLTRLIFACMVAGGVQYGWALQLSLLTPYVQTLGISHALSSLMWL  87



>gb|ADW94617.1| sucrose transporter 4 [Populus tremula x Populus alba]
Length=510

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = +2

Query  350  PHRVSNGDSTDSX-----HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLG  514
            PHRVS    T+       H Q   ++ L  L+   ++A G+ FGWALQLSLLTPY+Q LG
Sbjct  8    PHRVSRSRQTNRPPSTRHHQQQSSRVPLRQLLRVTSIAGGIQFGWALQLSLLTPYVQELG  67

Query  515  IPHAFSSFIWL  547
            IPH ++S IWL
Sbjct  68   IPHKWASIIWL  78



>ref|XP_010917012.1| PREDICTED: sucrose transport protein SUT1 isoform X2 [Elaeis 
guineensis]
Length=535

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LI +C VA GV +GWALQLSLLTPY+QTLGI HA SS +WL
Sbjct  42   ISLTRLIFACMVAGGVQYGWALQLSLLTPYVQTLGISHALSSLMWL  87



>gb|KHN32801.1| Sucrose transport protein [Glycine soja]
Length=372

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +IL  ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  11   LRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  54



>ref|XP_004985542.1| PREDICTED: sucrose transport protein SUT1-like [Setaria italica]
Length=519

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            PV ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  27   PVPISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  75



>emb|CAB75881.1| sucrose transporter 2 [Hordeum vulgare subsp. vulgare]
Length=506

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P ++ L +L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   APRKVPLRSLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  70



>dbj|BAJ93580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  398  SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P ++ L +L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   APRKVPLRSLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  70



>emb|CAB75882.1| sucrose transporter 1 [Hordeum vulgare subsp. vulgare]
Length=523

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            VQISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  32   VQISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  79



>emb|CAJ20123.1| sucrose transporter 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98323.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02629.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  VQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            VQISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  32   VQISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  79



>ref|XP_006599449.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +IL  ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  11   LRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  54



>gb|ABX10015.1| sucrose transporter [Lolium perenne]
Length=522

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + PV ISL  L+L+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  28   EPPVPISLGRLVLAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  78



>gb|KHN32799.1| Sucrose transport protein SUC2 [Glycine soja]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +IL  ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  11   LRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  54



>ref|XP_003548077.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +IL  ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  11   LRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  54



>ref|XP_006386430.1| hypothetical protein POPTR_0002s10710g [Populus trichocarpa]
 gb|ERP64227.1| hypothetical protein POPTR_0002s10710g [Populus trichocarpa]
Length=192

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = +2

Query  350  PHRVSNGDSTD---SXHHQS--PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLG  514
            PHR S    T+   S  HQ     ++ L  L+   ++A G+ FGWALQLSLLTPY+Q LG
Sbjct  8    PHRASRSRQTNRPPSTRHQQQQSSRVPLRQLLRVTSIAGGIQFGWALQLSLLTPYVQELG  67

Query  515  IPHAFSSFIWL  547
            IPH ++S IWL
Sbjct  68   IPHKWASIIWL  78



>gb|AIE90172.1| sucrose transporter 2A [Triticum aestivum]
 gb|AIE90173.1| sucrose transporter 2B [Triticum aestivum]
Length=505

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L +L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   PRKVPLRSLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  69



>emb|CAA57727.1| sucrose transporter [Nicotiana tabacum]
Length=507

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  24   LWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  67



>ref|XP_009777676.1| PREDICTED: sucrose transport protein-like [Nicotiana sylvestris]
 dbj|BAO47334.1| sucrose transporter [Nicotiana tabacum]
Length=510

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  371  DSTDSXHHQSPVQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++  S   + P+  S L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  9    NNVSSLAVEQPLPKSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  68



>emb|CAQ58421.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  24   LWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  67



>emb|CAQ58420.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  24   LWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  67



>gb|ABB30162.2| sucrose transport protein SUF4 [Pisum sativum]
Length=507

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  335  DSAFSPHRVSNGDSTDSXHHQS--PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQT  508
            DS+  PHR     S+ S   +     ++ L  L+   +VA G+ FGWALQLSLLTPY+Q 
Sbjct  5    DSSRQPHRSKTRPSSSSVRSKPRPKDRVPLTKLLRVASVAGGIQFGWALQLSLLTPYVQQ  64

Query  509  LGIPHAFSSFIWL  547
            LGIPHA++S IWL
Sbjct  65   LGIPHAWASIIWL  77



>ref|XP_009630281.1| PREDICTED: sucrose transport protein-like [Nicotiana tomentosiformis]
 emb|CAM33257.1| sucrose transporter [Nicotiana tabacum]
 dbj|BAO47333.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  24   LWKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  67



