BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024L11

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97628.1|  unnamed protein product                                141   2e-36   Coffea canephora [robusta coffee]
ref|XP_004230442.1|  PREDICTED: regulator of nonsense transcripts...    139   8e-36   
ref|XP_009775100.1|  PREDICTED: regulator of nonsense transcripts...    139   1e-35   Nicotiana sylvestris
ref|XP_009587503.1|  PREDICTED: regulator of nonsense transcripts...    139   1e-35   Nicotiana tomentosiformis
ref|XP_006349314.1|  PREDICTED: regulator of nonsense transcripts...    137   7e-35   Solanum tuberosum [potatoes]
ref|XP_007041200.1|  Smg-4/UPF3 family protein, putative isoform 1      133   1e-33   
ref|XP_011092289.1|  PREDICTED: regulator of nonsense transcripts...    133   2e-33   Sesamum indicum [beniseed]
ref|XP_007041201.1|  Smg-4/UPF3 family protein, putative isoform 2      132   2e-33   
ref|XP_010246764.1|  PREDICTED: regulator of nonsense transcripts...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010246762.1|  PREDICTED: regulator of nonsense transcripts...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010246763.1|  PREDICTED: regulator of nonsense transcripts...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009775092.1|  PREDICTED: regulator of nonsense transcripts...    132   4e-33   Nicotiana sylvestris
ref|XP_009587502.1|  PREDICTED: regulator of nonsense transcripts...    132   4e-33   Nicotiana tomentosiformis
ref|XP_010246761.1|  PREDICTED: regulator of nonsense transcripts...    133   4e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010246760.1|  PREDICTED: regulator of nonsense transcripts...    133   4e-33   Nelumbo nucifera [Indian lotus]
gb|KJB47855.1|  hypothetical protein B456_008G045900                    131   6e-33   Gossypium raimondii
gb|KJB47856.1|  hypothetical protein B456_008G045900                    131   6e-33   Gossypium raimondii
gb|KJB47859.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KJB47866.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KJB47860.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KJB47864.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KJB47868.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KJB47867.1|  hypothetical protein B456_008G045900                    131   7e-33   Gossypium raimondii
gb|KHF99019.1|  upf3a                                                   131   1e-32   Gossypium arboreum [tree cotton]
ref|XP_006598794.1|  PREDICTED: regulator of nonsense transcripts...    129   3e-32   Glycine max [soybeans]
ref|XP_006592654.1|  PREDICTED: regulator of nonsense transcripts...    129   5e-32   Glycine max [soybeans]
ref|XP_009353786.1|  PREDICTED: regulator of nonsense transcripts...    129   7e-32   
ref|XP_002526435.1|  conserved hypothetical protein                     128   1e-31   
ref|XP_008218705.1|  PREDICTED: regulator of nonsense transcripts...    127   1e-31   Prunus mume [ume]
gb|EYU26454.1|  hypothetical protein MIMGU_mgv1a004529mg                128   1e-31   Erythranthe guttata [common monkey flower]
gb|EYU26453.1|  hypothetical protein MIMGU_mgv1a004529mg                128   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_007221816.1|  hypothetical protein PRUPE_ppa004923mg             127   2e-31   Prunus persica
ref|XP_008795266.1|  PREDICTED: regulator of nonsense transcripts...    128   2e-31   Phoenix dactylifera
ref|XP_007221815.1|  hypothetical protein PRUPE_ppa004923mg             127   2e-31   Prunus persica
ref|XP_009355334.1|  PREDICTED: regulator of nonsense transcripts...    127   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_009355335.1|  PREDICTED: regulator of nonsense transcripts...    127   2e-31   
ref|XP_008795263.1|  PREDICTED: regulator of nonsense transcripts...    127   2e-31   Phoenix dactylifera
ref|XP_010912655.1|  PREDICTED: regulator of nonsense transcripts...    126   9e-31   Elaeis guineensis
ref|XP_008802925.1|  PREDICTED: regulator of nonsense transcripts...    126   9e-31   Phoenix dactylifera
ref|XP_011088114.1|  PREDICTED: regulator of nonsense transcripts...    125   9e-31   
ref|XP_010657968.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   
ref|XP_010657969.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   
ref|XP_010657967.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Vitis vinifera
ref|XP_007148572.1|  hypothetical protein PHAVU_006G219800g             124   2e-30   Phaseolus vulgaris [French bean]
gb|KDO41302.1|  hypothetical protein CISIN_1g0102241mg                  121   3e-30   Citrus sinensis [apfelsine]
ref|XP_010910233.1|  PREDICTED: regulator of nonsense transcripts...    124   3e-30   
ref|XP_010910195.1|  PREDICTED: regulator of nonsense transcripts...    124   4e-30   Elaeis guineensis
gb|KJB32866.1|  hypothetical protein B456_005G265700                    123   4e-30   Gossypium raimondii
ref|XP_009404844.1|  PREDICTED: regulator of nonsense transcripts...    123   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS57826.1|  hypothetical protein M569_16991                         123   5e-30   Genlisea aurea
ref|XP_010930556.1|  PREDICTED: regulator of nonsense transcripts...    124   5e-30   Elaeis guineensis
ref|XP_009786002.1|  PREDICTED: regulator of nonsense transcripts...    123   6e-30   Nicotiana sylvestris
gb|KJB32867.1|  hypothetical protein B456_005G265700                    122   8e-30   Gossypium raimondii
ref|XP_006858584.1|  hypothetical protein AMTR_s00071p00188270          124   9e-30   Amborella trichopoda
gb|KJB32858.1|  hypothetical protein B456_005G265700                    122   1e-29   Gossypium raimondii
gb|KJB32869.1|  hypothetical protein B456_005G265700                    122   1e-29   Gossypium raimondii
gb|KJB32864.1|  hypothetical protein B456_005G265700                    122   1e-29   Gossypium raimondii
gb|KJB32865.1|  hypothetical protein B456_005G265700                    122   1e-29   Gossypium raimondii
gb|KJB32862.1|  hypothetical protein B456_005G265700                    122   1e-29   Gossypium raimondii
gb|KJB32868.1|  hypothetical protein B456_005G265700                    122   2e-29   Gossypium raimondii
gb|KJB32861.1|  hypothetical protein B456_005G265700                    122   2e-29   Gossypium raimondii
ref|XP_008802922.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Phoenix dactylifera
ref|XP_006431585.1|  hypothetical protein CICLE_v10000901mg             122   2e-29   Citrus clementina [clementine]
ref|XP_006492554.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Citrus sinensis [apfelsine]
ref|XP_008802926.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Phoenix dactylifera
ref|XP_009587163.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Nicotiana tomentosiformis
ref|XP_010030190.1|  PREDICTED: regulator of nonsense transcripts...    120   4e-29   Eucalyptus grandis [rose gum]
gb|KCW57140.1|  hypothetical protein EUGRSUZ_I02778                     120   4e-29   Eucalyptus grandis [rose gum]
ref|XP_009401110.1|  PREDICTED: regulator of nonsense transcripts...    121   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786472.1|  PREDICTED: regulator of nonsense transcripts...    121   7e-29   Phoenix dactylifera
ref|XP_008786471.1|  PREDICTED: regulator of nonsense transcripts...    121   8e-29   
ref|XP_002891069.1|  ATUPF3/UPF3                                        120   9e-29   
emb|CBI18298.3|  unnamed protein product                                117   9e-29   Vitis vinifera
ref|NP_174660.2|  regulator of nonsense transcripts UPF3                120   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403714.1|  PREDICTED: regulator of nonsense transcripts...    120   9e-29   
ref|XP_006385051.1|  hypothetical protein POPTR_0004s23450g             120   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006385052.1|  Smg-4/UPF3 family protein                          120   1e-28   
ref|XP_009362405.1|  PREDICTED: regulator of nonsense transcripts...    119   1e-28   Pyrus x bretschneideri [bai li]
gb|AAG12537.1|AC015446_18  Unknown protein                              119   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362402.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009362399.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_011047885.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
ref|XP_011047883.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
ref|XP_011047886.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
ref|XP_011047887.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
ref|XP_011028362.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
ref|XP_011028363.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Populus euphratica
emb|CAN62711.1|  hypothetical protein VITISV_035617                     117   2e-28   Vitis vinifera
gb|KDP42459.1|  hypothetical protein JCGZ_00256                         119   3e-28   Jatropha curcas
emb|CAN72659.1|  hypothetical protein VITISV_042717                     118   3e-28   Vitis vinifera
emb|CBI18294.3|  unnamed protein product                                116   3e-28   Vitis vinifera
ref|XP_006389505.1|  hypothetical protein POPTR_0022s00460g             118   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008368136.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...    118   6e-28   
ref|XP_008378738.1|  PREDICTED: regulator of nonsense transcripts...    117   9e-28   
ref|XP_008378736.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   
ref|XP_008378737.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   
ref|XP_010101271.1|  hypothetical protein L484_011635                   117   1e-27   
ref|XP_007226163.1|  hypothetical protein PRUPE_ppa015218mg             115   2e-27   
ref|XP_010683312.1|  PREDICTED: regulator of nonsense transcripts...    116   2e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB68168.1|  hypothetical protein B456_010G229700                    115   2e-27   Gossypium raimondii
gb|KJB68170.1|  hypothetical protein B456_010G229700                    115   2e-27   Gossypium raimondii
ref|XP_010683306.1|  PREDICTED: regulator of nonsense transcripts...    116   2e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB68172.1|  hypothetical protein B456_010G229700                    115   2e-27   Gossypium raimondii
gb|KJB68169.1|  hypothetical protein B456_010G229700                    115   3e-27   Gossypium raimondii
ref|XP_008219049.1|  PREDICTED: regulator of nonsense transcripts...    116   3e-27   Prunus mume [ume]
ref|XP_007024252.1|  Smg-4/UPF3 family protein, putative isoform 5      115   3e-27   
ref|XP_007024253.1|  Smg-4/UPF3 family protein, putative isoform 6      115   3e-27   
gb|KHG15802.1|  Regulator of nonsense transcripts 3A                    116   3e-27   Gossypium arboreum [tree cotton]
ref|XP_007024249.1|  Smg-4/UPF3 family protein, putative isoform 2      115   3e-27   
ref|XP_007024248.1|  Smg-4/UPF3 family protein, putative isoform 1      115   4e-27   
ref|XP_010327534.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Solanum lycopersicum
ref|XP_006339925.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Solanum tuberosum [potatoes]
ref|XP_006339922.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Solanum tuberosum [potatoes]
ref|XP_010327533.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Solanum lycopersicum
ref|XP_010327532.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Solanum lycopersicum
ref|XP_008459660.1|  PREDICTED: regulator of nonsense transcripts...    115   4e-27   Cucumis melo [Oriental melon]
ref|XP_004248850.2|  PREDICTED: regulator of nonsense transcripts...    115   5e-27   Solanum lycopersicum
ref|XP_008459659.1|  PREDICTED: regulator of nonsense transcripts...    115   5e-27   Cucumis melo [Oriental melon]
ref|XP_004141560.1|  PREDICTED: uncharacterized protein LOC101208317    115   5e-27   Cucumis sativus [cucumbers]
ref|XP_010542917.1|  PREDICTED: regulator of nonsense transcripts...    115   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_010542909.1|  PREDICTED: regulator of nonsense transcripts...    115   5e-27   Tarenaya hassleriana [spider flower]
gb|KGN52703.1|  hypothetical protein Csa_5G650630                       115   5e-27   Cucumis sativus [cucumbers]
ref|XP_010327529.1|  PREDICTED: regulator of nonsense transcripts...    115   5e-27   Solanum lycopersicum
ref|XP_010542926.1|  PREDICTED: regulator of nonsense transcripts...    115   6e-27   Tarenaya hassleriana [spider flower]
ref|XP_010327531.1|  PREDICTED: regulator of nonsense transcripts...    115   6e-27   Solanum lycopersicum
ref|NP_001117406.1|  regulator of nonsense transcripts UPF3             114   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975685.1|  PREDICTED: regulator of nonsense transcripts...    114   8e-27   
ref|XP_010478812.1|  PREDICTED: regulator of nonsense transcripts...    114   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004485448.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   
ref|XP_010499932.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009379185.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009379179.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_004485447.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   
tpg|DAA37690.1|  TPA: hypothetical protein ZEAMMB73_050614              112   1e-26   
ref|XP_002447880.1|  hypothetical protein SORBIDRAFT_06g017380          114   1e-26   
gb|EMT22790.1|  Regulator of nonsense transcripts 3A                    114   1e-26   
ref|XP_006303223.1|  hypothetical protein CARUB_v10012004mg             112   1e-26   
