BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024L16

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008355146.1|  PREDICTED: U-box domain-containing protein 1...  81.3    2e-16   
emb|CDP09042.1|  unnamed protein product                              83.2    2e-15   Coffea canephora [robusta coffee]
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...  83.2    2e-15   
ref|XP_009774522.1|  PREDICTED: U-box domain-containing protein 1...  83.2    2e-15   Nicotiana sylvestris
ref|XP_009343828.1|  PREDICTED: U-box domain-containing protein 1...  82.8    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13    82.8    3e-15   Prunus mume [ume]
ref|XP_004250960.1|  PREDICTED: U-box domain-containing protein 13    82.4    4e-15   Solanum lycopersicum
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...  82.0    5e-15   Pyrus x bretschneideri [bai li]
gb|EYU36264.1|  hypothetical protein MIMGU_mgv1a002554mg              81.6    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...  81.6    7e-15   
ref|XP_006348996.1|  PREDICTED: U-box domain-containing protein 1...  81.3    1e-14   Solanum tuberosum [potatoes]
ref|XP_009629379.1|  PREDICTED: U-box domain-containing protein 1...  80.9    1e-14   Nicotiana tomentosiformis
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 13    80.5    2e-14   Fragaria vesca subsp. vesca
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...  80.5    2e-14   Nicotiana tomentosiformis
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...  80.1    2e-14   Solanum tuberosum [potatoes]
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...  80.1    3e-14   Nicotiana sylvestris
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13    79.7    3e-14   Sesamum indicum [beniseed]
ref|XP_010106453.1|  U-box domain-containing protein 13               79.0    7e-14   Morus notabilis
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1     79.0    7e-14   
ref|XP_007016448.1|  Plant U-box 13 isoform 2                         78.6    9e-14   
gb|KDP44223.1|  hypothetical protein JCGZ_05690                       78.6    9e-14   Jatropha curcas
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg           78.6    9e-14   Citrus clementina [clementine]
ref|XP_010253199.1|  PREDICTED: U-box domain-containing protein 1...  78.2    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_002534105.1|  Spotted leaf protein, putative                   77.4    2e-13   Ricinus communis
emb|CAN68757.1|  hypothetical protein VITISV_035534                   73.9    4e-13   Vitis vinifera
gb|KJB08865.1|  hypothetical protein B456_001G109500                  76.6    4e-13   Gossypium raimondii
gb|KHG05758.1|  U-box domain-containing 13 -like protein              76.3    5e-13   Gossypium arboreum [tree cotton]
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein     75.9    8e-13   Populus trichocarpa [western balsam poplar]
gb|EPS68981.1|  hypothetical protein M569_05787                       75.5    8e-13   Genlisea aurea
emb|CBI16152.3|  unnamed protein product                              73.9    1e-12   Vitis vinifera
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13    75.1    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13    75.1    1e-12   Vitis vinifera
gb|KHG14011.1|  U-box domain-containing 13 -like protein              75.1    1e-12   Gossypium arboreum [tree cotton]
ref|XP_008465621.1|  PREDICTED: U-box domain-containing protein 1...  70.9    2e-12   Cucumis melo [Oriental melon]
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...  74.7    2e-12   Solanum lycopersicum
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...  74.7    2e-12   Populus euphratica
gb|KHN32120.1|  U-box domain-containing protein 13                    73.9    3e-12   Glycine soja [wild soybean]
gb|KJB20105.1|  hypothetical protein B456_003G133100                  73.9    3e-12   Gossypium raimondii
ref|XP_003539679.1|  PREDICTED: U-box domain-containing protein 1...  73.6    4e-12   Glycine max [soybeans]
gb|KJB55893.1|  hypothetical protein B456_009G100000                  73.2    5e-12   Gossypium raimondii
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                 72.8    7e-12   Medicago truncatula
ref|XP_010535503.1|  PREDICTED: U-box domain-containing protein 13    72.8    7e-12   Tarenaya hassleriana [spider flower]
ref|XP_010252135.1|  PREDICTED: U-box domain-containing protein 1...  72.8    8e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...  72.0    1e-11   Cicer arietinum [garbanzo]
gb|KHG02811.1|  U-box domain-containing 13 -like protein              72.0    1e-11   Gossypium arboreum [tree cotton]
ref|XP_004163228.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-11   
ref|XP_004143106.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-11   Cucumis sativus [cucumbers]
ref|XP_008448400.1|  PREDICTED: U-box domain-containing protein 13    71.6    2e-11   Cucumis melo [Oriental melon]
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein     70.9    3e-11   
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...  70.9    3e-11   Glycine max [soybeans]
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g           70.9    4e-11   Phaseolus vulgaris [French bean]
ref|XP_004167730.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  70.1    6e-11   
ref|XP_004150186.1|  PREDICTED: U-box domain-containing protein 1...  70.1    6e-11   Cucumis sativus [cucumbers]
emb|CDX68380.1|  BnaC01g24580D                                        69.7    6e-11   
emb|CDX68379.1|  BnaC01g24570D                                        69.7    8e-11   
ref|XP_009150335.1|  PREDICTED: U-box domain-containing protein 13    69.7    9e-11   Brassica rapa
ref|XP_006290265.1|  hypothetical protein CARUB_v10016804mg           69.3    1e-10   Capsella rubella
ref|XP_010521828.1|  PREDICTED: U-box domain-containing protein 1...  68.6    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_006418891.1|  hypothetical protein EUTSA_v10002430mg           68.2    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_009149975.1|  PREDICTED: U-box domain-containing protein 1...  68.2    3e-10   Brassica rapa
ref|NP_190235.1|  U-box domain-containing protein 13                  66.6    9e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86080.1|  BnaC03g55950D                                        66.6    9e-10   