>gb|AFS33111.1| SUF4b [Pisum sativum]
Length=507

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  335  DSAFSPHRVSNGDSTDSXHHQS--PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQT  508
            DS+  PHR     S+ S   +     ++ L  L+   +VA G+ FGWALQLSLLTPY+Q 
Sbjct  5    DSSRQPHRSKTRPSSSSVRSKPRPKDRVPLTKLLRVASVAGGIQFGWALQLSLLTPYVQQ  64

Query  509  LGIPHAFSSFIWL  547
            LGIPHA++S IWL
Sbjct  65   LGIPHAWASIIWL  77



>gb|ACO87669.1| sucrose transport protein [Brachypodium sylvaticum]
Length=503

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +2

Query  350  PHRVSNGDSTD-SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHA  526
            P R ++G  T  S     P ++    L  + +VA GV FGWALQLSLLTPY+Q LGIPHA
Sbjct  3    PRRPNSGGGTSASAALPPPKKVPSRFLFRAASVACGVQFGWALQLSLLTPYVQELGIPHA  62

Query  527  FSSFIWL  547
            F+S +WL
Sbjct  63   FASLVWL  69



>tpg|DAA43619.1| TPA: hypothetical protein ZEAMMB73_332694 [Zea mays]
Length=528

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  356  RVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSS  535
            R + G +  +  H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +S
Sbjct  15   RGTGGAAAAAADHVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTS  72

Query  536  FIWL  547
            F+WL
Sbjct  73   FMWL  76



>ref|XP_008648004.1| PREDICTED: sucrose transporter1 isoform X1 [Zea mays]
 gb|ACR36545.1| unknown [Zea mays]
 tpg|DAA43617.1| TPA: sucrose Transporter isoform 1 [Zea mays]
 tpg|DAA43618.1| TPA: sucrose Transporter isoform 2 [Zea mays]
Length=520

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  356  RVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSS  535
            R + G +  +  H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +S
Sbjct  15   RGTGGAAAAAADHVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTS  72

Query  536  FIWL  547
            F+WL
Sbjct  73   FMWL  76



>gb|AAL90455.1|AF408845_1 sucrose transporter SUT1D [Triticum aestivum]
 gb|AAM13410.1|AF408844_1 sucrose transporter SUT1D [Triticum aestivum]
Length=523

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             Q  V ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  28   EQPAVDISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  79



>emb|CAA57726.1| sucrose transporter [Solanum lycopersicum]
Length=429

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  25   KLWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHRFASFIWL  69



>emb|CAA48915.1| sucrose transport protein [Solanum tuberosum]
Length=516

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  377  TDSXHHQSPVQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + S   + P+  S L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  16   SSSLQVEQPLAPSKLWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWL  73



>ref|NP_001137486.1| sucrose transporter4 [Zea mays]
 gb|AAT35810.1| sucrose transporter SUT4 [Zea mays]
Length=501

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>tpg|DAA54802.1| TPA: sucrose transport protein [Zea mays]
Length=501

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>ref|XP_001766981.1| predicted protein [Physcomitrella patens]
 gb|EDQ68147.1| predicted protein [Physcomitrella patens]
Length=494

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            DS   +   ++ +  LI   +VAAGV FGWALQLSLLTPY+Q LGIPHA++S IWL
Sbjct  2    DSSKGKRKNRVPIRALIQVASVAAGVQFGWALQLSLLTPYVQELGIPHAWASLIWL  57



>gb|AAT51689.1| sucrose transport protein [Zea mays]
Length=501

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>gb|AGZ83099.1| sucrose transporter 4 [Zea mays subsp. mays]
Length=501

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  14   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>gb|ACJ85843.1| unknown [Medicago truncatula]
Length=259

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = +2

Query  353  HRVSNGDSTDSXHHQSP-VQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHA  526
            H  +N  +  S H +SP ++ S L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH 
Sbjct  11   HNNNNTLTKPSLHVESPPLEPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHT  70

Query  527  FSSFIWL  547
            ++++IWL
Sbjct  71   WAAYIWL  77



>ref|XP_001777456.1| predicted protein [Physcomitrella patens]
 gb|EDQ57743.1| predicted protein [Physcomitrella patens]
Length=502

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +S   +   ++ +  LI   +VAAGV FGWALQLSLLTPY+Q LGIPHA++SFIWL
Sbjct  2    ESQRVKKKNRVPIRALIQVASVAAGVQFGWALQLSLLTPYVQELGIPHAWASFIWL  57