ref|XP_010463114.1|  PREDICTED: regulator of nonsense transcripts...    114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009421164.1|  PREDICTED: regulator of nonsense transcripts...    114   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94892.1|  predicted protein                                      113   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010096436.1|  hypothetical protein L484_013119                   113   3e-26   
ref|XP_011461172.1|  PREDICTED: regulator of nonsense transcripts...    112   4e-26   Fragaria vesca subsp. vesca
ref|XP_009421163.1|  PREDICTED: regulator of nonsense transcripts...    113   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011461169.1|  PREDICTED: regulator of nonsense transcripts...    112   5e-26   Fragaria vesca subsp. vesca
emb|CDY52194.1|  BnaCnng22070D                                          112   5e-26   Brassica napus [oilseed rape]
ref|XP_008669383.1|  PREDICTED: regulator of nonsense transcripts...    112   6e-26   Zea mays [maize]
tpg|DAA37689.1|  TPA: hypothetical protein ZEAMMB73_050614              112   6e-26   
ref|XP_011031522.1|  PREDICTED: regulator of nonsense transcripts...    111   2e-25   Populus euphratica
ref|XP_008663219.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   Zea mays [maize]
ref|XP_008663216.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   Zea mays [maize]
ref|XP_008663218.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   Zea mays [maize]
ref|XP_008663221.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   Zea mays [maize]
ref|XP_008663217.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   
emb|CAE03133.3|  OJ000114_01.14                                         110   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008663214.1|  PREDICTED: regulator of nonsense transcripts...    110   2e-25   Zea mays [maize]
ref|XP_010530121.1|  PREDICTED: regulator of nonsense transcripts...    110   3e-25   
ref|XP_010530119.1|  PREDICTED: regulator of nonsense transcripts...    110   3e-25   
ref|XP_010530120.1|  PREDICTED: regulator of nonsense transcripts...    110   3e-25   
ref|NP_001052873.1|  Os04g0440100                                       110   3e-25   
emb|CAH66847.1|  H0525C06.10                                            110   3e-25   Oryza sativa [red rice]
ref|XP_010239938.1|  PREDICTED: regulator of nonsense transcripts...    108   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_010239939.1|  PREDICTED: regulator of nonsense transcripts...    108   1e-24   Brachypodium distachyon [annual false brome]
emb|CDY48801.1|  BnaA05g20690D                                          108   1e-24   Brassica napus [oilseed rape]
ref|XP_009145165.1|  PREDICTED: regulator of nonsense transcripts...    108   1e-24   Brassica rapa
ref|XP_009145164.1|  PREDICTED: regulator of nonsense transcripts...    108   2e-24   Brassica rapa
ref|XP_003592906.1|  Regulator of nonsense transcripts 3A               106   3e-24   
gb|KHN47094.1|  Regulator of nonsense transcripts 3A                    107   5e-24   Glycine soja [wild soybean]
ref|XP_002325958.2|  hypothetical protein POPTR_0019s10620g             107   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006579008.1|  PREDICTED: regulator of nonsense transcripts...    106   9e-24   
ref|XP_003592907.1|  Regulator of nonsense transcripts 3A               106   1e-23   
gb|ABE91932.1|  Nonsense-mediated decay UPF3                            106   1e-23   Medicago truncatula
ref|XP_006579007.1|  PREDICTED: regulator of nonsense transcripts...    106   1e-23   
ref|XP_003522607.1|  PREDICTED: regulator of nonsense transcripts...    106   1e-23   
emb|CDY15301.1|  BnaC06g07870D                                          105   1e-23   Brassica napus [oilseed rape]
gb|AES63156.2|  Smg-4/UPF3 family protein                               105   1e-23   Medicago truncatula
gb|AES63158.2|  Smg-4/UPF3 family protein                               106   2e-23   Medicago truncatula
ref|XP_006415052.1|  hypothetical protein EUTSA_v10007455mg             105   2e-23   
ref|XP_003592905.1|  Regulator of nonsense transcripts 3A               105   2e-23   
ref|XP_009114779.1|  PREDICTED: regulator of nonsense transcripts...    104   3e-23   Brassica rapa
ref|XP_003527584.1|  PREDICTED: regulator of nonsense transcripts...    105   3e-23   Glycine max [soybeans]
ref|XP_006582443.1|  PREDICTED: regulator of nonsense transcripts...    105   3e-23   Glycine max [soybeans]
ref|XP_009114778.1|  PREDICTED: regulator of nonsense transcripts...    104   3e-23   Brassica rapa
ref|XP_006582445.1|  PREDICTED: regulator of nonsense transcripts...    105   3e-23   
ref|XP_006441553.1|  hypothetical protein CICLE_v10019695mg             105   3e-23   
ref|XP_006582442.1|  PREDICTED: regulator of nonsense transcripts...    105   3e-23   Glycine max [soybeans]
ref|XP_006582444.1|  PREDICTED: regulator of nonsense transcripts...    105   3e-23   Glycine max [soybeans]
emb|CDX93747.1|  BnaA09g23470D                                          104   4e-23   
ref|XP_006652316.1|  PREDICTED: regulator of nonsense transcripts...    104   6e-23   Oryza brachyantha
gb|KDO45829.1|  hypothetical protein CISIN_1g009733mg                   102   4e-22   Citrus sinensis [apfelsine]
ref|XP_006478194.1|  PREDICTED: regulator of nonsense transcripts...    102   4e-22   Citrus sinensis [apfelsine]
ref|XP_001778894.1|  predicted protein                                  103   5e-22   
gb|AES68284.2|  regulator of nonsense transcripts UPF3 protein          101   1e-21   Medicago truncatula
gb|KDP36702.1|  hypothetical protein JCGZ_07993                         100   1e-21   Jatropha curcas
ref|XP_007148608.1|  hypothetical protein PHAVU_005G000800g             100   2e-21   Phaseolus vulgaris [French bean]
ref|XP_007148607.1|  hypothetical protein PHAVU_005G000800g             100   2e-21   Phaseolus vulgaris [French bean]
emb|CDY46452.1|  BnaA08g06560D                                        99.8    2e-21   Brassica napus [oilseed rape]
ref|XP_003598033.1|  B3 domain-containing protein                       101   3e-21   
ref|XP_006441556.1|  hypothetical protein CICLE_v10019695mg           99.4    4e-21   
ref|XP_009107941.1|  PREDICTED: regulator of nonsense transcripts...  98.6    4e-21   Brassica rapa
ref|XP_009107940.1|  PREDICTED: regulator of nonsense transcripts...  98.6    5e-21   Brassica rapa
ref|XP_010910224.1|  PREDICTED: regulator of nonsense transcripts...  97.8    2e-20   
emb|CDX91795.1|  BnaC08g07140D                                        98.2    2e-20   
gb|KDO45837.1|  hypothetical protein CISIN_1g009733mg                 96.7    4e-20   Citrus sinensis [apfelsine]
ref|XP_002972412.1|  hypothetical protein SELMODRAFT_97155            90.5    6e-20   
ref|XP_002984244.1|  hypothetical protein SELMODRAFT_119852           89.7    1e-19   
ref|XP_006441789.1|  hypothetical protein CICLE_v10023375mg           87.0    1e-18   
ref|XP_001754467.1|  predicted protein                                91.7    6e-18   
ref|XP_006478236.1|  PREDICTED: uncharacterized protein LOC102612273  85.9    2e-17   
gb|KIY98106.1|  hypothetical protein MNEG_9858                        84.0    4e-17   Monoraphidium neglectum
ref|XP_006441573.1|  hypothetical protein CICLE_v10024086mg           80.9    2e-16   
ref|XP_004499559.1|  PREDICTED: regulator of nonsense transcripts...  82.0    6e-15   
ref|XP_004499558.1|  PREDICTED: regulator of nonsense transcripts...  82.0    6e-15   
ref|XP_004499561.1|  PREDICTED: regulator of nonsense transcripts...  81.6    7e-15   
ref|XP_004499563.1|  PREDICTED: regulator of nonsense transcripts...  81.6    7e-15   Cicer arietinum [garbanzo]
ref|XP_004499560.1|  PREDICTED: regulator of nonsense transcripts...  81.6    7e-15   
ref|XP_002945932.1|  hypothetical protein VOLCADRAFT_48819            74.3    4e-14   Volvox carteri f. nagariensis
ref|XP_001691099.1|  UPF3 protein                                     77.8    6e-14   Chlamydomonas reinhardtii
ref|XP_002510770.1|  conserved hypothetical protein                   73.9    2e-12   
gb|AFK46637.1|  unknown                                               65.9    2e-11   Lotus japonicus
ref|XP_011395745.1|  Regulator of nonsense transcripts 3A             70.1    4e-11   Auxenochlorella protothecoides
ref|XP_008378998.1|  PREDICTED: regulator of nonsense transcripts...  62.4    2e-10   
emb|CCJ29190.1|  unnamed protein product                              66.6    6e-10   Pneumocystis jirovecii
ref|XP_008352807.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  63.2    1e-08   
ref|XP_005644501.1|  hypothetical protein COCSUDRAFT_44353            62.0    2e-08   Coccomyxa subellipsoidea C-169
ref|XP_005851259.1|  hypothetical protein CHLNCDRAFT_50004            57.4    8e-08   Chlorella variabilis
gb|KHN22614.1|  Regulator of nonsense transcripts 3A                  56.2    3e-07   Glycine soja [wild soybean]
gb|EMS47492.1|  Regulator of nonsense transcripts 3A                  58.2    5e-07   Triticum urartu
gb|EPZ31303.1|  Nucleotide-binding, alpha-beta plait domain-conta...  55.8    7e-07   Rozella allomycis CSF55
emb|CCO28851.1|  putative WD repeat-containing protein C1672,07       57.8    9e-07   Rhizoctonia solani AG-1 IB
gb|ESA18168.1|  hypothetical protein GLOINDRAFT_144398                56.2    1e-06   
ref|XP_007872945.1|  hypothetical protein PNEG_01033                  57.0    1e-06   Pneumocystis murina B123
emb|CAX18772.1|  UPF3 regulator of nonsense transcripts homolog A...  54.3    1e-06   Danio rerio [leopard danio]
ref|XP_008339206.1|  PREDICTED: zinc transporter ZTP29-like           54.7    1e-06   
emb|CEL51964.1|  hypothetical protein RSOLAG1IB_00501                 56.2    2e-06   Rhizoctonia solani AG-1 IB
ref|XP_010930558.1|  PREDICTED: regulator of nonsense transcripts...  55.8    3e-06   Elaeis guineensis
gb|AAH95761.1|  Upf3a protein                                         54.3    3e-06   Danio rerio [leopard danio]
gb|KDN51831.1|  hypothetical protein RSAG8_00380                      55.5    3e-06   Rhizoctonia solani AG-8 WAC10335
ref|XP_006676092.1|  hypothetical protein BATDEDRAFT_84963            55.8    3e-06   Batrachochytrium dendrobatidis JAM81
gb|EJU05580.1|  hypothetical protein DACRYDRAFT_104067                55.8    3e-06   Dacryopinax primogenitus
gb|EUC62084.1|  Smg-4/UPF3 family protein                             55.8    4e-06   Rhizoctonia solani AG-3 Rhs1AP
gb|KEP50606.1|  Smg-4/UPF3 family protein                             55.8    4e-06   Rhizoctonia solani 123E
ref|XP_010930557.1|  PREDICTED: regulator of nonsense transcripts...  55.5    4e-06   
ref|XP_011501641.1|  PREDICTED: regulator of nonsense transcripts 3A  55.1    5e-06   Ceratosolen solmsi marchali
gb|EXX69496.1|  hypothetical protein RirG_095570                      55.1    5e-06   Rhizophagus irregularis DAOM 197198w
gb|KIM41523.1|  hypothetical protein M413DRAFT_445507                 52.0    7e-06   Hebeloma cylindrosporum h7
ref|XP_007263451.1|  hypothetical protein FOMMEDRAFT_165771           54.7    8e-06   Fomitiporia mediterranea MF3/22
gb|KIJ64775.1|  hypothetical protein HYDPIDRAFT_28135                 54.3    8e-06   Hydnomerulius pinastri MD-312
ref|XP_010738428.1|  PREDICTED: regulator of nonsense transcripts 3A  54.3    1e-05   
gb|KIK61351.1|  hypothetical protein GYMLUDRAFT_58885                 53.9    1e-05   Gymnopus luxurians FD-317 M1
ref|XP_010903997.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   Esox lucius
ref|XP_010786902.1|  PREDICTED: regulator of nonsense transcripts...  53.5    1e-05   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010903995.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   Esox lucius
ref|XP_007339797.1|  hypothetical protein AURDEDRAFT_181525           53.9    1e-05   
ref|XP_006788210.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   Neolamprologus brichardi [lyretail cichlid]
gb|KDQ17942.1|  hypothetical protein BOTBODRAFT_29260                 53.9    1e-05   Botryobasidium botryosum FD-172 SS1
ref|XP_003800045.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  53.9    1e-05   
ref|XP_005935879.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Haplochromis burtoni
gb|KIK82630.1|  hypothetical protein PAXRUDRAFT_153590                53.5    2e-05   Paxillus rubicundulus Ve08.2h10
ref|XP_004568014.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Maylandia zebra
ref|XP_004568016.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_005935877.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Haplochromis burtoni
ref|XP_005935878.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_005475492.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Oreochromis niloticus
ref|XP_005935876.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Haplochromis burtoni
ref|XP_004568015.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_008280517.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Stegastes partitus
ref|XP_008280526.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Stegastes partitus
ref|XP_004568013.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Maylandia zebra
ref|XP_003451599.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_008280534.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   Stegastes partitus
pdb|1UW4|A  Chain A, The Structural Basis Of The Interaction Betw...  49.7    3e-05   Homo sapiens [man]
ref|XP_849752.2|  PREDICTED: regulator of nonsense transcripts 3A...  52.8    3e-05   Canis lupus familiaris [dogs]