ref|XP_010412596.1|  PREDICTED: U-box domain-containing protein 1...  66.2    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010503261.1|  PREDICTED: U-box domain-containing protein 1...  66.2    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010426083.1|  PREDICTED: U-box domain-containing protein 13    66.2    1e-09   Camelina sativa [gold-of-pleasure]
gb|KFK33987.1|  hypothetical protein AALP_AA5G087000                  64.7    4e-09   Arabis alpina [alpine rockcress]
emb|CDX99112.1|  BnaA06g18030D                                        64.3    5e-09   
ref|XP_002877490.1|  armadillo/beta-catenin repeat family protein     63.5    9e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...  63.2    1e-08   Populus euphratica
ref|XP_006409918.1|  hypothetical protein EUTSA_v10016364mg           62.0    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010033136.1|  PREDICTED: U-box domain-containing protein 1...  61.2    4e-08   
ref|XP_009399873.1|  PREDICTED: protein spotted leaf 11-like          60.8    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033134.1|  PREDICTED: U-box domain-containing protein 1...  60.8    8e-08   Eucalyptus grandis [rose gum]
ref|XP_009421341.1|  PREDICTED: protein spotted leaf 11-like          60.5    9e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293619.1|  hypothetical protein CARUB_v10022571mg           60.1    2e-07   
ref|XP_010510574.1|  PREDICTED: U-box domain-containing protein 12    58.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010414478.1|  PREDICTED: U-box domain-containing protein 1...  58.9    4e-07   
ref|XP_010920613.1|  PREDICTED: protein spotted leaf 11-like          58.5    4e-07   Elaeis guineensis
ref|XP_008647602.1|  PREDICTED: uncharacterized protein LOC100502...  58.5    4e-07   
gb|KCW85583.1|  hypothetical protein EUGRSUZ_B02378                   58.2    5e-07   Eucalyptus grandis [rose gum]
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like          58.2    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA44667.1|  TPA: putative ARM repeat-containing protein cont...  58.2    6e-07   
ref|XP_008784531.1|  PREDICTED: protein spotted leaf 11-like          57.4    8e-07   
ref|XP_006649845.1|  PREDICTED: protein spotted leaf 11-like          57.4    9e-07   Oryza brachyantha
ref|XP_002881013.1|  armadillo/beta-catenin repeat family protein     57.4    1e-06   Arabidopsis lyrata subsp. lyrata
gb|EEC74963.1|  hypothetical protein OsI_10954                        57.4    1e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001049711.1|  Os03g0275900                                     57.0    1e-06   
ref|XP_006841267.1|  hypothetical protein AMTR_s00135p00108920        56.6    1e-06   
ref|XP_009402317.1|  PREDICTED: protein spotted leaf 11-like          55.8    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26672.1|  hypothetical protein AALP_AA8G277900                  55.8    3e-06   Arabis alpina [alpine rockcress]
emb|CDO99779.1|  unnamed protein product                              55.5    4e-06   Coffea canephora [robusta coffee]
ref|XP_009594953.1|  PREDICTED: U-box domain-containing protein 14    55.1    5e-06   Nicotiana tomentosiformis
gb|KFK26673.1|  hypothetical protein AALP_AA8G277900                  54.7    6e-06   Arabis alpina [alpine rockcress]
ref|XP_010922355.1|  PREDICTED: protein spotted leaf 11-like          54.3    1e-05   Elaeis guineensis
ref|XP_006833209.1|  hypothetical protein AMTR_s00072p00171260        53.9    1e-05   
ref|XP_004250057.1|  PREDICTED: U-box domain-containing protein 1...  53.9    1e-05   Solanum lycopersicum
ref|XP_004250056.1|  PREDICTED: U-box domain-containing protein 1...  53.9    1e-05   
ref|XP_009407488.1|  PREDICTED: protein spotted leaf 11-like          53.9    1e-05   
ref|XP_007009958.1|  U-box domain-containing protein 14               53.9    1e-05   
ref|XP_003561780.1|  PREDICTED: protein spotted leaf 11-like          53.9    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_008810592.1|  PREDICTED: LOW QUALITY PROTEIN: protein spot...  53.5    2e-05   
ref|XP_008802759.1|  PREDICTED: protein spotted leaf 11-like          53.5    2e-05   Phoenix dactylifera
ref|XP_006361678.1|  PREDICTED: U-box domain-containing protein 1...  53.5    2e-05   Solanum tuberosum [potatoes]
ref|XP_011084290.1|  PREDICTED: U-box domain-containing protein 14    53.1    2e-05   Sesamum indicum [beniseed]
ref|XP_010253985.1|  PREDICTED: U-box domain-containing protein 1...  52.0    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_009760654.1|  PREDICTED: U-box domain-containing protein 14    51.2    9e-05   Nicotiana sylvestris
ref|XP_009140947.1|  PREDICTED: U-box domain-containing protein 12    50.8    1e-04   Brassica rapa
emb|CDY31736.1|  BnaA04g16720D                                        50.8    1e-04   Brassica napus [oilseed rape]
gb|AFK37700.1|  unknown                                               46.6    3e-04   Lotus japonicus
gb|KJB73521.1|  hypothetical protein B456_011G237300                  49.7    3e-04   Gossypium raimondii
emb|CDX77213.1|  BnaC04g40080D                                        49.3    3e-04   
ref|XP_010241804.1|  PREDICTED: U-box domain-containing protein 14    48.9    4e-04   
gb|KHN37791.1|  U-box domain-containing protein 14                    48.5    6e-04   Glycine soja [wild soybean]
gb|KHN00867.1|  U-box domain-containing protein 14                    48.5    7e-04   Glycine soja [wild soybean]
ref|XP_003556245.1|  PREDICTED: U-box domain-containing protein 1...  48.5    7e-04   Glycine max [soybeans]
ref|XP_003535520.1|  PREDICTED: U-box domain-containing protein 1...  48.5    7e-04   Glycine max [soybeans]
gb|KHG15771.1|  U-box domain-containing 14 -like protein              48.5    7e-04   Gossypium arboreum [tree cotton]
gb|EYU39871.1|  hypothetical protein MIMGU_mgv1a002720mg              48.5    8e-04   Erythranthe guttata [common monkey flower]
ref|XP_009415649.1|  PREDICTED: U-box domain-containing protein 1...  48.1    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP30475.1|  hypothetical protein JCGZ_16154                       48.1    9e-04   Jatropha curcas
ref|XP_008446840.1|  PREDICTED: U-box domain-containing protein 14    48.1    0.001   Cucumis melo [Oriental melon]