>gb|ACX71839.1| sucrose transporter 4 [Sorghum bicolor]
Length=501

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  13   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  61



>ref|XP_002443677.1| hypothetical protein SORBIDRAFT_08g023310 [Sorghum bicolor]
 gb|EES17515.1| hypothetical protein SORBIDRAFT_08g023310 [Sorghum bicolor]
Length=501

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  13   PRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  61



>ref|XP_011016949.1| PREDICTED: sucrose transport protein SUC4 [Populus euphratica]
 ref|XP_011016951.1| PREDICTED: sucrose transport protein SUC4 [Populus euphratica]
Length=510

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  350  PHRVSNGDSTDSX-----HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLG  514
            PHR S    T+       H Q   ++ L  L+   ++A G+ FGWALQLSLLTPY+Q LG
Sbjct  8    PHRASRSRQTNRPPSTRHHQQQSSRVPLRQLLRVTSIAGGIQFGWALQLSLLTPYVQELG  67

Query  515  IPHAFSSFIWL  547
            IPH ++S IWL
Sbjct  68   IPHKWASIIWL  78



>gb|KJB28907.1| hypothetical protein B456_005G075300 [Gossypium raimondii]
Length=417

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + +P    L  +I   ++AAG+ FGWALQLSLLTPY+QTLG+PHA+++FIWL
Sbjct  5    YINPAPSPLRKIITVASIAAGIQFGWALQLSLLTPYVQTLGVPHAWAAFIWL  56



>ref|XP_001768298.1| predicted protein [Physcomitrella patens]
 gb|EDQ66912.1| predicted protein [Physcomitrella patens]
Length=500

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ +  LI   +VAAGV FGWALQLSLLTPY+Q LGIPHA++SFIWL
Sbjct  11   RVPIRALIQVASVAAGVQFGWALQLSLLTPYVQELGIPHAWASFIWL  57



>ref|NP_001289830.1| sucrose transport protein [Solanum lycopersicum]
 dbj|BAO96213.1| sucrose transporter 1 [Solanum lycopersicum]
Length=511

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  26   LWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHRFASFIWL  69



>ref|XP_006599448.1| PREDICTED: sucrose transport protein SUC8-like isoform X2 [Glycine 
max]
Length=446

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q P    L  +    ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  15   QQPGPSPLRKMFAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  65



>ref|XP_003518345.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=507

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I   ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  22   LRKMIAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  65



>emb|CBI31990.3| unnamed protein product [Vitis vinifera]
Length=535

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  443  VAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +AAGV FGWALQLSLLTPYIQTLGI HAFSSFIWL
Sbjct  2    IAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWL  36



>ref|XP_006851036.1| hypothetical protein AMTR_s00025p00229310 [Amborella trichopoda]
 gb|ERN12617.1| hypothetical protein AMTR_s00025p00229310 [Amborella trichopoda]
Length=466

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  + ++AAG+ FGWALQLSLLTPY+Q LGIPH FSSFIWL
Sbjct  27   LATAASIAAGIQFGWALQLSLLTPYVQQLGIPHTFSSFIWL  67



>ref|XP_007141313.1| hypothetical protein PHAVU_008G185300g [Phaseolus vulgaris]
 gb|ESW13307.1| hypothetical protein PHAVU_008G185300g [Phaseolus vulgaris]
Length=505

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFI  541
            S G  + S   ++P + SL  L+   +VA+G+ FGWALQLSLLTPY+Q LGIPH ++S I
Sbjct  14   SRGRPSTSAPPRTPARASLRQLLRVASVASGIQFGWALQLSLLTPYVQQLGIPHQWASII  73

Query  542  WL  547
            WL
Sbjct  74   WL  75



>ref|XP_006599447.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Glycine 
max]
Length=504

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q P    L  +    ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  15   QQPGPSPLRKMFAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  65



>gb|KHG00539.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=494

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + +P    L  +I   ++AAG+ FGWALQLSLLTPY+QTLG+PHA+++FIWL
Sbjct  5    YINPAPSPLRKIITVASIAAGIQFGWALQLSLLTPYVQTLGVPHAWAAFIWL  56



>ref|XP_010063792.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063793.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063795.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 gb|KCW71043.1| hypothetical protein EUGRSUZ_F04144 [Eucalyptus grandis]
Length=513

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  371  DSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +  +  H Q P    +  ++    +AAGV FGWALQLSLLTPY+Q LGIPH +++FIWL
Sbjct  7    NKEEQQHQQQPRPSPMRKMVTVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAFIWL  65



>gb|KJB81364.1| hypothetical protein B456_013G140900 [Gossypium raimondii]
Length=456