dbj|BAG57751.1|  unnamed protein product                              50.4    3e-05   Homo sapiens [man]
ref|XP_008214123.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.8    3e-05   
ref|XP_005167908.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   Danio rerio [leopard danio]
ref|XP_005167907.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   Danio rerio [leopard danio]
ref|NP_001189377.1|  regulator of nonsense transcripts 3A             52.4    4e-05   Danio rerio [leopard danio]
ref|XP_007911648.1|  putative nonsense-mediated mrna decay protein    52.4    4e-05   Phaeoacremonium minimum UCRPA7
emb|CDQ69277.1|  unnamed protein product                              52.8    4e-05   Oncorhynchus mykiss
ref|XP_008326453.1|  PREDICTED: regulator of nonsense transcripts...  52.0    5e-05   
ref|XP_008326457.1|  PREDICTED: regulator of nonsense transcripts...  51.6    6e-05   
pdb|2L08|A  Chain A, Solution Nmr Structure Of Nonsense Mrna Redu...  48.9    6e-05   
ref|XP_008326452.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_002593359.1|  hypothetical protein BRAFLDRAFT_70868            52.0    6e-05   
ref|XP_008326454.1|  PREDICTED: regulator of nonsense transcripts...  51.6    6e-05   
ref|XP_005733842.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_008431434.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_003030982.1|  hypothetical protein SCHCODRAFT_109867           51.2    8e-05   
ref|XP_007317069.1|  hypothetical protein SERLADRAFT_436716           51.2    9e-05   
gb|KIJ16461.1|  hypothetical protein PAXINDRAFT_10911                 51.2    9e-05   
gb|ELK26013.1|  Regulator of nonsense transcripts 3A                  51.2    9e-05   
ref|XP_004012426.1|  PREDICTED: regulator of nonsense transcripts 3A  51.2    9e-05   
gb|EAX09249.1|  UPF3 regulator of nonsense transcripts homolog A ...  50.4    1e-04   
ref|XP_007227931.1|  PREDICTED: regulator of nonsense transcripts...  50.8    1e-04   
ref|XP_007940590.1|  PREDICTED: regulator of nonsense transcripts 3A  50.8    1e-04   
ref|XP_008142232.1|  PREDICTED: regulator of nonsense transcripts 3A  50.8    1e-04   
ref|XP_007227930.1|  PREDICTED: regulator of nonsense transcripts...  50.8    1e-04   
gb|KIM52552.1|  hypothetical protein SCLCIDRAFT_1223619               50.8    1e-04   
ref|XP_004621431.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  50.8    1e-04   
ref|XP_010591894.1|  PREDICTED: regulator of nonsense transcripts...  50.4    1e-04   
ref|XP_002364750.1|  smg-4/UPF3 family domain protein                 50.8    1e-04   
gb|KFG56382.1|  Smg-4/UPF3 family protein                             50.8    1e-04   
gb|EJT52479.1|  hypothetical protein A1Q1_03995                       50.4    1e-04   
gb|EKD05159.1|  hypothetical protein A1Q2_00545                       50.4    1e-04   
gb|KFG66380.1|  Smg-4/UPF3 family protein                             50.8    1e-04   
ref|XP_004369447.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  50.8    1e-04   
emb|CDQ75295.1|  unnamed protein product                              47.8    2e-04   
ref|XP_004704483.1|  PREDICTED: regulator of nonsense transcripts 3A  50.4    2e-04   
ref|XP_008326455.1|  PREDICTED: regulator of nonsense transcripts...  50.4    2e-04   
ref|XP_005659004.1|  PREDICTED: regulator of nonsense transcripts...  50.4    2e-04   
ref|XP_005266257.1|  PREDICTED: regulator of nonsense transcripts...  50.1    2e-04   
ref|XP_006884026.1|  PREDICTED: regulator of nonsense transcripts 3A  50.1    2e-04   
ref|XP_006076665.1|  PREDICTED: regulator of nonsense transcripts...  50.4    2e-04   
gb|EHB12834.1|  Regulator of nonsense transcripts 3B                  50.4    2e-04   
dbj|BAB32218.1|  unnamed protein product                              48.5    2e-04   
ref|XP_009247103.1|  PREDICTED: regulator of nonsense transcripts...  50.1    2e-04   
ref|XP_010829733.1|  PREDICTED: regulator of nonsense transcripts...  50.4    2e-04   
emb|CEP19677.1|  hypothetical protein                                 50.1    2e-04   
ref|XP_010829734.1|  PREDICTED: regulator of nonsense transcripts...  50.4    2e-04   
dbj|GAN09940.1|  conserved hypothetical protein                       50.1    2e-04   
gb|EPB88698.1|  hypothetical protein HMPREF1544_04457                 50.1    2e-04   
ref|XP_006639007.1|  PREDICTED: regulator of nonsense transcripts...  50.1    2e-04   
ref|XP_010591893.1|  PREDICTED: regulator of nonsense transcripts...  50.1    2e-04   
emb|CDS12040.1|  hypothetical protein LRAMOSA04235                    49.7    2e-04   
gb|EPR58795.1|  Smg-4/UPF3 family protein                             50.1    2e-04   
ref|XP_006851618.1|  PREDICTED: regulator of nonsense transcripts 3A  50.1    2e-04   
gb|KFG36731.1|  Smg-4/UPF3 family protein                             50.1    2e-04   
gb|EPT25711.1|  Smg-4/UPF3 family protein                             50.1    2e-04   
gb|KFG49381.1|  Smg-4/UPF3 family protein                             50.1    3e-04   
gb|KFH02027.1|  Smg-4/UPF3 family protein                             50.1    3e-04   
gb|AAI21019.1|  UPF3B protein                                         48.9    3e-04   
ref|XP_006176815.1|  PREDICTED: regulator of nonsense transcripts 3A  49.7    3e-04   
emb|CDH57309.1|  wd repeat-containing protein                         49.7    3e-04   
ref|XP_004365162.1|  hypothetical protein CAOG_00291                  49.7    3e-04   
ref|XP_004448695.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  49.7    3e-04   
ref|XP_006909398.1|  PREDICTED: regulator of nonsense transcripts...  49.3    3e-04   
ref|XP_002192806.2|  PREDICTED: regulator of nonsense transcripts 3A  49.7    3e-04   
ref|XP_007547253.1|  PREDICTED: regulator of nonsense transcripts...  49.7    3e-04   
ref|XP_011348594.1|  PREDICTED: regulator of nonsense transcripts 3A  49.7    3e-04   
ref|XP_009556246.1|  PREDICTED: regulator of nonsense transcripts 3A  49.7    3e-04   
ref|XP_008431428.1|  PREDICTED: regulator of nonsense transcripts...  49.3    3e-04   
ref|XP_007547252.1|  PREDICTED: regulator of nonsense transcripts...  49.3    3e-04   
ref|XP_007547251.1|  PREDICTED: regulator of nonsense transcripts...  49.3    3e-04   
ref|XP_007547250.1|  PREDICTED: regulator of nonsense transcripts...  49.3    4e-04   
dbj|BAC28207.1|  unnamed protein product                              48.5    4e-04   
ref|XP_003961715.1|  PREDICTED: regulator of nonsense transcripts...  49.3    4e-04   
gb|ACU18923.1|  unknown                                               46.2    4e-04   
ref|XP_006102113.1|  PREDICTED: regulator of nonsense transcripts 3A  49.3    4e-04   
gb|ELU44664.1|  smg-4/UPF3 family domain-containing protein           49.3    4e-04   
ref|XP_005877753.1|  PREDICTED: regulator of nonsense transcripts 3A  49.3    4e-04   
ref|XP_002824527.1|  PREDICTED: regulator of nonsense transcripts...  49.3    4e-04   
gb|EAW89843.1|  UPF3 regulator of nonsense transcripts homolog B ...  48.9    4e-04   
ref|XP_010591892.1|  PREDICTED: regulator of nonsense transcripts...  49.3    4e-04   
ref|XP_006769378.1|  PREDICTED: regulator of nonsense transcripts 3A  49.3    4e-04   
gb|KFH18280.1|  Smg-4/UPF3 family protein                             49.3    4e-04   
gb|KDQ32779.1|  hypothetical protein PLEOSDRAFT_1073199               49.3    4e-04   
ref|XP_007196795.1|  PREDICTED: regulator of nonsense transcripts...  48.9    4e-04   
gb|AFR96497.2|  hypothetical protein CNAG_03276                       48.9    5e-04   
ref|XP_004710123.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_005295966.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_002824528.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
emb|CAG07286.1|  unnamed protein product                              48.5    5e-04   
ref|XP_006749889.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_007331132.1|  hypothetical protein AGABI1DRAFT_129598          48.9    5e-04   
ref|XP_009550875.1|  hypothetical protein HETIRDRAFT_436258           48.9    5e-04   
ref|XP_004710124.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_004577654.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_001621914.1|  hypothetical protein NEMVEDRAFT_v1g143243        46.2    5e-04   
ref|XP_005810868.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
gb|EPQ14845.1|  Regulator of nonsense transcripts 3A                  48.9    5e-04   
ref|XP_005810870.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_006724844.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_008683241.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_005810869.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_011163835.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_010950654.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_006218264.1|  PREDICTED: regulator of nonsense transcripts 3A  48.9    5e-04   
ref|XP_004467549.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_005810871.1|  PREDICTED: regulator of nonsense transcripts...  48.9    5e-04   
ref|XP_006455323.1|  hypothetical protein AGABI2DRAFT_187731          48.9    5e-04   
ref|XP_004467550.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
ref|XP_974984.1|  PREDICTED: regulator of nonsense transcripts 3A     48.9    6e-04   
ref|XP_004379883.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
ref|XP_006872154.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
ref|XP_009190566.1|  PREDICTED: regulator of nonsense transcripts...  48.5    6e-04   
ref|XP_004614510.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
dbj|BAB30093.1|  unnamed protein product                              48.1    6e-04   
ref|XP_004379884.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
ref|XP_006872155.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
ref|XP_011377840.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  48.9    6e-04   
ref|XP_006909399.1|  PREDICTED: regulator of nonsense transcripts...  48.9    6e-04   
gb|KIP09958.1|  hypothetical protein PHLGIDRAFT_85906                 48.1    6e-04   
ref|XP_004614511.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
ref|XP_010985943.1|  PREDICTED: regulator of nonsense transcripts 3A  48.5    7e-04   
ref|XP_008507162.1|  PREDICTED: regulator of nonsense transcripts 3B  48.5    7e-04   
ref|XP_008634145.1|  PREDICTED: regulator of nonsense transcripts 3A  48.5    7e-04   
ref|XP_005673919.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
ref|XP_006268616.1|  PREDICTED: regulator of nonsense transcripts 3A  48.5    7e-04   
ref|XP_010573972.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
gb|EPT02345.1|  hypothetical protein FOMPIDRAFT_141476                47.4    7e-04   
ref|NP_001069879.1|  regulator of nonsense transcripts 3B             48.1    7e-04   
ref|XP_003414824.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
ref|XP_007196794.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
ref|XP_010573973.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
dbj|BAB31954.1|  unnamed protein product                              48.1    7e-04   
ref|XP_007902641.1|  PREDICTED: regulator of nonsense transcripts...  48.5    7e-04   
ref|XP_780145.3|  PREDICTED: uncharacterized protein LOC574684        48.1    8e-04   
ref|XP_007951522.1|  PREDICTED: regulator of nonsense transcripts...  48.5    8e-04   
ref|XP_003414825.1|  PREDICTED: regulator of nonsense transcripts...  48.5    8e-04   
gb|AAG60690.1|AF318575_1  UPF3                                        48.5    8e-04   
ref|XP_007075325.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  48.5    8e-04   
ref|XP_009233484.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  48.1    8e-04   
ref|XP_005420088.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    8e-04   
ref|XP_007951523.1|  PREDICTED: regulator of nonsense transcripts...  48.5    8e-04   
gb|EHB07949.1|  Regulator of nonsense transcripts 3B                  47.8    8e-04   
ref|XP_007196793.1|  PREDICTED: regulator of nonsense transcripts...  48.1    9e-04   
ref|XP_005151571.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    9e-04   
gb|KFO73940.1|  Regulator of nonsense transcripts 3A                  48.1    9e-04   
ref|XP_009663817.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    9e-04   
ref|XP_007959223.1|  PREDICTED: regulator of nonsense transcripts...  48.1    9e-04   
ref|XP_009083697.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    9e-04   
gb|KDE06536.1|  hypothetical protein MVLG_03185                       47.8    9e-04   
gb|KFV75952.1|  Regulator of nonsense transcripts 3A                  48.1    9e-04   
ref|XP_005488045.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    0.001   
ref|XP_007959222.1|  PREDICTED: regulator of nonsense transcripts...  48.1    0.001   
ref|XP_004872225.1|  PREDICTED: regulator of nonsense transcripts...  48.1    0.001   
gb|KIO11060.1|  hypothetical protein M404DRAFT_994730                 48.1    0.001   
ref|XP_003488445.1|  PREDICTED: hypothetical protein LOC100743974...  48.1    0.001   
ref|XP_006893846.1|  PREDICTED: regulator of nonsense transcripts...  48.1    0.001   
ref|XP_791537.3|  PREDICTED: regulator of nonsense transcripts 3B...  46.2    0.001   
ref|XP_011231589.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    0.001   
gb|KIO20158.1|  hypothetical protein M407DRAFT_30192                  48.1    0.001   
ref|XP_005516633.1|  PREDICTED: regulator of nonsense transcripts 3A  48.1    0.001   
ref|XP_006893845.1|  PREDICTED: regulator of nonsense transcripts...  48.1    0.001   
gb|ENN72156.1|  hypothetical protein YQE_11213                        48.1    0.001   