>ref|XP_008355146.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=115

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E++ A+ + LI+  NEI++ISD++ +VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  10   MEEDRGALVQSLIDTINEIASISDYRCVVKKQYCNLARRLKLLTPMFEEIRDSK  63



>emb|CDP09042.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E+K  +A++LIE  NEISAI +++  VKKQYCNLARRLKLLTPMFEEIRD+K
Sbjct  1    MDEDKAGLAQKLIETVNEISAIPEYRPTVKKQYCNLARRLKLLTPMFEEIRDNK  54



>ref|XP_008385130.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=693

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  229  IIMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + M E++ A+ + LI+  NEI++ISD+K  VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  29   VAMEEDRGALVQSLIDTVNEIASISDYKCXVKKQYCNLARRLKLLTPMFEEIRDSK  84



>ref|XP_009774522.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Nicotiana sylvestris]
Length=665

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            MGEEK A+A++LIE+ NEIS IS+F+  VKK+YCNL RRLKLL PMFEEIRD+
Sbjct  1    MGEEKRALAQKLIEIVNEISGISEFRISVKKEYCNLGRRLKLLIPMFEEIRDN  53



>ref|XP_009343828.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
 ref|XP_009343833.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=672

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E++ A+ + LI+  NEI+AISD++ +VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  10   MEEDRGALVQSLIDTINEIAAISDYRCVVKKQYCNLARRLKLLTPMFEEIRDSK  63



>ref|XP_008223401.1| PREDICTED: U-box domain-containing protein 13 [Prunus mume]
Length=666

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M ++K A+ + LI+L NEI++ISD++  VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  1    MEKDKVALVQSLIDLVNEIASISDYRCTVKKQYCNLARRLKLLTPMFEEIRDSK  54



>ref|XP_004250960.1| PREDICTED: U-box domain-containing protein 13 [Solanum lycopersicum]
Length=663

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEE-KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            MGEE K  +A++LIE+ N+IS+ISD++  VKKQ+CNLARRLKLLTPMFEEIRDSK
Sbjct  1    MGEEDKGEVAKKLIEIVNDISSISDYRISVKKQFCNLARRLKLLTPMFEEIRDSK  55



>ref|XP_009353694.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Pyrus x bretschneideri]
Length=661

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E++ A+ + LI+  NEI++ISD+K  VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  1    MEEDRGALVQSLIDTVNEIASISDYKCTVKKQYCNLARRLKLLTPMFEEIRDSK  54



>gb|EYU36264.1| hypothetical protein MIMGU_mgv1a002554mg [Erythranthe guttata]
Length=659

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +EK A++R+LI++  +ISAISD++S VKKQY NLARRLKLLTPMFEEIRD K
Sbjct  1    MEDEKAALSRKLIDIVGDISAISDYRSPVKKQYTNLARRLKLLTPMFEEIRDGK  54



>ref|XP_008357448.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=671

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E++ A+ + LI+  NEI++ISD++ +VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  10   MEEDRGALVQSLIDTINEIASISDYRCVVKKQYCNLARRLKLLTPMFEEIRDSK  63



>ref|XP_006348996.1| PREDICTED: U-box domain-containing protein 13-like [Solanum tuberosum]
Length=664

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEE-KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            MGEE K  +A++LIE+ N+IS ISD+K  VKKQ+CNLARRLKLLTPMFEEIRD+K
Sbjct  1    MGEEDKGEVAKKLIEIVNDISNISDYKISVKKQFCNLARRLKLLTPMFEEIRDNK  55



>ref|XP_009629379.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=665

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            MGEEK A+ ++LIE+ NEIS+IS+F+  VKK+YCNL RRLKLL PMFEEIRD+
Sbjct  1    MGEEKGALTQKLIEIVNEISSISEFRISVKKEYCNLGRRLKLLIPMFEEIRDN  53



>ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 13 [Fragaria vesca 
subsp. vesca]
Length=676

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E+K A+ + LI+  NEI++ISD++  VKKQYCNLARRLKLLTPMFEEIRD K
Sbjct  1    MEEDKGALVQSLIDTVNEIASISDYRCTVKKQYCNLARRLKLLTPMFEEIRDMK  54



>ref|XP_009599897.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=663

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEE-KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            MGEE K  I ++LIE  NEIS+I++F++ VKKQYCNLARRLKLLTPMFEEIRD K
Sbjct  1    MGEEDKGEIVQKLIETVNEISSINEFRNSVKKQYCNLARRLKLLTPMFEEIRDCK  55



>ref|XP_006350762.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Solanum tuberosum]
Length=661

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EE+  + ++LIE+ NEI+AISDF++ VKK+YCNLARRLKLL PMFEEIRD K
Sbjct  1    MEEERGVLVQKLIEVVNEIAAISDFRTWVKKEYCNLARRLKLLIPMFEEIRDIK  54



>ref|XP_009777581.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
sylvestris]
Length=663

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEE-KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            MGEE K  I ++LIE  NEIS+I++F++ VKKQYCNLARRLKLLTPMFEEIRD K
Sbjct  1    MGEEDKGEIVQKLIETVNEISSINEFRNSVKKQYCNLARRLKLLTPMFEEIRDCK  55



>ref|XP_011089810.1| PREDICTED: U-box domain-containing protein 13 [Sesamum indicum]
Length=663

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M ++K A++R+LI++ +EISAI +++S VKKQY NLARRLKLLTPMFEEIRDSK
Sbjct  1    MEDDKTALSRKLIDIVSEISAIPEYRSTVKKQYTNLARRLKLLTPMFEEIRDSK  54



>ref|XP_010106453.1| U-box domain-containing protein 13 [Morus notabilis]
 gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis]
Length=664

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEEKEA-IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK   + + LIEL  EI++IS++K  VKKQYCNLARRLKLLTPMFEEIRDSK
Sbjct  1    MEEEKSGDLVQSLIELVGEIASISEYKCTVKKQYCNLARRLKLLTPMFEEIRDSK  55



>ref|XP_007016447.1| U-box domain-containing protein 13 isoform 1 [Theobroma cacao]
 gb|EOY34066.1| U-box domain-containing protein 13 isoform 1 [Theobroma cacao]
Length=693

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+ + LI+  N+I++I D++  VKKQYCNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGALVQSLIDAVNQIASIGDYRCPVKKQYCNLARRLKLLTPMFEEIRESK  54



>ref|XP_007016448.1| Plant U-box 13 isoform 2 [Theobroma cacao]
 gb|EOY34067.1| Plant U-box 13 isoform 2 [Theobroma cacao]
Length=666

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+ + LI+  N+I++I D++  VKKQYCNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGALVQSLIDAVNQIASIGDYRCPVKKQYCNLARRLKLLTPMFEEIRESK  54



>gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas]
Length=663

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +EK AI + LI+  ++I++ISD++  VKKQYCNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEDEKGAIVQSLIDTVHDIASISDYRCTVKKQYCNLARRLKLLTPMFEEIRESK  54



>ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis]
 gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|KDO72884.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
Length=661

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +EK  + + LI+  NEIS ISD++  VKKQYCNLARRLKLLTPMFEEI++SK
Sbjct  1    MEDEKGVLVQSLIDTVNEISTISDYRGTVKKQYCNLARRLKLLTPMFEEIKESK  54



>ref|XP_010253199.1| PREDICTED: U-box domain-containing protein 13-like [Nelumbo nucifera]
Length=652

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +EK  + ++LI++ NEISAISD++  +KKQYCNLARRLKLLTPMFEEI++SK
Sbjct  1    MEDEKGTLVQKLIDIVNEISAISDYRWAIKKQYCNLARRLKLLTPMFEEIKESK  54



>ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF28280.1| Spotted leaf protein, putative [Ricinus communis]
Length=662

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +EK A+   LIE  NEI++IS+++S VKKQYCNLARRLKLL PMFEEI++SK
Sbjct  4    QEKGALVESLIETVNEIASISEYRSTVKKQYCNLARRLKLLIPMFEEIKESK  55