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q+   I L  +++   +AAG+ FGWALQLSLLTPY+QTLG+PH +++FIWL
Sbjct  5    QTVTPIPLWNIVVIAAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWL  55



>ref|XP_007151866.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
 gb|ESW23860.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
Length=494

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  ++   ++AAGV FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  12   LRKMVAVSSIAAGVQFGWALQLSLLTPYVQTLGVPHAWASFIWL  55



>ref|XP_006351170.1| PREDICTED: sucrose transport protein-like [Solanum tuberosum]
Length=515

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
             L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  29   KLWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHRFASFIWL  73



>gb|KJB28906.1| hypothetical protein B456_005G075300 [Gossypium raimondii]
 gb|KJB28908.1| hypothetical protein B456_005G075300 [Gossypium raimondii]
Length=494

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            + +P    L  +I   ++AAG+ FGWALQLSLLTPY+QTLG+PHA+++FIWL
Sbjct  5    YINPAPSPLRKIITVASIAAGIQFGWALQLSLLTPYVQTLGVPHAWAAFIWL  56



>ref|XP_001778997.1| predicted protein [Physcomitrella patens]
 gb|EDQ56143.1| predicted protein [Physcomitrella patens]
Length=605

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  383  SXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            S   +   ++ L  L ++  VAAGV FGWALQLSLLTPYIQ LGI HA +SFIWL
Sbjct  52   SSSKEEAKRLGLFKLAMASMVAAGVQFGWALQLSLLTPYIQMLGIEHAMASFIWL  106



>gb|KJB81363.1| hypothetical protein B456_013G140900 [Gossypium raimondii]
Length=442

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q+   I L  +++   +AAG+ FGWALQLSLLTPY+QTLG+PH +++FIWL
Sbjct  5    QTVTPIPLWNIVVIAAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWL  55



>ref|XP_011074299.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein SUC4 
[Sesamum indicum]
Length=574

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  401  PVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            P ++ L TL+   +VA G+ FGWALQLSLLTPY+Q LGIPHA++S IWL
Sbjct  22   PRRVKLRTLLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASIIWL  70



>ref|XP_011097249.1| PREDICTED: sucrose transport protein SUC2-like [Sesamum indicum]
Length=506

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  356  RVSNGDSTDSXHHQSPVQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
             V N   +     Q P     L  +IL   +AAGV FGWALQLSLLTPY+Q LGIPHA++
Sbjct  6    EVKNNAPSSFQLQQPPTPAEPLRKIILVAAIAAGVQFGWALQLSLLTPYVQLLGIPHAWA  65

Query  533  SFIWL  547
            +FIWL
Sbjct  66   AFIWL  70



>gb|KJB81361.1| hypothetical protein B456_013G140900 [Gossypium raimondii]
Length=500

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q+   I L  +++   +AAG+ FGWALQLSLLTPY+QTLG+PH +++FIWL
Sbjct  5    QTVTPIPLWNIVVIAAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWL  55



>gb|AAU11810.1| sucrose transporter [Juglans regia]
Length=516

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  SLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +L+ ++L  ++AAGV FGWALQLSLLTPY+Q LGIPH +++FIWL
Sbjct  17   TLIRIVLVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWL  61



>ref|XP_007151901.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
 gb|ESW23895.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
Length=496

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  389  HHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
                P    L  ++   ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  3    EQPKPESSPLRKMVAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  55



>gb|AIE90174.1| sucrose transporter 2D [Triticum aestivum]
Length=507

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ L +L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  25   KVPLRSLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  71



>dbj|BAA89458.1| sucrose transporter protein [Daucus carota]
Length=515

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +2

Query  374  STDSXHHQSPVQ---ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIW  544
            S+ +   Q+PVQ    +   L+L   +AAGV FGWALQLSLLTPY+Q LGIPH ++++IW
Sbjct  15   SSAAMQLQTPVQKIPTATWKLVLVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAYIW  74

Query  545  L  547
            L
Sbjct  75   L  75



>ref|XP_003548078.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +2

Query  350  PHRVSNGDSTDSXHHQSPVQISLLTLILS-CTVAAGVXFGWALQLSLLTPYIQTLGIPHA  526
            P + SN  +T S     P Q S L  + +  ++AAG+ FGWALQLSLLTPY+Q LG+PHA
Sbjct  12   PTKPSNTSTTLSLE-AGPAQASPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHA  70

Query  527  FSSFIWL  547
             +SFIWL
Sbjct  71   AASFIWL  77



>emb|CAQ58422.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+  ++AAGV FGW LQLSLLTPY+Q LGIPH F+SFIWL
Sbjct  24   LWKIIMVASIAAGVQFGWVLQLSLLTPYVQLLGIPHKFASFIWL  67