>emb|CDO97628.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPP++ Q++L+++V++RFSGRYNWVSF PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPSISQSSLMDQVETRFSGRYNWVSFRPGKTSQKRQSYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_004230442.1| PREDICTED: regulator of nonsense transcripts UPF3 [Solanum lycopersicum]
Length=485

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR+KVVLRHLPPT+ Q+ L+++VDSRF+GRYNW  F PGK SQK QTYSRAY+EF
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_009775100.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana sylvestris]
Length=508

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK SQK QTYSRAYV+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_009587503.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=508

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK SQK QTYSRAYV+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Solanum 
tuberosum]
Length=483

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR+KVVLRHLPPT+ Q+ L+++VDSRF+GRYNW  F PGK SQK QTYSRAY+EF
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDVIEFAEFF+GH+FVN
Sbjct  61   KMPEDVIEFAEFFDGHVFVN  80



>ref|XP_007041200.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97031.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=514

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP + +A L+E+VD+ FSGRYNW+SF PGK SQK Q+YSRAY++F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KR EDV+EFAEFFNGH+FVN
Sbjct  61   KRSEDVLEFAEFFNGHVFVN  80



>ref|XP_011092289.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092290.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092291.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=518

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPPT+ Q+ L + VDSRFSGRY W +F PGK SQK  TYSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLFDHVDSRFSGRYRWSAFRPGKSSQKHLTYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV+EFAEFFNGH+FVN
Sbjct  61   NRPEDVLEFAEFFNGHVFVN  80



>ref|XP_007041201.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOX97032.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
Length=440

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP + +A L+E+VD+ FSGRYNW+SF PGK SQK Q+YSRAY++F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KR EDV+EFAEFFNGH+FVN
Sbjct  61   KRSEDVLEFAEFFNGHVFVN  80



>ref|XP_010246764.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X5 
[Nelumbo nucifera]
Length=575

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHIFVN  80



>ref|XP_010246762.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Nelumbo nucifera]
Length=585

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHIFVN  80



>ref|XP_010246763.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X4 
[Nelumbo nucifera]
Length=580

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHIFVN  80



>ref|XP_009775092.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana sylvestris]
Length=517

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 9/89 (10%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------ISQKQQ  400
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK          SQK Q
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  401  TYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            TYSRAYV+FKRPEDVIEFAEFF+GH+FVN
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVN  89



>ref|XP_009587502.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=517

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 9/89 (10%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------ISQKQQ  400
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK          SQK Q
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  401  TYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            TYSRAYV+FKRPEDVIEFAEFF+GH+FVN
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVN  89



>ref|XP_010246761.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Nelumbo nucifera]
Length=602

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHIFVN  80



>ref|XP_010246760.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Nelumbo nucifera]
Length=612

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHIFVN  80



>gb|KJB47855.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47857.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=508

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  61   KRPEDVLEFAEFFNGHVFVS  80



>gb|KJB47856.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47858.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  61   KRPEDVLEFAEFFNGHVFVS  80



>gb|KJB47859.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47861.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47869.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=516

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KJB47866.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KJB47860.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47862.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47865.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=515

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KJB47864.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=485

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KJB47868.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47870.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=468

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KJB47867.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=511

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>gb|KHF99019.1| upf3a [Gossypium arboreum]
Length=577

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESVLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFFNGH+FV+
Sbjct  68   KRPEDVLEFAEFFNGHVFVS  87



>ref|XP_006598794.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006598795.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN39677.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=512

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A L+ ++D+ F+GRYNW+SF PGKISQK  +YSRAY++F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLAQIDAAFAGRYNWLSFRPGKISQKHISYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVI FAEFFNGH+FVN
Sbjct  61   KRPEDVILFAEFFNGHVFVN  80



>ref|XP_006592654.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006592655.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN31598.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=514

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A L+ ++D+ F+GRYNW+SF PGKISQK  ++SRAY++F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLSQIDAAFAGRYNWLSFRPGKISQKHMSFSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVI FAEFFNGH+FVN
Sbjct  61   KRPEDVILFAEFFNGHVFVN  80



>ref|XP_009353786.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009353787.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009353789.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRY+WV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDGFFAGRYSWVAFRPGKKSQKNQSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GHLFVN
Sbjct  62   KRPEDVFEFAEFFDGHLFVN  81



>ref|XP_002526435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35930.1| conserved hypothetical protein [Ricinus communis]
Length=472

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            ++ KVV+RHLPPT+ Q + +E++D  FSGRYNWVSF PGK SQK Q+YSRAY++FKRPED
Sbjct  7    EKTKVVVRHLPPTISQGSFLEQIDVVFSGRYNWVSFRPGKSSQKHQSYSRAYIDFKRPED  66

Query  443  VIEFAEFFNGHLFVN  487
            VIEFAEFFNGHLFVN
Sbjct  67   VIEFAEFFNGHLFVN  81



>ref|XP_008218705.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Prunus 
mume]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GHLFVN
Sbjct  62   KRPEDVIEFAEFFDGHLFVN  81



>gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=521

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  +DR KVVLRHLPPT+ Q+ L+E VDSRFSGRY W++F PGK S +Q  YSRAY++F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              PEDVIEFAEFFNGH+FVN
Sbjct  61   NTPEDVIEFAEFFNGHIFVN  80



>gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=522

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  +DR KVVLRHLPPT+ Q+ L+E VDSRFSGRY W++F PGK S +Q  YSRAY++F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              PEDVIEFAEFFNGH+FVN
Sbjct  61   NTPEDVIEFAEFFNGHIFVN  80



>ref|XP_007221816.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23015.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=485

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GHLFVN
Sbjct  62   KRPEDVIEFAEFFDGHLFVN  81



>ref|XP_008795266.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=562

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR K+VLRHLPP++ Q+ LIE++D RFSGRY+W+ F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPE V+EFAEFF+GH+FVN
Sbjct  61   KRPEVVVEFAEFFDGHIFVN  80



>ref|XP_007221815.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23014.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=482

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GHLFVN
Sbjct  62   KRPEDVIEFAEFFDGHLFVN  81



>ref|XP_009355334.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=495

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRYNWV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRP+DV +FAEFF+GHLFVN
Sbjct  62   KRPDDVFDFAEFFDGHLFVN  81