>emb|CAN68757.1| hypothetical protein VITISV_035534 [Vitis vinifera]
Length=246

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = +1

Query  184  KSFNLFWILVDWIPGI-----IMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLAR  348
            K  N  WI     P +      M E K A  +ELI+  ++IS+ISD++  V+K+YCNLAR
Sbjct  130  KPNNHSWIKAKGKPWLDLSSEAMEEAKGAPVQELIDTVSKISSISDYRCTVRKEYCNLAR  189

Query  349  RLKLLTPMFEEIRDSK  396
            RLKLL PMFEEIRDSK
Sbjct  190  RLKLLIPMFEEIRDSK  205



>gb|KJB08865.1| hypothetical protein B456_001G109500 [Gossypium raimondii]
Length=669

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK  + + LI+  N+I++ISD++  VKK+YCNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGVLVQSLIDAVNQIASISDYRCSVKKEYCNLARRLKLLTPMFEEIRESK  54



>gb|KHG05758.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=669

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK  + + LI+  N+I++ISD++  VKK+YCNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGVLVQSLIDAVNQIASISDYRCSVKKEYCNLARRLKLLTPMFEEIRESK  54



>ref|XP_002313440.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE87395.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=663

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + + LIE  NEI++ISD++  VKKQYCNLARRLKLLTPM EEIRDSK
Sbjct  9    VVQSLIETVNEIASISDYRCAVKKQYCNLARRLKLLTPMLEEIRDSK  55



>gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlisea aurea]
Length=634

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +++  ++++LI+   EISAISD++S VKKQY NLARRLKLLTPMFEEIRDS+
Sbjct  1    MEDDRAVLSKKLIDSVAEISAISDYRSSVKKQYTNLARRLKLLTPMFEEIRDSR  54



>emb|CBI16152.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E K A  +ELI+  ++IS+ISD++  V+K+YCNLARRLKLL PMFEEIRDSK
Sbjct  1    MEEAKGAPVQELIDTVSKISSISDYRCTVRKEYCNLARRLKLLIPMFEEIRDSK  54



>ref|XP_010685786.1| PREDICTED: U-box domain-containing protein 13 [Beta vulgaris 
subsp. vulgaris]
Length=664

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MGEEKEA-IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M +EKEA +  +LI+  NEI++ISD++  VKKQYCNLARRLKLLTPMFEEI++SK
Sbjct  1    MEDEKEAKLINKLIDRINEIASISDYRPPVKKQYCNLARRLKLLTPMFEEIKESK  55



>ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera]
Length=682

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E K A  +ELI+  ++IS+ISD++  V+K+YCNLARRLKLL PMFEEIRDSK
Sbjct  1    MEEAKGAPVQELIDTVSKISSISDYRCTVRKEYCNLARRLKLLIPMFEEIRDSK  54



>gb|KHG14011.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=671

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK  + R LI+  N+I+ I D++  VKK++CNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGELVRSLIDAVNQIAPIGDYRCAVKKEFCNLARRLKLLTPMFEEIRESK  54



>ref|XP_008465621.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis melo]
Length=140

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + LI++ NEI+ ISDF+  VKKQYCNL+RRLKLL PMFEEIRDSK
Sbjct  11   QSLIDVVNEIAWISDFRYTVKKQYCNLSRRLKLLIPMFEEIRDSK  55



>ref|XP_004241233.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Solanum 
lycopersicum]
Length=661

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E +  +  +LIE+ NEI+AISD+++ VKK+YCNL RRLKLL PMFEEIRD K
Sbjct  1    MEEGRGVLVEKLIEVVNEIAAISDYRTSVKKEYCNLGRRLKLLIPMFEEIRDIK  54



>ref|XP_011042684.1| PREDICTED: U-box domain-containing protein 13-like [Populus euphratica]
Length=663

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + + LIE  NEI++ISD++  VKKQYCNLARRLKLLTPM EEIRDSK
Sbjct  9    LVQSLIETVNEIASISDYRCSVKKQYCNLARRLKLLTPMLEEIRDSK  55



>gb|KHN32120.1| U-box domain-containing protein 13 [Glycine soja]
Length=662

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            E E  + ++IEL NEI++ISD++  VKKQYCNLARRLKLL PMFEEIRD
Sbjct  2    EGENASNKVIELVNEIASISDYRPPVKKQYCNLARRLKLLIPMFEEIRD  50



>gb|KJB20105.1| hypothetical protein B456_003G133100 [Gossypium raimondii]
Length=660

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+ + LIE  N+I++I D+   VKK+YCNLARRLKLLTPMFEEIR+ K
Sbjct  1    MEEEKGALVQGLIEAVNQIASIGDYSCAVKKEYCNLARRLKLLTPMFEEIREIK  54



>ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
Length=662

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            E E  + ++IEL NEI++ISD++  VKKQYCNLARRLKLL PMFEEIRD
Sbjct  2    EGENASNKVIELMNEIASISDYRPPVKKQYCNLARRLKLLIPMFEEIRD  50



>gb|KJB55893.1| hypothetical protein B456_009G100000 [Gossypium raimondii]
Length=671

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK  + R L +  N+I+ I D++  VKK++CNLARRLKLLTPMFEEIR+SK
Sbjct  1    MEEEKGELVRSLTDAVNQIAPIGDYRCAVKKEFCNLARRLKLLTPMFEEIRESK  54



>gb|KEH30143.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=662

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +I+L NEI+ ISDF+ MVKKQYCNLARRLKLL P+FEEIRD K
Sbjct  9    VIDLVNEIANISDFRPMVKKQYCNLARRLKLLIPLFEEIRDMK  51



>ref|XP_010535503.1| PREDICTED: U-box domain-containing protein 13 [Tarenaya hassleriana]
Length=667

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  235  MGEEKE--AIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK   A A+ LI+L NEIS +SD+++ VKKQ  NLARRLKLL PMFEEIRDSK
Sbjct  1    MEEEKTLAATAQSLIDLVNEISLVSDYRTTVKKQCSNLARRLKLLVPMFEEIRDSK  56



>ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Nelumbo nucifera]
Length=652

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EE   + ++LI++ NEISAISD++  +KKQYCNLARRLKLL PMFEE ++SK
Sbjct  1    MEEENRTLNQKLIDVVNEISAISDYRWAIKKQYCNLARRLKLLIPMFEEFKESK  54



>ref|XP_004505870.1| PREDICTED: U-box domain-containing protein 13-like [Cicer arietinum]
Length=661

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +I+L NEI+ ISDF+ MVKKQYCNLARRLKLL P+FEEIRD K
Sbjct  9    VIDLLNEIANISDFRPMVKKQYCNLARRLKLLIPLFEEIRDMK  51