>emb|CAC19689.1| sucrose/proton symporter [Daucus carota]
Length=515

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +2

Query  374  STDSXHHQSPVQ---ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIW  544
            S+ +   Q+PVQ    +   L+L   +AAGV FGWALQLSLLTPY+Q LGIPH ++++IW
Sbjct  15   SSAAMQLQTPVQKIPTATWKLVLVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAYIW  74

Query  545  L  547
            L
Sbjct  75   L  75



>ref|XP_008378695.1| PREDICTED: sucrose transport protein SUC4-like [Malus domestica]
Length=634

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +I L  L+   +VA G+ FGWALQLSLLTPY+Q LGIPHA++S IWL
Sbjct  20   RIPLRQLLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASIIWL  66



>ref|XP_006433712.1| hypothetical protein CICLE_v100009412mg, partial [Citrus clementina]
 gb|ESR46952.1| hypothetical protein CICLE_v100009412mg, partial [Citrus clementina]
Length=170

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +2

Query  353  HRVSNGDSTDSXHHQSPV--QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHA  526
             R  +  ST     + P   ++ L  L+   +VA G+ FGWALQLSLLTPY+Q LGIPHA
Sbjct  7    QRSKSRASTSRAVARPPARAKVPLRKLLKVASVAGGIQFGWALQLSLLTPYVQELGIPHA  66

Query  527  FSSFIWL  547
            ++S IWL
Sbjct  67   WASIIWL  73



>emb|CAA76369.1| sucrose/H+ symporter [Daucus carota]
Length=515

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +2

Query  374  STDSXHHQSPVQ---ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIW  544
            S+ +   Q+PVQ    +   L+L   +AAGV FGWALQLSLLTPY+Q LGIPH ++++IW
Sbjct  15   SSAAMQLQTPVQKIPTATWKLVLVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAYIW  74

Query  545  L  547
            L
Sbjct  75   L  75



>ref|XP_008444969.1| PREDICTED: sucrose transport protein SUC4 isoform X1 [Cucumis 
melo]
 ref|XP_008444970.1| PREDICTED: sucrose transport protein SUC4 isoform X1 [Cucumis 
melo]
 ref|XP_008444971.1| PREDICTED: sucrose transport protein SUC4 isoform X1 [Cucumis 
melo]
Length=526

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPV---QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
            S G  T S     P+   ++ L  L+   +VA G+ FGWALQLSLLTPYIQ LGIPHA+S
Sbjct  7    SEGHRTASRRANRPLVGPRVPLRRLLRVASVACGIQFGWALQLSLLTPYIQELGIPHAWS  66

Query  533  SFIWL  547
            S IWL
Sbjct  67   SLIWL  71



>gb|ACV95498.1| sucrose transporter [Saccharum hybrid cultivar ROC22]
Length=502

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  16   KVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  62



>gb|KHG01351.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=500

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            Q+   I L  +++   +AAG+ FGWALQLSLLTPY+QTLG+PH +++FIWL
Sbjct  5    QTVTPIPLWNIVVISAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWL  55



>ref|NP_001284446.1| sucrose transport protein SUC4 [Cucumis melo]
 ref|XP_008444974.1| PREDICTED: sucrose transport protein SUC4 isoform X2 [Cucumis 
melo]
 gb|ACJ04700.1| sucrose transporter [Cucumis melo]
Length=503

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPV---QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
            S G  T S     P+   ++ L  L+   +VA G+ FGWALQLSLLTPYIQ LGIPHA+S
Sbjct  7    SEGHRTASRRANRPLVGPRVPLRRLLRVASVACGIQFGWALQLSLLTPYIQELGIPHAWS  66

Query  533  SFIWL  547
            S IWL
Sbjct  67   SLIWL  71



>gb|KHN00701.1| Sucrose transport protein SUC2 [Glycine soja]
Length=446

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  425  LILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +I   ++AAG+ FGWALQLSLLTPY+QTLG+PHA++SFIWL
Sbjct  1    MIAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWL  41



>gb|AHA80795.2| sucrose transport protein 1 [Paeonia suffruticosa]
Length=519

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 4/51 (8%)
 Frame = +2

Query  395  QSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +SPV+     +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH +++FIWL
Sbjct  26   ESPVK----KIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWL  72