>ref|XP_009355335.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=485

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRYNWV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRP+DV +FAEFF+GHLFVN
Sbjct  62   KRPDDVFDFAEFFDGHLFVN  81



>ref|XP_008795263.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008795264.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=565

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR K+VLRHLPP++ Q+ LIE++D RFSGRY+W+ F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPE V+EFAEFF+GH+FVN
Sbjct  61   KRPEVVVEFAEFFDGHIFVN  80



>ref|XP_010912655.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Elaeis 
guineensis]
Length=562

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR K+VLRHLPP++ Q+ L+E++  RF+GRY+WV F PGK S K Q YSR+Y+ F
Sbjct  1    MKGPFDRTKIVLRHLPPSISQSALMEQIGERFAGRYDWVCFRPGKASPKNQRYSRSYLSF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFF+GH+FVN
Sbjct  61   KRPEDVVEFAEFFDGHIFVN  80



>ref|XP_008802925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=568

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  239  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK SQK   +SRAY
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSQKNPHHSRAY  66

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FKRPEDV+EFAEFF+GH+FVN
Sbjct  67   IDFKRPEDVVEFAEFFDGHVFVN  89



>ref|XP_011088114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=515

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPPT+ Q+ L+E VDSRF GRY W+ F PGK S K   YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLVEHVDSRFVGRYLWLVFRPGKSSLKHPKYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             +PEDVIEFAEFFNGH+FVN
Sbjct  61   NKPEDVIEFAEFFNGHVFVN  80



>ref|XP_010657968.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Vitis vinifera]
Length=515

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_010657969.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Vitis vinifera]
Length=514

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_010657967.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Vitis vinifera]
 emb|CBI29694.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_007148572.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 ref|XP_007148573.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20566.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20567.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
Length=513

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP+L +A L+ ++DS F+ RYNW+SF P K+SQK  +YSRAY++F
Sbjct  1    MKGSLDRTKVVLRHLPPSLSEAALLAQIDSAFADRYNWLSFRPAKVSQKHISYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRP+DVI FAEFFNGH+FVN
Sbjct  61   KRPDDVILFAEFFNGHVFVN  80



>gb|KDO41302.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
 gb|KDO41303.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
Length=260

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDV+EFAEFFNGH+FVN
Sbjct  61   KKPEDVLEFAEFFNGHVFVN  80



>ref|XP_010910233.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=531

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK ++K Q +SRAY++F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             R EDV+EFAEFF+GH+FVN
Sbjct  61   NRSEDVVEFAEFFDGHIFVN  80



>ref|XP_010910195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910210.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=566

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK ++K Q +SRAY++F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             R EDV+EFAEFF+GH+FVN
Sbjct  61   NRSEDVVEFAEFFDGHIFVN  80



>gb|KJB32866.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=443

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>ref|XP_009404844.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=467

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVV+RHLPP + Q+ L+E++D RF+GRY+WV F PGK SQK Q +SRAY+ F
Sbjct  1    MKDPPDRTKVVMRHLPPAISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKDQIHSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              PEDV+EFAEFF+GH+FVN
Sbjct  61   NNPEDVVEFAEFFDGHIFVN  80



>gb|EPS57826.1| hypothetical protein M569_16991, partial [Genlisea aurea]
Length=484

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLRHLPP++ ++ L+E +DSRFSGRY+W +F PGK SQK+  YSRAY+ F
Sbjct  1    MKGPLDRTKVVLRHLPPSISESNLVELIDSRFSGRYHWFAFCPGKSSQKRLKYSRAYIGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             +PEDVIEFA FFNGH FVN
Sbjct  61   YKPEDVIEFAAFFNGHAFVN  80



>ref|XP_010930556.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=575

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KR EDV+EFAE F+GH+FVN
Sbjct  61   KRLEDVVEFAELFDGHIFVN  80



>ref|XP_009786002.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
sylvestris]
Length=469

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVV+RHLPPTL Q+TL+E+VDSRF+GRYNW +F PGK S K Q+YSRAY++F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRAYIDFRNTEDV  64

Query  446  IEFAEFFNGHLFVN  487
            IEFAEFF+GH+FVN
Sbjct  65   IEFAEFFDGHVFVN  78



>gb|KJB32867.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=476

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>ref|XP_006858584.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda]
 gb|ERN20051.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda]
Length=599

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+R LPP L Q  L+EK+DSRFSGRY W +F PGK S K Q +SR Y++F
Sbjct  1    MKDPLDRTKVVVRRLPPALTQQALMEKIDSRFSGRYEWAAFRPGKNSLKNQRHSRIYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFF GH+FVN
Sbjct  61   KRPEDVLEFAEFFVGHVFVN  80



>gb|KJB32858.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=508

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32869.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=442

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32864.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=504

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32865.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=515

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32862.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=514

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32868.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=499

 Score =   122 bits (306),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>gb|KJB32861.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=507

 Score =   122 bits (306),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSLEDVLEFAEFFNGHVFVN  80



>ref|XP_008802922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=570

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +2

Query  239  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSR  412
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK   SQK   +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  413  AYVEFKRPEDVIEFAEFFNGHLFVN  487
            AY++FKRPEDV+EFAEFF+GH+FVN
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVN  91



>ref|XP_006431585.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
 gb|ESR44825.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
Length=514

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDV+EFAEFFNGH+FVN
Sbjct  61   KKPEDVLEFAEFFNGHVFVN  80



>ref|XP_006492554.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Citrus 
sinensis]
Length=514

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDV+EFAEFFNGH+FVN
Sbjct  61   KKPEDVLEFAEFFNGHVFVN  80



>ref|XP_008802926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Phoenix dactylifera]
Length=567

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +2

Query  239  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSR  412
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK   SQK   +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  413  AYVEFKRPEDVIEFAEFFNGHLFVN  487
            AY++FKRPEDV+EFAEFF+GH+FVN
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVN  91



>ref|XP_009587163.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVV+RHLPPTL Q+TL+E+VDSRF+GRYNW +F PGK S K Q+YSR Y++F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRVYIDFRNTEDV  64

Query  446  IEFAEFFNGHLFVN  487
            IEFAEFF+GH+FVN
Sbjct  65   IEFAEFFDGHVFVN  78



>ref|XP_010030190.1| PREDICTED: regulator of nonsense transcripts UPF3 [Eucalyptus 
grandis]
 gb|KCW57141.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=486

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVVLRHLPP++ +  L +++D+ F+GRYNW SF PGK S K Q YSRAY+ F
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF GH+FVN
Sbjct  61   KRPEDVIEFAEFFEGHVFVN  80



>gb|KCW57140.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=479

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVVLRHLPP++ +  L +++D+ F+GRYNW SF PGK S K Q YSRAY+ F
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF GH+FVN
Sbjct  61   KRPEDVIEFAEFFEGHVFVN  80



>ref|XP_009401110.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401111.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=565

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            M+ P DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK SQK Q +SRAY+ F
Sbjct  1    MRGPSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRHSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAEFF+ H+FVN
Sbjct  61   KRPEDVVEFAEFFDQHIFVN  80



>ref|XP_008786472.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=574

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KR EDV+EFAE F+GH+FVN
Sbjct  61   KRLEDVVEFAELFDGHIFVN  80



>ref|XP_008786471.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=581

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KR EDV+EFAE F+GH+FVN
Sbjct  61   KRLEDVVEFAELFDGHIFVN  80



>ref|XP_002891069.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67328.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>emb|CBI18298.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KV++RHLPP + +A  +E++++ F GRY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|NP_174660.2| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 sp|Q9FVW4.1|RENT3_ARATH RecName: Full=Regulator of nonsense transcripts UPF3; AltName: 
Full=Nonsense mRNA reducing factor UPF3; AltName: Full=Up-frameshift 
suppressor 3 homolog; Short=AtUpf3 [Arabidopsis thaliana]
 gb|AAG12847.1|AC079286_4 unknown protein; 6107-8789 [Arabidopsis thaliana]
 gb|AAM91586.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15431.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31653.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=482

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_009403714.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=563

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P DR KVV+R LPP++ Q  L+E++D RF+GRY+WV F PGK SQK Q Y+RAY+ F
Sbjct  1    MKDPSDRTKVVVRRLPPSMSQPVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRYTRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K P+DV+EFAEFF+GH+FVN
Sbjct  61   KIPDDVVEFAEFFDGHIFVN  80



>ref|XP_006385051.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
 gb|ERP62848.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
Length=520

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGH+FVN
Sbjct  68   VIDFAEFFNGHIFVN  82



>ref|XP_006385052.1| Smg-4/UPF3 family protein [Populus trichocarpa]
 gb|ERP62849.1| Smg-4/UPF3 family protein [Populus trichocarpa]
Length=527

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGH+FVN
Sbjct  68   VIDFAEFFNGHIFVN  82



>ref|XP_009362405.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Pyrus x bretschneideri]
Length=491

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHMFVN  80



>gb|AAG12537.1|AC015446_18 Unknown protein [Arabidopsis thaliana]
Length=525

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_009362402.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362403.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362404.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=522

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHMFVN  80



>ref|XP_009362399.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362400.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362401.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=523

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHMFVN  80



>ref|XP_011047885.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=517

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  67   VIDFAEFFNGHLFVN  81



>ref|XP_011047883.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047884.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=518

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  67   VIDFAEFFNGHLFVN  81



>ref|XP_011047886.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Populus euphratica]
Length=511

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  67   VIDFAEFFNGHLFVN  81



>ref|XP_011047887.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Populus euphratica]
Length=510

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  67   VIDFAEFFNGHLFVN  81



>ref|XP_011028362.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=521

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + +   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  68   VIDFAEFFNGHLFVN  82



>ref|XP_011028363.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=520

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + +   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  68   VIDFAEFFNGHLFVN  82



>emb|CAN62711.1| hypothetical protein VITISV_035617 [Vitis vinifera]
Length=355

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KV++RHLPP + +A  +E++++ F GRY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>gb|KDP42459.1| hypothetical protein JCGZ_00256 [Jatropha curcas]
Length=510

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   ++ KVV+RHLPPT+ Q   +E+++  F+GRYNWVSF PGK SQ+ Q+ SRAY++F
Sbjct  1    MKGQSEKTKVVVRHLPPTISQDMFLEQINVAFAGRYNWVSFRPGKNSQRHQSNSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            + PEDVIEFAEFFNGHLFVN
Sbjct  61   RSPEDVIEFAEFFNGHLFVN  80



>emb|CAN72659.1| hypothetical protein VITISV_042717 [Vitis vinifera]
Length=437

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  227  FELPVWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTY  406
             +L +  MK PLDR KV++RHLPP + +A  +E++D+ F  RY  V F PGK SQ++Q+Y
Sbjct  69   LKLGISHMKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSY  128

Query  407  SRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            SRAY++FKRPEDVIEFAEFF+GH+FVN
Sbjct  129  SRAYLDFKRPEDVIEFAEFFDGHVFVN  155



>emb|CBI18294.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KV++RHLPP + +A  +E++D+ F  RY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSYSRAYLDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDVIEFAEFF+GH+FVN
Sbjct  61   KRPEDVIEFAEFFDGHVFVN  80



>ref|XP_006389505.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
 gb|ERP48419.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
Length=511

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSYRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  443  VIEFAEFFNGHLFVN  487
            VI+FAEFFNGHLFVN
Sbjct  67   VIDFAEFFNGHLFVN  81



>ref|XP_008368136.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like [Malus domestica]
Length=575

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MKVPL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKVPLVRTKVLIRHLPPSLSQSDLFHQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_008378738.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Malus domestica]
Length=517