>gb|KHG02811.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=676

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+ + LI+  N+I++I D+   VKK+YCNLARRLKLLTPMFEEIR+ K
Sbjct  1    MEEEKGALVQGLIDAVNQIASIGDYSCAVKKEYCNLARRLKLLTPMFEEIREIK  54



>ref|XP_004163228.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
Length=657

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            R LI+L N++++ISDF+  V+KQYCNLARRLKLL PMFEE+RD K
Sbjct  11   RSLIDLVNDVASISDFRYAVRKQYCNLARRLKLLIPMFEEMRDMK  55



>ref|XP_004143106.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 gb|KGN47162.1| hypothetical protein Csa_6G191020 [Cucumis sativus]
Length=657

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            R LI+L N++++ISDF+  V+KQYCNLARRLKLL PMFEE+RD K
Sbjct  11   RSLIDLVNDVASISDFRYAVRKQYCNLARRLKLLIPMFEEMRDMK  55



>ref|XP_008448400.1| PREDICTED: U-box domain-containing protein 13 [Cucumis melo]
Length=658

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            R LI+L N++++ISDF+  V+KQYCNLARRLKLL PMFEE+RD K
Sbjct  11   RSLIDLVNDVASISDFRYAVRKQYCNLARRLKLLIPMFEEMRDMK  55



>ref|XP_002298363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE83168.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=663

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            LIE  N+I++ISD++  VKKQYCNLARRLKLL PM EEIRDSK
Sbjct  15   LIETVNKIASISDYRCTVKKQYCNLARRLKLLIPMLEEIRDSK  57



>ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
 gb|KHN21961.1| U-box domain-containing protein 13 [Glycine soja]
Length=661

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  259  ARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            A ++IEL NEI++IS+++  VKKQYCNLARRLKLL PMFEEIRD
Sbjct  6    ASKVIELVNEIASISEYRPPVKKQYCNLARRLKLLIPMFEEIRD  49



>ref|XP_007132072.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
 gb|ESW04066.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
Length=670

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +A ++IEL NE+++IS+++  VKK+YCNLARRLKLL PMFEEIRD K
Sbjct  16   VASKVIELVNEVASISEYRPPVKKEYCNLARRLKLLIPMFEEIRDMK  62



>ref|XP_004167730.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
13-like [Cucumis sativus]
Length=671

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + LI+  NEI+ ISDF+  VKKQYCNL+RRLKLL PMFEEIRDSK
Sbjct  11   QSLIDAVNEIAWISDFRYTVKKQYCNLSRRLKLLIPMFEEIRDSK  55



>ref|XP_004150186.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 gb|KGN65711.1| hypothetical protein Csa_1G505960 [Cucumis sativus]
Length=671

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  262  RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            + LI+  NEI+ ISDF+  VKKQYCNL+RRLKLL PMFEEIRDSK
Sbjct  11   QSLIDAVNEIAWISDFRYTVKKQYCNLSRRLKLLIPMFEEIRDSK  55



>emb|CDX68380.1| BnaC01g24580D [Brassica napus]
Length=532

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+A+ LI++ NEIS++S++++ VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKGAVAQSLIDVVNEISSVSEYRTTVKKLCSNLARRLKLLVPMFEEIRESN  54



>emb|CDX68379.1| BnaC01g24570D [Brassica napus]
Length=658

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EEK A+A+ LI++ NEIS++S++++ VKK   NLARRLKLL PMFEEIR+S
Sbjct  1    MEEEKGAVAQSLIDVVNEISSVSEYRTTVKKLCSNLARRLKLLVPMFEEIRES  53



>ref|XP_009150335.1| PREDICTED: U-box domain-containing protein 13 [Brassica rapa]
Length=658

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EEK A+A+ LI++ NEIS++S++++ VKK   NLARRLKLL PMFEEIR+S
Sbjct  1    MEEEKGAVAQSLIDVVNEISSVSEYRTTVKKLCSNLARRLKLLVPMFEEIRES  53



>ref|XP_006290265.1| hypothetical protein CARUB_v10016804mg [Capsella rubella]
 gb|EOA23163.1| hypothetical protein CARUB_v10016804mg [Capsella rubella]
Length=657

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A+A+ LI++ NEI+AISD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKAAVAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESN  54



>ref|XP_010521828.1| PREDICTED: U-box domain-containing protein 12 isoform X1 [Tarenaya 
hassleriana]
Length=659

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            EK  +++ L++L NEI++ISDF++  KKQ  NLARRLKLL PMFEEIRD K
Sbjct  5    EKRGLSQSLVDLLNEIASISDFRAPAKKQCSNLARRLKLLLPMFEEIRDGK  55



>ref|XP_006418891.1| hypothetical protein EUTSA_v10002430mg [Eutrema salsugineum]
 gb|ESQ37327.1| hypothetical protein EUTSA_v10002430mg [Eutrema salsugineum]
Length=661

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK A A+ LI++ NEI+A+SD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKGAAAQSLIDVVNEIAAVSDYRITVKKLCSNLARRLKLLVPMFEEIRESN  54



>ref|XP_009149975.1| PREDICTED: U-box domain-containing protein 13-like [Brassica 
rapa]
Length=651

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EEK A+A+ LI+L  EI+++SD++ MVKK   NLARRLKLL PM EEIR+S
Sbjct  1    MEEEKGAVAQSLIDLVTEIASVSDYRIMVKKLCSNLARRLKLLVPMLEEIRES  53



>ref|NP_190235.1| U-box domain-containing protein 13 [Arabidopsis thaliana]
 sp|Q9SNC6.1|PUB13_ARATH RecName: Full=U-box domain-containing protein 13; AltName: Full=Plant 
U-box protein 13 [Arabidopsis thaliana]
 emb|CAB62321.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AAK68731.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AAM91213.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AEE78167.1| U-box domain-containing protein 13 [Arabidopsis thaliana]
Length=660

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK + A+ LI++ NEI+AISD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKASAAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESN  54



>emb|CDX86080.1| BnaC03g55950D [Brassica napus]
Length=656

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EEK A+A+ LI++  EI+++SD++  VKK   NLARRLKLL PMFEEIR+S
Sbjct  1    MEEEKGAVAQSLIDVVTEIASVSDYRITVKKLCSNLARRLKLLVPMFEEIRES  53



>ref|XP_010412596.1| PREDICTED: U-box domain-containing protein 13-like [Camelina 
sativa]
Length=554

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK   A+ LI++ NEI+AISD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKATAAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESN  54



>ref|XP_010503261.1| PREDICTED: U-box domain-containing protein 13-like [Camelina 
sativa]
Length=657

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK   A+ LI++ NEI+AISD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKATAAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESN  54



>ref|XP_010426083.1| PREDICTED: U-box domain-containing protein 13 [Camelina sativa]
Length=655