>gb|AFK34473.1| unknown [Medicago truncatula]
Length=328

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = +2

Query  353  HRVSNGDSTDSXHHQSP-VQIS-LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHA  526
            H  +N  +  S H +SP ++ S L  +I+  ++AAGV FGWALQLSLLTPY+Q LGIPH 
Sbjct  11   HNNNNTLTKPSLHVESPPLEPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHT  70

Query  527  FSSFIWL  547
            ++++IWL
Sbjct  71   WAAYIWL  77



>gb|ABF94212.1| sucrose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=611

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LILS  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  48   ISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  93



>ref|XP_003518348.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  PHRVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAF  529
            P + SN  ST S          L  +    ++AAG+ FGWALQLSLLTPY+Q LG+PHA 
Sbjct  12   PTKPSNTSSTLSLEGGPGEASPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAA  71

Query  530  SSFIWL  547
            +SFIWL
Sbjct  72   ASFIWL  77



>ref|XP_002961568.1| hypothetical protein SELMODRAFT_76990 [Selaginella moellendorffii]
 gb|EFJ36828.1| hypothetical protein SELMODRAFT_76990 [Selaginella moellendorffii]
Length=514

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  371  DSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            D   S       ++ L +L     VAAGV FGWALQLSLLTPY+Q LGIPH F+S+IWL
Sbjct  2    DLPRSPRRLKSSRVPLRSLARVACVAAGVQFGWALQLSLLTPYVQELGIPHTFASYIWL  60



>ref|XP_002971245.1| hypothetical protein SELMODRAFT_94770 [Selaginella moellendorffii]
 gb|EFJ27843.1| hypothetical protein SELMODRAFT_94770 [Selaginella moellendorffii]
Length=514

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  371  DSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            D   S       ++ L +L     VAAGV FGWALQLSLLTPY+Q LGIPH F+S+IWL
Sbjct  2    DLPRSPRRLKSSRVPLRSLARVACVAAGVQFGWALQLSLLTPYVQELGIPHTFASYIWL  60



>gb|ABF94214.1| sucrose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=453

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LILS  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  48   ISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  93



>ref|NP_001141050.1| sucrose transporter BoSUT1 [Zea mays]
 gb|ACF85284.1| unknown [Zea mays]
 gb|AFW71984.1| sucrose transporter BoSUT1 [Zea mays]
Length=530

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +2

Query  299  GAEELHQRRSQ-----ADSAFSPHRVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXF  463
            G++E   RR +      + A      + GD   +   ++P  IS++ L L+C V+ G+ +
Sbjct  5    GSKEDANRRLEWATLNMERAVVVSETTKGDGNGNAGRKAP--ISIVRLFLACMVSGGIQY  62

Query  464  GWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            GWALQLSLL+PY QTLGI H++ S  W+
Sbjct  63   GWALQLSLLSPYSQTLGISHSYVSLTWI  90



>gb|ABF94213.1| sucrose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=483

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LILS  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  48   ISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  93



>gb|KFK25020.1| hypothetical protein AALP_AA8G056600 [Arabis alpina]
Length=799

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +2

Query  398  SPVQISLLTLILS-CTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P Q S L  I+S  ++AAG+ FGWALQLSLLTPY+Q LGIPH ++S IWL
Sbjct  13   NPDQPSPLKKIISVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWL  63



>ref|XP_007151899.1| hypothetical protein PHAVU_004G0852000g, partial [Phaseolus vulgaris]
 gb|ESW23893.1| hypothetical protein PHAVU_004G0852000g, partial [Phaseolus vulgaris]
Length=194

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +    ++AAG+ FGWALQLSLLTPY+Q LG+PHA +SFIWL
Sbjct  32   LRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWL  75



>ref|XP_004501070.1| PREDICTED: sucrose transport protein SUC4-like [Cicer arietinum]
Length=510

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++SL+ L+   +VA G+ FGWALQLSLLTPY+Q LGIPHA++S IWL
Sbjct  35   RVSLIKLLRVASVAGGIQFGWALQLSLLTPYVQQLGIPHAWASIIWL  81



>gb|ADB04246.1| sucrose transporter [Cucumis sativus]
Length=503

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPV---QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
            S G  T S     P+   ++ L  L+   ++A G+ FGWALQLSLLTPYIQ LGIPHA+S
Sbjct  7    SEGHRTASRRANRPLVGPRVPLRRLLRVASIACGIQFGWALQLSLLTPYIQELGIPHAWS  66

Query  533  SFIWL  547
            S IWL
Sbjct  67   SLIWL  71



>ref|XP_004148402.1| PREDICTED: sucrose transport protein SUC4-like [Cucumis sativus]
 ref|XP_004166650.1| PREDICTED: sucrose transport protein SUC4-like [Cucumis sativus]
Length=503