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHIFVN  80



>ref|XP_008378736.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Malus domestica]
Length=524

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHIFVN  80



>ref|XP_008378737.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Malus domestica]
Length=523

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHIFVN  80



>ref|XP_010101271.1| hypothetical protein L484_011635 [Morus notabilis]
 gb|EXB88206.1| hypothetical protein L484_011635 [Morus notabilis]
Length=533

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R K V+R LPP+L Q+ L +++D RFSGRY+W  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLSRTKAVVRRLPPSLSQSDLFQQIDDRFSGRYHWFCFRPGKNSQKHQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             R EDV+EFAEFF+GH+FVN
Sbjct  61   NRAEDVLEFAEFFDGHVFVN  80



>ref|XP_007226163.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
 gb|EMJ27362.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
Length=467

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L  + L++++D + + RYNW  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_010683312.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  ++  E++D RFS RYNW SF PG  S   Q Y RAYV F
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              P+DV EFAEFFNGH+FVN
Sbjct  61   NSPDDVFEFAEFFNGHVFVN  80



>gb|KJB68168.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=452

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   NRPEDVFEFAEFFDGHIFVN  80



>gb|KJB68170.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=459

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   NRPEDVFEFAEFFDGHIFVN  80



>ref|XP_010683306.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  ++  E++D RFS RYNW SF PG  S   Q Y RAYV F
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              P+DV EFAEFFNGH+FVN
Sbjct  61   NSPDDVFEFAEFFNGHVFVN  80



>gb|KJB68172.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=464

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   NRPEDVFEFAEFFDGHIFVN  80



>gb|KJB68169.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
 gb|KJB68171.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=487

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   NRPEDVFEFAEFFDGHIFVN  80



>ref|XP_008219049.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219050.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219051.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
Length=528

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L  + L++++D + + RYNW  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_007024252.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
 gb|EOY26874.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
Length=492

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_007024253.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
 gb|EOY26875.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
Length=450

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>gb|KHG15802.1| Regulator of nonsense transcripts 3A [Gossypium arboreum]
Length=540

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKCSHKQQSYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   NRPEDVFEFAEFFDGHIFVN  80



>ref|XP_007024249.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY26871.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
Length=487

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_007024248.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024250.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024251.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26870.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26872.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26873.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=523

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_010327534.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Solanum lycopersicum]
Length=476

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_006339925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum tuberosum]
Length=482

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_006339922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum tuberosum]
Length=508

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_010327533.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Solanum lycopersicum]
Length=489

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_010327532.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum lycopersicum]
Length=495

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_008459660.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis melo]
Length=506

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   TRPEDVFEFAEFFDGHVFVN  80



>ref|XP_004248850.2| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum lycopersicum]
Length=496

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_008459659.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis melo]
Length=513

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   TRPEDVFEFAEFFDGHVFVN  80



>ref|XP_004141560.1| PREDICTED: uncharacterized protein LOC101208317 [Cucumis sativus]
 ref|XP_004166008.1| PREDICTED: uncharacterized LOC101208317 [Cucumis sativus]
Length=506

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   TRPEDVFEFAEFFDGHVFVN  80



>ref|XP_010542917.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=491

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV EFA FFNGH+FVN
Sbjct  61   KTQEDVYEFATFFNGHVFVN  80



>ref|XP_010542909.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=495

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV EFA FFNGH+FVN
Sbjct  61   KTQEDVYEFATFFNGHVFVN  80



>gb|KGN52703.1| hypothetical protein Csa_5G650630 [Cucumis sativus]
Length=513

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             RPEDV EFAEFF+GH+FVN
Sbjct  61   TRPEDVFEFAEFFDGHVFVN  80



>ref|XP_010327529.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010327530.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
Length=508

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|XP_010542926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=490

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV EFA FFNGH+FVN
Sbjct  61   KTQEDVYEFATFFNGHVFVN  80



>ref|XP_010327531.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum lycopersicum]
Length=507

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  446  IEFAEFFNGHLFVN  487
             EFAEFF+GH+FVN
Sbjct  65   TEFAEFFDGHMFVN  78



>ref|NP_001117406.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 gb|AEE31654.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=484

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSRAYV  421
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK  +  K Q YSRAYV
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSRLGYKNQKYSRAYV  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             FK PEDV EFA FFNGH+FVN
Sbjct  61   SFKAPEDVYEFAAFFNGHVFVN  82



>ref|XP_004975685.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Setaria italica]
 ref|XP_004975686.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Setaria italica]
Length=504

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_010478812.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=484

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_004485448.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004485449.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004485450.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
Length=510

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ + +L   +D  FSGRYNW+SF P KIS K  ++SRAY++F +PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  443  VIEFAEFFNGHLFVN  487
            VIEFAEFFNGH+FVN
Sbjct  63   VIEFAEFFNGHVFVN  77



>ref|XP_010499932.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Camelina sativa]
 ref|XP_010499933.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Camelina sativa]
Length=485

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_009379185.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=523

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDV EFAEFF+GH+FVN
Sbjct  61   KQPEDVFEFAEFFDGHVFVN  80



>ref|XP_009379179.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=524

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDV EFAEFF+GH+FVN
Sbjct  61   KQPEDVFEFAEFFDGHVFVN  80



>ref|XP_004485447.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=517

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ + +L   +D  FSGRYNW+SF P KIS K  ++SRAY++F +PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  443  VIEFAEFFNGHLFVN  487
            VIEFAEFFNGH+FVN
Sbjct  63   VIEFAEFFNGHVFVN  77



>tpg|DAA37690.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=270

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  61   KHPEDVVEFAEVFNGHIFVN  80



>ref|XP_002447880.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
 gb|EES12208.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
Length=504

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>gb|EMT22790.1| Regulator of nonsense transcripts 3A [Aegilops tauschii]
Length=484

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAEFFNGH+FVN
Sbjct  61   KSPEDVVEFAEFFNGHVFVN  80



>ref|XP_006303223.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
 gb|EOA36121.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
Length=311

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P+ + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPVQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYRNQKCSRAYVAF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            + PEDV EFA FFNGH+FVN
Sbjct  61   EEPEDVYEFAAFFNGHVFVN  80



>ref|XP_010463114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=499

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_009421164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=531

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK S+K Q +SRAY+ F
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            +R +DV+EFAEFF+GH+FVN
Sbjct  61   ERSDDVVEFAEFFDGHIFVN  80



>dbj|BAJ94892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  30   MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWARFRPGNASQKNHRYSRLYLNF  89

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAEFFNGH+FVN
Sbjct  90   KSPEDVVEFAEFFNGHVFVN  109



>ref|XP_010096436.1| hypothetical protein L484_013119 [Morus notabilis]
 gb|EXB64107.1| hypothetical protein L484_013119 [Morus notabilis]
Length=534

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVVLRHLPPT+ +A L+E++DS F+GRY+W+SF PGK  QK  ++SRAY++FK+PED
Sbjct  8    DRTKVVLRHLPPTISKAALLERIDSVFAGRYSWLSFRPGKNRQK-HSFSRAYLDFKKPED  66

Query  443  VIEFAEFFNGHLFVN  487
            V+EFAE F GH+FVN
Sbjct  67   VVEFAELFGGHVFVN  81



>ref|XP_011461172.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=498

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+   +++D  F  R+NW  F PGK S K Q YSRAY+EF
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>ref|XP_009421163.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK   DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK S+K Q +SRAY+ F
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            +R +DV+EFAEFF+GH+FVN
Sbjct  61   ERSDDVVEFAEFFDGHIFVN  80



>ref|XP_011461169.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461170.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461171.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KV++RHLPP+L Q+   +++D  F  R+NW  F PGK S K Q YSRAY+EF
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV EFAEFF+GH+FVN
Sbjct  61   KRPEDVFEFAEFFDGHVFVN  80



>emb|CDY52194.1| BnaCnng22070D [Brassica napus]
Length=484

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKDPSAKRKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFSF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  61   KAPEDVYDFAAFFNGHVFVN  80



>ref|XP_008669383.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Zea mays]
Length=499

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  61   KHPEDVVEFAEVFNGHIFVN  80



>tpg|DAA37689.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=500

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  61   KHPEDVVEFAEVFNGHIFVN  80



>ref|XP_011031522.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031524.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031525.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031526.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
Length=524

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +2

Query  245  RMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVE  424
            + K PL R KVV+RHLPP+L Q+ L  + D RF  RYNW  F PG  S K Q YSRAY++
Sbjct  3    KKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHRFCHRYNWFRFRPGNSSHKSQRYSRAYID  62

Query  425  FKRPEDVIEFAEFFNGHLFVN  487
            FK PEDV+EFA+FF+GH+FVN
Sbjct  63   FKNPEDVLEFADFFHGHVFVN  83



>ref|XP_008663219.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Zea mays]
Length=496

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_008663216.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Zea mays]
Length=504

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_008663218.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Zea mays]
Length=502

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_008663221.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Zea mays]
Length=488

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_008663217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Zea mays]
 gb|AFW58318.1| hypothetical protein ZEAMMB73_385077 [Zea mays]
Length=503

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>emb|CAE03133.3| OJ000114_01.14 [Oryza sativa Japonica Group]
Length=455

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  68   KGPEDVVEFAEVFNGHVFVN  87



>ref|XP_008663214.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
 ref|XP_008663215.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
Length=514

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            KRPEDV+EFAE FNGH+FVN
Sbjct  61   KRPEDVVEFAEVFNGHVFVN  80



>ref|XP_010530121.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=494

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  61   KTPEDVCDFASFFNGHVFVN  80



>ref|XP_010530119.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=499

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  61   KTPEDVCDFASFFNGHVFVN  80



>ref|XP_010530120.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=498

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  61   KTPEDVCDFASFFNGHVFVN  80



>ref|NP_001052873.1| Os04g0440100 [Oryza sativa Japonica Group]
 dbj|BAF14787.1| Os04g0440100 [Oryza sativa Japonica Group]
Length=507

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  68   KGPEDVVEFAEVFNGHVFVN  87



>emb|CAH66847.1| H0525C06.10 [Oryza sativa Indica Group]
 gb|EEC77332.1| hypothetical protein OsI_16007 [Oryza sativa Indica Group]
 gb|EEE61056.1| hypothetical protein OsJ_14914 [Oryza sativa Japonica Group]
Length=507

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE FNGH+FVN
Sbjct  68   KGPEDVVEFAEVFNGHVFVN  87



>ref|XP_010239938.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Brachypodium distachyon]
Length=506

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+  
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSSEDVVEFAEFFNGHIFVN  80



>ref|XP_010239939.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Brachypodium distachyon]
Length=505

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+  
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  EDV+EFAEFFNGH+FVN
Sbjct  61   KSSEDVVEFAEFFNGHIFVN  80



>emb|CDY48801.1| BnaA05g20690D [Brassica napus]
Length=476

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FF+GH+FVN
Sbjct  61   KAPEDVYDFAAFFSGHVFVN  80



>ref|XP_009145165.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=480

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FF+GH+FVN
Sbjct  61   KAPEDVYDFAAFFSGHVFVN  80



>ref|XP_009145164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FF+GH+FVN
Sbjct  61   KAPEDVYDFAAFFSGHVFVN  80



>ref|XP_003592906.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=385

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>gb|KHN47094.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=530

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
            +FK P+DV EFAEFF+GH+FVN
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVN  82



>ref|XP_002325958.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
 gb|EEF00340.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
Length=527

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  245  RMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVE  424
            + K PL R KVV+RHLPP+L Q+ L  + D  F  RYNW  F PG  S K Q YSRAY++
Sbjct  3    KKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHLFCHRYNWFRFRPGNSSHKSQRYSRAYID  62