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK   A+ LI++ NEI+AISD++  VKK   NLARRLKLL PMFEEIR+S 
Sbjct  1    MEEEKATAAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESN  54



>gb|KFK33987.1| hypothetical protein AALP_AA5G087000 [Arabis alpina]
Length=661

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M E+K   A+ LI++ NEI+++SD++  VKK   NLARRLKLL PMFEEIR+S
Sbjct  1    MEEDKGTTAQSLIDVVNEIASVSDYRITVKKLCSNLARRLKLLVPMFEEIRES  53



>emb|CDX99112.1| BnaA06g18030D [Brassica napus]
Length=655

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EEK A+A+ LI++  EI+++SD++  VKK   NLARRLKLL PM EEIR+S
Sbjct  1    MEEEKGAVAQSLIDVVTEIASVSDYRITVKKLCSNLARRLKLLVPMLEEIRES  53



>ref|XP_002877490.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH53749.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=660

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M EEK + A+ LI++ NEI+ ISD++  VKK   NLARRLKLL PMFEEI++S 
Sbjct  1    MEEEKASAAQSLIDVVNEIATISDYRITVKKLCYNLARRLKLLVPMFEEIKESN  54



>ref|XP_011000261.1| PREDICTED: U-box domain-containing protein 13-like [Populus euphratica]
Length=665

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            LIE  N+I++ISD++  VKKQY  LARRLKLL PM EEIRDSK
Sbjct  15   LIETVNKIASISDYRCTVKKQYFYLARRLKLLIPMLEEIRDSK  57



>ref|XP_006409918.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
 gb|ESQ51371.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
Length=652

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYC-NLARRLKLLTPMFEEIRDSK  396
            EK  +A+ LIE  NEI+++SD ++   K++C NL+RRLKLL PMFEEIRDSK
Sbjct  5    EKVELAQTLIESVNEIASVSDHRTPAMKKHCGNLSRRLKLLIPMFEEIRDSK  56



>ref|XP_010033136.1| PREDICTED: U-box domain-containing protein 13 isoform X3 [Eucalyptus 
grandis]
Length=436

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  283  NEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
             EI++I D++  VK+QYCNLARRLKLL PMFEE+R+S+
Sbjct  24   GEIASICDYRCAVKRQYCNLARRLKLLVPMFEEVRESR  61



>ref|XP_009399873.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=673

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  253  AIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            ++   L+    EI+AISD+++  KKQ+CNL+RR+KLL PMFEE+++SK
Sbjct  18   SVVESLMAAVEEIAAISDYRNAYKKQFCNLSRRIKLLAPMFEELKESK  65



>ref|XP_010033134.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Eucalyptus 
grandis]
 gb|KCW52690.1| hypothetical protein EUGRSUZ_J02058 [Eucalyptus grandis]
Length=667

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  IELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            I    EI++I D++  VK+QYCNLARRLKLL PMFEE+R+S+
Sbjct  20   IARVGEIASICDYRCAVKRQYCNLARRLKLLVPMFEEVRESR  61



>ref|XP_009421341.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=661

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  253  AIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            A+   + E A EISAISD+++  +KQ+C+L+RR+KLL PMF+E+++SK
Sbjct  15   ALVERMAEAAEEISAISDYRNAYRKQFCDLSRRMKLLEPMFQELKESK  62



>ref|XP_006293619.1| hypothetical protein CARUB_v10022571mg [Capsella rubella]
 gb|EOA26517.1| hypothetical protein CARUB_v10022571mg [Capsella rubella]
Length=982

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            EK  +A+ LI+  NEI +ISD ++ +KK   NL+RRLKLL PM EEIRD K
Sbjct  5    EKHKLAKTLIDSVNEIVSISDHRAPMKKHCSNLSRRLKLLLPMLEEIRDCK  55



>ref|XP_010510574.1| PREDICTED: U-box domain-containing protein 12 [Camelina sativa]
Length=654

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            EK  +A+ LI+  NEI++ISD ++ +KK   NL+RRLKLL PM EEIRD+
Sbjct  5    EKHKLAQTLIDSVNEIASISDHRAPMKKHCSNLSRRLKLLLPMLEEIRDN  54



>ref|XP_010414478.1| PREDICTED: U-box domain-containing protein 12-like [Camelina 
sativa]
Length=929

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            +K  +A+ LI+  NEI++ISD ++ +KK   NL+RRLKLL PM EEIRDS
Sbjct  5    KKHKLAQTLIDSVNEIASISDHRAPMKKHCSNLSRRLKLLLPMLEEIRDS  54



>ref|XP_010920613.1| PREDICTED: protein spotted leaf 11-like [Elaeis guineensis]
Length=682

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +  ++IE   EI+A SD+++  KKQ+CNL RR+KLL+PM EE+++SK
Sbjct  22   VVEKVIETVEEIAAFSDYRNAYKKQFCNLVRRIKLLSPMLEELKESK  68



>ref|XP_008647602.1| PREDICTED: uncharacterized protein LOC100502260 isoform X1 [Zea 
mays]
Length=794

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            E + + R L+EL +EI+AISDF++  ++Q+CNL+RR++LL PM EE +++
Sbjct  116  ESQVVER-LVELVSEIAAISDFRNSYRRQFCNLSRRIRLLVPMLEEAKEA  164



>gb|KCW85583.1| hypothetical protein EUGRSUZ_B02378 [Eucalyptus grandis]
Length=667

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M E K A+A+ +I+  +E+++IS ++   K+Q  NLAR L LLTP+FEEI+DSK
Sbjct  1    MEEGKGALAQSMIDAVHEMASISGYRGTTKRQCGNLARMLSLLTPLFEEIKDSK  54



>ref|XP_009380658.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=673

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            +   L E   EI+ ISD+++  KKQ+CNL+RR+KLL PMFEE+++S
Sbjct  20   VVDRLAEAVEEIAGISDYRNAYKKQFCNLSRRIKLLAPMFEELKES  65



>tpg|DAA44667.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=726

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            +   L+EL +EI+AISDF++  ++Q+CNL+RR++LL PM EE +++
Sbjct  51   VVERLVELVSEIAAISDFRNSYRRQFCNLSRRIRLLVPMLEEAKEA  96



>ref|XP_008784531.1| PREDICTED: protein spotted leaf 11-like [Phoenix dactylifera]
Length=674

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  ELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            ++IE   EI+  SD+++  K+Q+CNLARR+KLL+PM EE+++SK
Sbjct  20   KVIETVEEIAGFSDYRNAYKRQFCNLARRIKLLSPMLEELKESK  63



>ref|XP_006649845.1| PREDICTED: protein spotted leaf 11-like [Oryza brachyantha]
Length=725