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPV---QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
            S G  T S     P+   ++ L  L+   ++A G+ FGWALQLSLLTPYIQ LGIPHA+S
Sbjct  7    SEGHRTASRRANRPLVGPRVPLRRLLRVASIACGIQFGWALQLSLLTPYIQELGIPHAWS  66

Query  533  SFIWL  547
            S IWL
Sbjct  67   SLIWL  71



>gb|KFK25021.1| hypothetical protein AALP_AA8G056600 [Arabis alpina]
Length=785

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +2

Query  398  SPVQISLLTLILS-CTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            +P Q S L  I+S  ++AAG+ FGWALQLSLLTPY+Q LGIPH ++S IWL
Sbjct  13   NPDQPSPLKKIISVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWL  63



>ref|XP_001777654.1| predicted protein [Physcomitrella patens]
 gb|EDQ57556.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  380  DSXHHQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            D    +   ++ +  LI   +VAAGV FGWALQLSLLTPY+Q LGIPHA++S IWL
Sbjct  2    DKGEWKKKNRVPIRALIQVASVAAGVQFGWALQLSLLTPYVQELGIPHAWASLIWL  57



>ref|XP_007151897.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
 gb|ESW23891.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
Length=503

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  440  TVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ AG+ FGWALQLSLLTPY+QTLG+PHA+SSFIWL
Sbjct  29   SIGAGIQFGWALQLSLLTPYVQTLGVPHAWSSFIWL  64



>emb|CAA76367.1| sucrose/H+ symporter [Daucus carota]
 emb|CAA76368.1| sucrose/H+ symporter [Daucus carota]
 emb|CAC19688.1| sucrose/proton symporter [Daucus carota]
Length=501

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +2

Query  293  LAGAEELHQRRSQADSAFSPHRVSNGDSTDSXHHQSPVQISLLTLILSCTVAAGVXFGWA  472
            +AG E    R     +A  P R                ++SL  L+   +VA G+ FGWA
Sbjct  1    MAGPEADRNRHRGGATAAPPPRS---------------RVSLRLLLRVASVACGIQFGWA  45

Query  473  LQLSLLTPYIQTLGIPHAFSSFIWL  547
            LQLSLLTPY+Q LGIPHA+SS IWL
Sbjct  46   LQLSLLTPYVQELGIPHAWSSIIWL  70



>gb|AAD53000.1|U64967_1 sucrose-proton symporter [Beta vulgaris]
Length=539

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  353  HRVSNGDSTDSXHHQSPVQI-----------SLLTLILSCTVAAGVXFGWALQLSLLTPY  499
              V NGD+ ++    S + I           SL  L L  ++AAGV FGWALQLSLLTPY
Sbjct  4    RNVKNGDTNNNKIVGSSLSIEKNPISPPEASSLKKLALVASIAAGVQFGWALQLSLLTPY  63

Query  500  IQTLGIPHAFSSFIWL  547
            +Q LGIPH ++ +IWL
Sbjct  64   VQLLGIPHTWAPYIWL  79



>gb|KGN62782.1| hypothetical protein Csa_2G372770 [Cucumis sativus]
Length=470

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  362  SNGDSTDSXHHQSPV---QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFS  532
            S G  T S     P+   ++ L  L+   ++A G+ FGWALQLSLLTPYIQ LGIPHA+S
Sbjct  7    SEGHRTASRRANRPLVGPRVPLRRLLRVASIACGIQFGWALQLSLLTPYIQELGIPHAWS  66

Query  533  SFIWL  547
            S IWL
Sbjct  67   SLIWL  71



>gb|ABB30164.1| sucrose transport protein SUT1 [Phaseolus vulgaris]
Length=503

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  440  TVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ AG+ FGWALQLSLLTPY+QTLG+PHA+SSFIWL
Sbjct  29   SIGAGIQFGWALQLSLLTPYVQTLGVPHAWSSFIWL  64



>ref|NP_001049111.1| Os03g0170900 [Oryza sativa Japonica Group]
 sp|Q9LKH3.1|SUT1_ORYSI RecName: Full=Sucrose transport protein SUT1; AltName: Full=Sucrose 
permease 1; AltName: Full=Sucrose transporter 1; Short=OsSUT1; 
AltName: Full=Sucrose-proton symporter 1 [Oryza sativa 
Indica Group]
 sp|Q10R54.1|SUT1_ORYSJ RecName: Full=Sucrose transport protein SUT1; AltName: Full=Sucrose 
permease 1; AltName: Full=Sucrose transporter 1; Short=OsSUT1; 
AltName: Full=Sucrose-proton symporter 1 [Oryza sativa 
Japonica Group]
 gb|AAF90181.1|AF280050_1 sucrose transporter [Oryza sativa Indica Group]
 gb|ABF94211.1| sucrose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11025.1| Os03g0170900 [Oryza sativa Japonica Group]
 dbj|BAG94404.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74602.1| hypothetical protein OsI_10195 [Oryza sativa Indica Group]
 dbj|BAI83443.1| sucrose transporter [Oryza sativa Indica Group]
Length=538