Query  425  FKRPEDVIEFAEFFNGHLFVN  487
            FK PEDV+EFA FF+GH+FVN
Sbjct  63   FKNPEDVLEFAGFFHGHVFVN  83



>ref|XP_006579008.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Glycine max]
Length=493

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
            +FK P+DV EFAEFF+GH+FVN
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVN  82



>ref|XP_003592907.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=498

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>gb|ABE91932.1| Nonsense-mediated decay UPF3 [Medicago truncatula]
Length=500

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>ref|XP_006579007.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=525

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
            +FK P+DV EFAEFF+GH+FVN
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVN  82



>ref|XP_003522607.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006579004.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 ref|XP_006579005.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
 ref|XP_006579006.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=535

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
            +FK P+DV EFAEFF+GH+FVN
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVN  82



>emb|CDY15301.1| BnaC06g07870D [Brassica napus]
Length=473

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + K Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLSESDLLSQIDSRFGDRYYWFSFRPGKSNYKTQKHSRAYFGF  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  62   KAPEDVYDFAAFFNGHVFVN  81



>gb|AES63156.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=510

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>gb|AES63158.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=540

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>ref|XP_006415052.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
 gb|ESQ33405.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
Length=496

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KVV+RHLPP+L Q+ L+ +++ RF  RY W SF PGK S K Q +SRAYV F
Sbjct  1    MKDPSPKRKVVVRHLPPSLSQSDLLSQIEPRFGDRYYWFSFRPGKSSYKNQKFSRAYVGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KAPEDVYEFAAFFNGHVFVN  80



>ref|XP_003592905.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=565

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  443  VIEFAEFFNGHLFVN  487
            VI+FA FFNGHLF+N
Sbjct  62   VIDFAHFFNGHLFLN  76



>ref|XP_009114779.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=462

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  3    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYFGF  62

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  63   KAPEDVYDFASFFNGHVFVN  82



>ref|XP_003527584.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 gb|KHN20546.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=529

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P+DV EFAEFF+GH+FVN
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVN  88



>ref|XP_006582443.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
Length=539

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P+DV EFAEFF+GH+FVN
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVN  88



>ref|XP_009114778.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=479

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  3    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYFGF  62

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  63   KAPEDVYDFASFFNGHVFVN  82



>ref|XP_006582445.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=537

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P+DV EFAEFF+GH+FVN
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVN  88



>ref|XP_006441553.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441554.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441555.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54793.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54794.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54795.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=523

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+P DV EFAE  NGH+FVN
Sbjct  61   KKPADVFEFAELLNGHVFVN  80



>ref|XP_006582442.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
Length=547

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P+DV EFAEFF+GH+FVN
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVN  88



>ref|XP_006582444.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=537

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P+DV EFAEFF+GH+FVN
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVN  88



>emb|CDX93747.1| BnaA09g23470D [Brassica napus]
Length=475

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRAQKHSRAYFGF  61

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV +FA FFNGH+FVN
Sbjct  62   KAPEDVYDFAAFFNGHVFVN  81



>ref|XP_006652316.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Oryza 
brachyantha]
Length=512

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            +K P  R KVVLR LPP +    ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAPQAVVDQVDARFAGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV+EFAE F+GH+FVN
Sbjct  68   KSPEDVVEFAEVFSGHVFVN  87



>gb|KDO45829.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45830.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45831.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45832.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45833.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45834.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45835.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45836.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=523

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+P  V EFAE  NGH+FVN
Sbjct  61   KKPAGVFEFAELLNGHVFVN  80



>ref|XP_006478194.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006478195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Citrus sinensis]
Length=523

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+P  V EFAE  NGH+FVN
Sbjct  61   KKPAGVFEFAELLNGHVFVN  80



>ref|XP_001778894.1| predicted protein [Physcomitrella patens]
 gb|EDQ56344.1| predicted protein [Physcomitrella patens]
Length=1124

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK    R KV +RHLPP+L  A   +++  +++G Y W S+HPGK S K+Q YSRAY+ F
Sbjct  26   MKEQQARTKVSVRHLPPSLAWAVFQDQIAVKYAGTYTWWSYHPGKSSHKRQVYSRAYINF  85

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+PEDVI+F E FNGH+FVN
Sbjct  86   KKPEDVIDFYEDFNGHVFVN  105



>gb|AES68284.2| regulator of nonsense transcripts UPF3 protein [Medicago truncatula]
Length=540

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVV+RHLPP+L ++ LI+ +D+RFS RY+W  F  G  S + Q Y+RAY++F  P+DV
Sbjct  9    RTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYLDFNSPDDV  68

Query  446  IEFAEFFNGHLFVN  487
             EFAEFFNGH+FVN
Sbjct  69   FEFAEFFNGHVFVN  82



>gb|KDP36702.1| hypothetical protein JCGZ_07993 [Jatropha curcas]
Length=536

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  239  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            + + K P +R +VV+RHLPP+L Q  L  + D  FS RYNW  F P K SQK Q YSRAY
Sbjct  2    IMKKKEPSERTRVVIRHLPPSLSQFHLFSQFDHLFSQRYNWFCFRPAKFSQKHQRYSRAY  61

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++FK P DV+EFA+ F+GH+F N
Sbjct  62   IDFKNPGDVLEFADIFHGHIFYN  84



>ref|XP_007148608.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20602.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=529

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F  RYNW SF PG  S K+Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++F  P DV +FA FF+GH+FVN
Sbjct  66   IDFNSPHDVFDFAHFFHGHVFVN  88



>ref|XP_007148607.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20601.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=539

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = +2

Query  245  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  418
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F  RYNW SF PG  S K+Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAY  65

Query  419  VEFKRPEDVIEFAEFFNGHLFVN  487
            ++F  P DV +FA FF+GH+FVN
Sbjct  66   IDFNSPHDVFDFAHFFHGHVFVN  88



>emb|CDY46452.1| BnaA08g06560D [Brassica napus]
Length=491

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK    + KVV+RHLPP+L Q  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSQPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KSPEDVYEFAAFFNGHVFVN  80



>ref|XP_003598033.1| B3 domain-containing protein [Medicago truncatula]
Length=1203

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVV+RHLPP+L ++ LI+ +D+RFS RY+W  F  G  S + Q Y+RAY++F  P+DV
Sbjct  9    RTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYLDFNSPDDV  68

Query  446  IEFAEFFNGHLFVN  487
             EFAEFFNGH+FVN
Sbjct  69   FEFAEFFNGHVFVN  82



>ref|XP_006441556.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54796.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=527

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKI----SQKQQTYSRA  415
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK     S K Q YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  416  YVEFKRPEDVIEFAEFFNGHLFVN  487
            YVE K+P DV EFAE  NGH+FVN
Sbjct  61   YVELKKPADVFEFAELLNGHVFVN  84



>ref|XP_009107941.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=461

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KSPEDVYEFAAFFNGHVFVN  80



>ref|XP_009107940.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=466

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  61   KSPEDVYEFAAFFNGHVFVN  80



>ref|XP_010910224.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=551

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 15/80 (19%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK               
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGK---------------  45

Query  428  KRPEDVIEFAEFFNGHLFVN  487
             + EDV+EFAEFF+GH+FVN
Sbjct  46   NKSEDVVEFAEFFDGHIFVN  65



>emb|CDX91795.1| BnaC08g07140D [Brassica napus]
Length=730

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  240  MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  299

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K PEDV EFA FFNGH+FVN
Sbjct  300  KSPEDVYEFAAFFNGHVFVN  319



>gb|KDO45837.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=527

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKI----SQKQQTYSRA  415
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK     S K Q YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  416  YVEFKRPEDVIEFAEFFNGHLFVN  487
            YVE K+P  V EFAE  NGH+FVN
Sbjct  61   YVELKKPAGVFEFAELLNGHVFVN  84



>ref|XP_002972412.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
 gb|EFJ26498.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
Length=118

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+R LPPTL +  L+ ++ +RF+  Y W+ F PGK +   Q +SRAY+EF
Sbjct  1    MKDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKST--NQIHSRAYIEF  58

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            +RPEDV+ F E F+GH+FVN
Sbjct  59   ERPEDVLAFHEDFHGHVFVN  78



>ref|XP_002984244.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
 gb|EFJ14754.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
Length=118

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            M+ PL R KVV+R LPPTL +  L+ ++ +RF+  Y W+ F PGK +   Q +SRAY+EF
Sbjct  1    MRDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKST--NQIHSRAYIEF  58

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            +RPEDV+ F E F+GH+FVN
Sbjct  59   ERPEDVLAFHEDFHGHVFVN  78



>ref|XP_006441789.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
 gb|ESR55029.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
Length=103

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKI-----SQKQQTYSR  412
            MK PL R KVV+RHLP +L Q  L+      F+  YNW +F P  +     S K QTYSR
Sbjct  1    MKKPLQRTKVVIRHLPLSLSQNDLLALFHDHFNDHYNWSTFGPENLGIFFNSYKHQTYSR  60

Query  413  AYVEFKRPEDVIEFAEFFNGHLFVN  487
            A  E K+P DV EFAE  NGH+FVN
Sbjct  61   ACEELKKPTDVFEFAELLNGHVFVN  85



>ref|XP_001754467.1| predicted protein [Physcomitrella patens]
 gb|EDQ80917.1| predicted protein [Physcomitrella patens]
Length=987

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 59/106 (56%), Gaps = 26/106 (25%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------------  382
            MK    R KV +RHLPP+L +A   +++  +++G Y W S+HPGK               
Sbjct  26   MKEQQARTKVAVRHLPPSLSEAVFQDQIAGKYAGAYTWWSYHPGKNRSSRKRRQYVAHNP  85

Query  383  -----------ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
                        S K+Q YSRAY+ FK+PEDVI+F E FNGH+FVN
Sbjct  86   RNQFDAVGAIACSHKRQVYSRAYINFKKPEDVIDFYEDFNGHVFVN  131



>ref|XP_006478236.1| PREDICTED: uncharacterized protein LOC102612273 [Citrus sinensis]
Length=233

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  272  KVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVIE  451
            ++V+RHLPP+L Q  L+      F+ RYNW  F PG+ S K Q YSRAY E K P  V E
Sbjct  36   QLVIRHLPPSLSQNDLLALFHDHFNDRYNWFCFRPGRSSSKHQRYSRAYEELKNPAVVFE  95

Query  452  FAEFFNGHLFVN  487
            FAE  NGH+FVN
Sbjct  96   FAELLNGHVFVN  107



>gb|KIY98106.1| hypothetical protein MNEG_9858, partial [Monoraphidium neglectum]
Length=149

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            M  P +R KVV+R+LPP L +  L   VD    GRY W +++PGK+S ++  +SRAY +F
Sbjct  1    MTKPQERTKVVVRNLPPALTEEALRAVVDKIVGGRYGWSAYYPGKVSLRRTLHSRAYFDF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
              P+DVIEF   F+GH+FV+
Sbjct  61   LTPDDVIEFKTRFDGHVFVS  80



>ref|XP_006441573.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
 gb|ESR54813.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
Length=90

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK PL R KVV+RHLPP+L Q  L+      F+ RYN           K +TYSR Y E 
Sbjct  1    MKKPLQRTKVVIRHLPPSLSQNDLLALFHDHFNDRYNCF---------KHETYSRTYEEL  51

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K+P DV EFAE  NGH+FVN
Sbjct  52   KKPTDVFEFAELLNGHVFVN  71



>ref|XP_004499559.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
Length=570

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             F  P+DV +FA+FFNGH+FVN
Sbjct  61   NFNSPDDVFDFADFFNGHVFVN  82