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  265  ELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            +L+EL  EI+AISDF++  ++Q+CNL+RR++LL PM EE ++
Sbjct  58   QLVELVEEIAAISDFRNAYRRQFCNLSRRIRLLAPMLEEAKE  99



>ref|XP_002881013.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57272.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=652

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  EKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            EK  +A+ LI+  NEI++ISD  + +KK   NL+RRLKLL PM EEIRD++
Sbjct  5    EKHKLAQTLIDSINEIASISDHHTPMKKHCGNLSRRLKLLIPMLEEIRDNQ  55



>gb|EEC74963.1| hypothetical protein OsI_10954 [Oryza sativa Indica Group]
Length=726

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            +  +L+EL  EI+AISDF++  ++Q+CNL+RR++LL PM EE ++
Sbjct  54   LVEKLVELVEEIAAISDFRNAYRRQFCNLSRRIRLLAPMLEEAKE  98



>ref|NP_001049711.1| Os03g0275900 [Oryza sativa Japonica Group]
 gb|ABF95255.1| Spotted leaf protein 11, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11625.1| Os03g0275900 [Oryza sativa Japonica Group]
 dbj|BAH00739.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58792.1| hypothetical protein OsJ_10327 [Oryza sativa Japonica Group]
Length=726

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  256  IARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            +  +L+EL  EI+AISDF++  ++Q+CNL+RR++LL PM EE ++
Sbjct  54   LVEKLVELVEEIAAISDFRNAYRRQFCNLSRRIRLLAPMLEEAKE  98



>ref|XP_006841267.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
 gb|ERN02942.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
Length=636

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            M  +   +AR L+++  EIS I +++++V+K+  NL RR+ LL+P+FEEIRD K
Sbjct  1    MAGDPHFLARSLLDIVEEISKIGEYRNLVRKECVNLTRRVTLLSPLFEEIRDFK  54



>ref|XP_009402317.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=654

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  253  AIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            A+   L     EI+AIS  ++  KKQ+CNL+RR++LL PMFEE+R+SK
Sbjct  10   AVVESLSRAVEEIAAISYHRNAYKKQFCNLSRRVRLLAPMFEELRESK  57



>gb|KFK26672.1| hypothetical protein AALP_AA8G277900 [Arabis alpina]
Length=607

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            K  +A+ LI+  NE+++IS+ ++ +KK   NL+RRLKLL PM EEIRDS+
Sbjct  4    KSELAQTLIDSVNEMASISNHRTPMKKHCGNLSRRLKLLLPMLEEIRDSQ  53



>emb|CDO99779.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  GEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            G  +EA+  +L E    +S + + +++VKK YCNL RR+KLL+P+FEE++D +
Sbjct  5    GNSQEALLSQLSEATRTVSTLPECRAVVKKIYCNLVRRIKLLSPLFEELKDGE  57



>ref|XP_009594953.1| PREDICTED: U-box domain-containing protein 14 [Nicotiana tomentosiformis]
Length=624

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M  EKEA+  EL EL + +S + + K++ K+ Y NL RR+KLL+P+ EE++DS
Sbjct  1    MDHEKEALINELTELIDAVSGLPECKNVSKRMYSNLVRRVKLLSPLVEEMKDS  53



>gb|KFK26673.1| hypothetical protein AALP_AA8G277900 [Arabis alpina]
Length=652

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            K  +A+ LI+  NE+++IS+ ++ +KK   NL+RRLKLL PM EEIRDS+
Sbjct  4    KSELAQTLIDSVNEMASISNHRTPMKKHCGNLSRRLKLLLPMLEEIRDSQ  53



>ref|XP_010922355.1| PREDICTED: protein spotted leaf 11-like [Elaeis guineensis]
Length=668

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  GEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            G    A    L+    EI+AISD+++  +KQ  NL+RR+KLL PMF+E++DS+
Sbjct  7    GSAAAAAVERLMVAVEEIAAISDYRNAYRKQLGNLSRRIKLLAPMFDELKDSR  59



>ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda]
 gb|ERM98487.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda]
Length=630

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            EE E I + LI+L  EIS + ++++  +KQY NL RR+KLL P+FEE+++S
Sbjct  4    EEGEDIVQSLIDLVKEISELPEWRNPWRKQYYNLVRRVKLLGPLFEELKES  54



>ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 14 isoform X2 [Solanum 
lycopersicum]
Length=586

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            MG +KE +  EL EL + +S + + +S+ K+ Y NL RR+KLL+P+ E+++DS
Sbjct  1    MGHQKEELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDS  53



>ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 14 isoform X1 [Solanum 
lycopersicum]
Length=624

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            MG +KE +  EL EL + +S + + +S+ K+ Y NL RR+KLL+P+ E+++DS
Sbjct  1    MGHQKEELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDS  53



>ref|XP_009407488.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407489.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  250  EAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            EA+ R L E   EI+ IS++++  +K  C+LARR++LL PMF+E+ D +
Sbjct  13   EAVVRRLAEAVEEIAVISEYRNAYRKPLCSLARRIRLLAPMFDELGDGR  61



>ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao]
 gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao]
Length=637

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  238  GEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            G+ K  +  +L EL  EI+ + D K+  KK + NL RR+KLL+P+FEE+RD 
Sbjct  7    GDSKGELLSQLAELVKEITGLPDCKNSCKKTHGNLVRRIKLLSPLFEELRDG  58



>ref|XP_003561780.1| PREDICTED: protein spotted leaf 11-like [Brachypodium distachyon]
Length=712

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            E+   +  +L EL +EI+ IS+F++  ++Q+CNL+RR++LL PM EE ++
Sbjct  38   EDVGNLVEKLAELVDEIAVISEFRNAYRRQFCNLSRRIRLLAPMLEEAKE  87



>ref|XP_008810592.1| PREDICTED: LOW QUALITY PROTEIN: protein spotted leaf 11 [Phoenix 
dactylifera]
Length=667

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  ELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +L+E   EI A+SD+++  +KQ+CNLARR+KL  PM EE+++ K
Sbjct  24   KLVEAVEEIPAVSDYRNAYEKQFCNLARRIKLPPPMLEELKERK  67



>ref|XP_008802759.1| PREDICTED: protein spotted leaf 11-like [Phoenix dactylifera]
Length=670

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +1

Query  235  MGEEKEAIA-------RELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            M EE++ +A         L+ +  EI+AI DF++  +KQ  NL+RR+KLL PMF+E++DS
Sbjct  1    MEEEEKGLAAAEVPAVERLLVMVEEIAAICDFRNAYRKQLGNLSRRIKLLAPMFDELKDS  60

Query  394  K  396
            +
Sbjct  61   R  61



>ref|XP_006361678.1| PREDICTED: U-box domain-containing protein 14-like [Solanum tuberosum]
Length=624