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LILS  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  48   ISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  93



>gb|AAF04294.1|AF191024_1 sucrose transporter 1 [Asarina barclaiana]
Length=510

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = +2

Query  359  VSNGDSTDSXHHQ-----SPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPH  523
            + NGD   +   Q      P    +  +IL   +AAGV FGWALQLSLLTPY+Q LGIPH
Sbjct  1    MENGDHRTAPAFQLQQASPPEAAPVRNIILVAAIAAGVQFGWALQLSLLTPYVQLLGIPH  60

Query  524  AFSSFIWL  547
             +++FIWL
Sbjct  61   TWTAFIWL  68



>sp|A2ZN77.2|SUT2_ORYSI RecName: Full=Sucrose transport protein SUT2; AltName: Full=SUC4-like 
protein; AltName: Full=Sucrose permease 2; AltName: 
Full=Sucrose transporter 2; Short=OsSUT2; AltName: Full=Sucrose-proton 
symporter 2 [Oryza sativa Indica Group]
 gb|AAY83288.1| SUT2M [Oryza sativa Indica Group]
Length=501

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   KVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  67



>ref|NP_001290021.1| sucrose transport protein [Beta vulgaris subsp. vulgaris]
 emb|CAA58730.1| sucrose/proton-symporter [Beta vulgaris subsp. vulgaris]
Length=523

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  353  HRVSNGDSTDSXHHQSPVQI-----------SLLTLILSCTVAAGVXFGWALQLSLLTPY  499
              V NGD+ ++    S + I           SL  L L  ++AAGV FGWALQLSLLTPY
Sbjct  4    RNVKNGDTNNNKIVGSSLSIEKNPISPPEASSLKKLALVASIAAGVQFGWALQLSLLTPY  63

Query  500  IQTLGIPHAFSSFIWL  547
            +Q LGIPH ++ +IWL
Sbjct  64   VQLLGIPHTWAPYIWL  79



>sp|Q0ILJ3.2|SUT2_ORYSJ RecName: Full=Sucrose transport protein SUT2; AltName: Full=SUC4-like 
protein; AltName: Full=Sucrose permease 2; AltName: 
Full=Sucrose transporter 2; Short=OsSUT2; AltName: Full=Sucrose-proton 
symporter 2 [Oryza sativa Japonica Group]
 gb|ABA99631.2| sucrose/H+ symporter family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ADZ23999.1| sucrose transporter 2 [Oryza sativa Japonica Group]
 gb|AEH05934.1| sucrose transporter 2 [synthetic construct]
Length=501

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  407  QISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ++ L  L+ + +VA GV FGWALQLSLLTPY+Q LGIPHAF+S +WL
Sbjct  21   KVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWL  67



>dbj|BAA24071.1| sucrose transporter [Oryza sativa Japonica Group]
Length=537

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  ISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            ISL  LILS  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  47   ISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  92



>gb|AFW89525.1| hypothetical protein ZEAMMB73_311282 [Zea mays]
Length=528

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  25   HVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  74



>ref|XP_008660500.1| PREDICTED: sucrose transport protein SUT1-like [Zea mays]
 gb|AFW89524.1| hypothetical protein ZEAMMB73_311282 [Zea mays]
Length=519

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  25   HVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  74



>ref|XP_002465781.1| hypothetical protein SORBIDRAFT_01g045720 [Sorghum bicolor]
 gb|EER92779.1| hypothetical protein SORBIDRAFT_01g045720 [Sorghum bicolor]
Length=519

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  392  HQSPVQISLLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            H +P  ISL  LIL+  VA GV +GWALQLSLLTPY+QTLG+ HA +SF+WL
Sbjct  26   HVAP--ISLGRLILAGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWL  75



>ref|XP_007020266.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
 gb|EOY17491.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
Length=491

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  LLTLILSCTVAAGVXFGWALQLSLLTPYIQTLGIPHAFSSFIWL  547
            L  +I+   +AAGV FGWALQLSLLTPY+QTLG+PH +++FIWL
Sbjct  11   LWKIIVVAAIAAGVQFGWALQLSLLTPYVQTLGVPHTWAAFIWL  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335