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            MG +KE +  EL EL + +S + + +S+ K+ Y NL RR+KLL+P+ E+++DS
Sbjct  1    MGHQKEDLINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDS  53



>ref|XP_011084290.1| PREDICTED: U-box domain-containing protein 14 [Sesamum indicum]
Length=632

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  ELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            +L E    ISA+ D +++ KK YCNL RR+KLL+P+FEE++D +
Sbjct  14   QLSEYVRAISALPDCRTVSKKMYCNLVRRVKLLSPLFEEMKDGR  57



>ref|XP_010253985.1| PREDICTED: U-box domain-containing protein 14-like [Nelumbo nucifera]
Length=626

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            EE + +  +L+E+   +S   + ++  KK YCNL RR+KLL+P+FEE++D
Sbjct  2    EEPKEVVDQLVEIVKMVSGFPECRNTSKKMYCNLVRRVKLLSPLFEELKD  51



>ref|XP_009760654.1| PREDICTED: U-box domain-containing protein 14 [Nicotiana sylvestris]
Length=624

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  235  MGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIR  387
            M  EKEA+  EL EL + +S + + K++ K+ Y NL RR+KLL+P+ EE++
Sbjct  1    MDHEKEALINELTELIDTVSGLPECKNVSKRMYSNLVRRVKLLSPLVEEMK  51



>ref|XP_009140947.1| PREDICTED: U-box domain-containing protein 12 [Brassica rapa]
Length=652

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            K  +A+ LIE   EI++ISD +  +K    +L+RRLKLL PM EEIRD K
Sbjct  3    KTELAKILIESVKEIASISDHRPPMKTHCAHLSRRLKLLLPMLEEIRDCK  52



>emb|CDY31736.1| BnaA04g16720D [Brassica napus]
Length=642

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            K  +A+ LIE   EI++ISD +  +K    +L+RRLKLL PM EEIRD K
Sbjct  3    KTELAKILIESVKEIASISDHRPPMKTHCAHLSRRLKLLLPMLEEIRDCK  52



>gb|AFK37700.1| unknown [Lotus japonicus]
Length=94

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            K A+   L+E   EIS + + +++ K+   N+ RR+KLL+P+FEE++DS
Sbjct  8    KSAVVGSLVETIKEISGLPECQNVHKRMCGNMVRRVKLLSPLFEELKDS  56



>gb|KJB73521.1| hypothetical protein B456_011G237300 [Gossypium raimondii]
Length=637

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  IMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            + G+ K  +  +L EL  EIS + + ++  KK +  L RR+KLL+P+FEE+RD 
Sbjct  5    LTGDSKGQLLSQLAELVKEISGLPECRNSCKKMHGTLVRRIKLLSPLFEELRDG  58



>emb|CDX77213.1| BnaC04g40080D [Brassica napus]
Length=643

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            K  +A+ LIE   EI++ISD +  +K    +L+RRLKLL PM EEIRD K
Sbjct  3    KTELAKILIESVKEIASISDHRPPMKIHCAHLSRRLKLLLPMLEEIRDCK  52



>ref|XP_010241804.1| PREDICTED: U-box domain-containing protein 14 [Nelumbo nucifera]
 ref|XP_010241805.1| PREDICTED: U-box domain-containing protein 14 [Nelumbo nucifera]
Length=623

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            EE   +  +L+++  E S   + +S  KK Y NL RR+KLL P+FEE+RD
Sbjct  2    EEPNEVVEQLVQIVKEASGFPECRSTSKKMYHNLLRRVKLLNPLFEELRD  51



>gb|KHN37791.1| U-box domain-containing protein 14 [Glycine soja]
Length=632

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            K  +   L+E   EIS + + +++ KK Y NL RR+KLL+P+FEE++D+
Sbjct  8    KGVVMSRLVECIKEISGLPESQNLCKKVYGNLVRRVKLLSPLFEELKDN  56



>gb|KHN00867.1| U-box domain-containing protein 14 [Glycine soja]
Length=631

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +1

Query  226  GIIMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            G++MG         L+E   EIS + + +++ K+ Y NL RR+KLL+P+FEE++D 
Sbjct  9    GVVMGR--------LVECIKEISGLPECQNLCKRVYGNLVRRVKLLSPLFEELKDG  56



>ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max]
Length=631

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +1

Query  226  GIIMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            G++MG         L+E   EIS + + +++ K+ Y NL RR+KLL+P+FEE++D 
Sbjct  9    GVVMGR--------LVECIKEISGLPECQNLCKRVYGNLVRRVKLLSPLFEELKDG  56



>ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max]
Length=632

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            K  +   L+E   EIS + + +++ KK Y NL RR+KLL+P+FEE++D+
Sbjct  8    KGVVMSRLVECIKEISGLPESQNLCKKVYGNLVRRVKLLSPLFEELKDN  56



>gb|KHG15771.1| U-box domain-containing 14 -like protein [Gossypium arboreum]
Length=637

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  IMGEEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            + G+ K  +  +L EL  EIS + + ++  KK +  L RR+KLL+P+FEE+RD 
Sbjct  5    LTGDSKGQLLCQLAELVKEISGLPECRNSCKKMHGTLVRRIKLLSPLFEELRDG  58



>gb|EYU39871.1| hypothetical protein MIMGU_mgv1a002720mg [Erythranthe guttata]
Length=644

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  247  KEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            +EAI  +L E    I+A+ + K++ +K Y NL RR+KLL+P+FEE++D 
Sbjct  6    EEAILSQLSESVKAITALPECKTVSRKMYGNLVRRIKLLSPLFEELKDG  54



>ref|XP_009415649.1| PREDICTED: U-box domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  253  AIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRD  390
            A+A  L+++  E+SA+ + +  +++  C+LARR+KLL P+F+E+RD
Sbjct  26   AVAETLLQVVAEVSALPESRGPLRQMCCDLARRVKLLAPLFDELRD  71



>gb|KDP30475.1| hypothetical protein JCGZ_16154 [Jatropha curcas]
Length=630

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  241  EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDS  393
            + K  +    IE   E+S + + K++ KK + NL RR+KLL+P+FEE+RDS
Sbjct  6    DPKSELMSRFIESVKEVSGLPECKNVCKKMHGNLIRRIKLLSPLFEELRDS  56



>ref|XP_008446840.1| PREDICTED: U-box domain-containing protein 14 [Cucumis melo]
Length=627

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MG-EEKEAIARELIELANEISAISDFKSMVKKQYCNLARRLKLLTPMFEEIRDSK  396
            MG  EK+ +  +L E   EIS + +   + KK Y +L RR+KLL+P+FEE+RD +
Sbjct  1    MGPSEKDMVVNQLPESVREISGLPECNGICKKMYGDLIRRVKLLSPLFEELRDGE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105