>ref|XP_004499558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=572

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             F  P+DV +FA+FFNGH+FVN
Sbjct  61   NFNSPDDVFDFADFFNGHVFVN  82



>ref|XP_004499561.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
 ref|XP_004499562.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Cicer arietinum]
Length=567

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             F  P+DV +FA+FFNGH+FVN
Sbjct  61   NFNSPDDVFDFADFFNGHVFVN  82



>ref|XP_004499563.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Cicer arietinum]
 ref|XP_004499564.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X7 [Cicer arietinum]
 ref|XP_004499565.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X8 [Cicer arietinum]
Length=535

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             F  P+DV +FA+FFNGH+FVN
Sbjct  61   NFNSPDDVFDFADFFNGHVFVN  82



>ref|XP_004499560.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
Length=568

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query  248  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  421
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  422  EFKRPEDVIEFAEFFNGHLFVN  487
             F  P+DV +FA+FFNGH+FVN
Sbjct  61   NFNSPDDVFDFADFFNGHVFVN  82



>ref|XP_002945932.1| hypothetical protein VOLCADRAFT_48819 [Volvox carteri f. nagariensis]
 gb|EFJ52927.1| hypothetical protein VOLCADRAFT_48819 [Volvox carteri f. nagariensis]
Length=90

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  269  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  448
             KVV+R+LPP +   T    ++S   GRY W+S+ PGK+S K+  +SRAYV F   EDV 
Sbjct  1    TKVVIRNLPPGMTDDTFKTVLESLAGGRYTWLSYFPGKVSLKRVVFSRAYVNFLTAEDVY  60

Query  449  EFAEFFNGHLFVN  487
            +F + F+GH+F+ 
Sbjct  61   DFKQRFDGHVFIG  73



>ref|XP_001691099.1| UPF3 protein [Chlamydomonas reinhardtii]
 gb|EDP05545.1| UPF3 protein [Chlamydomonas reinhardtii]
Length=371

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  427
            MK P  + KV++R LPP + + T    +DS  +GRYNW+S++ GK+S K+   SRAY+ F
Sbjct  1    MKPPRQKTKVLVRKLPPAMSEDTFKSVLDSVAAGRYNWLSYYAGKVSLKRVASSRAYINF  60

Query  428  KRPEDVIEFAEFFNGHLFVN  487
               EDV  F + F+GH+F++
Sbjct  61   VSEEDVYNFKQRFDGHVFIS  80



>ref|XP_002510770.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52957.1| conserved hypothetical protein [Ricinus communis]
Length=423

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  272  KVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVIE  451
            KVV+RHLPP+L Q+ L  +        +NW  F P   S K   YSRAY+EFK P D  +
Sbjct  14   KVVIRHLPPSLSQSHLFSQFHHLLLLSFNWFCFRPPNSSHKNHRYSRAYIEFKSPADAGQ  73

Query  452  FAEFFNGHLFVN  487
            FA  F+GHLFV+
Sbjct  74   FAHLFHGHLFVD  85



>gb|AFK46637.1| unknown [Lotus japonicus]
Length=57

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHP-GKI  385
            LDR KVVLRHLPPTL QA+L+ ++D+ F GRYNW+SF P GK+
Sbjct  2    LDRTKVVLRHLPPTLSQASLVAQIDAAFLGRYNWLSFCPAGKV  44



>ref|XP_011395745.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
 gb|KFM22879.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
Length=475

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  442
            +R KVV+RHLPP+L +      V      R NW +++ GK+S K+  +SRAY+ FK P D
Sbjct  6    ERTKVVVRHLPPSLSEDAFKSAVQEWLD-RSNWSAYYQGKVSAKEHVHSRAYLNFKDPAD  64

Query  443  VIEFAEFFNGHLFVN  487
             + F+  FNG+LFV+
Sbjct  65   ALRFSAAFNGNLFVS  79



>ref|XP_008378998.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Malus 
domestica]
Length=607

 Score = 62.4 bits (150),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  386  SQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            SQK Q+YSRAY++ KRPEDV +FAEFF+GHLFVN
Sbjct  84   SQKNQSYSRAYIDLKRPEDVFDFAEFFDGHLFVN  117


 Score = 29.3 bits (64),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 0/51 (0%)
 Frame = +1

Query  250  EGSFGSSQSGVAALAAHTSAGYAHRES*FSLLRSLQLGLFPPWKNQPETTN  402
            EG  GS+Q G + LAA   A  A   +   L   LQLG F  W+ +    N
Sbjct  37   EGPVGSNQGGASTLAAFDFASCACGANRRFLCWPLQLGCFSSWQEERSQKN  87



>emb|CCJ29190.1| unnamed protein product [Pneumocystis jirovecii]
Length=395

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  257  PLDRAKVVLRHLPPTLPQATLIEKVDSRFSG-RYNWVSFHPGKIS---QKQQTYSRAYVE  424
            P  R KVV+R+LPP L + T  E V       R  W SF+PGK+S    K   Y+RAY++
Sbjct  19   PATRLKVVIRYLPPDLSEQTFKELVKEWIDEERVEWSSFYPGKVSSNRNKNDKYARAYIK  78

Query  425  FKRPEDVIEFAEFFNGHLFVN  487
            FK PE +I F + F  HLF +
Sbjct  79   FKSPEALIAFHKGFGAHLFTD  99



>ref|XP_008352807.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like, partial [Malus domestica]
Length=532

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  383  ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
             SQK Q YSRAY++FKRPEDV EFAEFF+GH+FVN
Sbjct  2    CSQKNQRYSRAYIDFKRPEDVFEFAEFFDGHVFVN  36



>ref|XP_005644501.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19957.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
Length=382

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPE  439
            ++R KVV+R LPP++  A + E VDS  + +YNW SF  GK S ++  +SR YV F+ P 
Sbjct  1    MERTKVVIRKLPPSIADADVRELVDS-TNVKYNWFSFVQGKTSVRKVVHSRCYVNFEDPS  59

Query  440  DVIEFAEFFNGHLFVN  487
            D+  F      H FV 
Sbjct  60   DIPAFKAAVEAHAFVT  75



>ref|XP_005851259.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
 gb|EFN59157.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
Length=119

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            R KVV+R LPP+L +      V   +  R +W S+  GK S K   +SRAY+ FK   DV
Sbjct  6    RCKVVVRRLPPSLQEEAFRGAV-REWIERADWFSYVQGKASSKDLLHSRAYLRFKDAADV  64

Query  446  IEFAEFFNGHLFVN  487
              F + ++GH FVN
Sbjct  65   PRFQQAWDGHAFVN  78



>gb|KHN22614.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=148

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 30/103 (29%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNW-VSFHPGK-------------------  382
            ++ KVV+RHL P+L  +        RFS R++  +   P +                   
Sbjct  8    EKTKVVIRHLSPSLTLSDFFPT--HRFSLRFSLQLVLLPSRQQQVITIQTLPVCSLCNPN  65

Query  383  --------ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
                     S K+Q +SRAY++FK P+DV EF EFF+GH+FVN
Sbjct  66   KSLIIIIICSHKRQMHSRAYIDFKCPDDVFEFTEFFDGHVFVN  108



>gb|EMS47492.1| Regulator of nonsense transcripts 3A [Triticum urartu]
Length=509

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  377  GKISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            G  SQK   YSR Y+ FK PEDV+EFAEFFNGH+FVN
Sbjct  46   GVKSQKNHRYSRLYLNFKSPEDVVEFAEFFNGHVFVN  82



>gb|EPZ31303.1| Nucleotide-binding, alpha-beta plait domain-containing protein 
[Rozella allomycis CSF55]
Length=217

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  445
            ++K+V+R+LPP+L + T ++ + +       W ++    +S K + +S AY+ FK  E V
Sbjct  9    KSKIVVRYLPPSLTEETFLKTISAHLPN-VTWKTYLKDNLSVKGKKFSIAYLNFKTEESV  67

Query  446  IEFAEFFNGHLFVN  487
            + FA+ F+GH+FV+
Sbjct  68   LNFAKEFDGHVFVD  81



>emb|CCO28851.1| putative WD repeat-containing protein C1672,07 [Rhizoctonia solani 
AG-1 IB]
Length=759

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQK---QQTYSRAYVEFKR  433
            + KVV+R LPP LP+    + V    +    NW  + PGK+  K   + T SRAYVEF  
Sbjct  645  KLKVVIRRLPPNLPENIFWQSVAQWVTDETSNWKLYVPGKLRTKLNRENTPSRAYVEFVT  704

Query  434  PEDVIEFAEFFNGHLF  481
            PE VI F   +NGH+F
Sbjct  705  PEAVITFNRDYNGHVF  720



>gb|ESA18168.1| hypothetical protein GLOINDRAFT_144398, partial [Rhizophagus 
irregularis DAOM 181602]
Length=270

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGR-YNWVSFHPGKISQ---KQQTYSRAYVEF  427
            + + KVV+R LPP +P++   E V    +     W  FH G+IS+   K+  +SRAY  F
Sbjct  25   VTKTKVVVRRLPPLIPESLFFESVKQWVNEETCTWSRFHQGRISKSKNKESIFSRAYFHF  84

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  E V+EF   ++ HLF++
Sbjct  85   KTVEQVLEFHRGYDNHLFID  104



>ref|XP_007872945.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
 gb|EMR10886.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
Length=410

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKIS---QKQQTYSRAYVEFKRP  436
            R KVV+R+LP  L +      V    S    W SF PGKIS    K   + RAY++FK P
Sbjct  22   RLKVVVRYLPCNLSEQEFKNSVKEWISEEIEWFSFFPGKISTNRSKNDRHGRAYIKFKSP  81

Query  437  EDVIEFAEFFNGHLFVN  487
            E +I F +  N HLF +
Sbjct  82   EALITFYKGINKHLFTD  98



>emb|CAX18772.1| UPF3 regulator of nonsense transcripts homolog A (yeast) [Danio 
rerio]
Length=155

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  269  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  448
            +KVV+R LPP+L +  L E +    S  +++  F P   S     +SRAY+ FK PED+I
Sbjct  43   SKVVIRRLPPSLSKDQLQEHLSPLPS--FDYFEFFPADQSLYPHLFSRAYINFKNPEDII  100

Query  449  EFAEFFNGHLFVN  487
             F + F+G++F++
Sbjct  101  IFRDRFDGYVFID  113



>ref|XP_008339206.1| PREDICTED: zinc transporter ZTP29-like [Malus domestica]
Length=188

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSF  370
            MKVPL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F
Sbjct  1    MKVPLVRTKVLIRHLPPSLSQSDLFHQIDHLLADRYNWLCF  41



>emb|CEL51964.1| hypothetical protein RSOLAG1IB_00501 [Rhizoctonia solani AG-1 
IB]
Length=440

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +2

Query  272  KVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQK---QQTYSRAYVEFKRPE  439
            KVV+R LPP LP+    + V    +    NW  + PGK+  K   + T SRAYVEF  PE
Sbjct  32   KVVIRRLPPNLPENIFWQSVAQWVTDETSNWKLYVPGKLRTKLNRENTPSRAYVEFVTPE  91

Query  440  DVIEFAEFFNGHLF  481
             VI F   +NGH+F
Sbjct  92   AVITFNRDYNGHVF  105



>ref|XP_010930558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=543

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +2

Query  362  VSFHPGKIS----QKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            V  H G+ S     K Q YSRAY+ FKR EDV+EFAE F+GH+FVN
Sbjct  3    VGCHEGRTSPVWCHKNQRYSRAYLNFKRLEDVVEFAELFDGHIFVN  48



>gb|AAH95761.1| Upf3a protein [Danio rerio]
Length=201

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  269  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  448
            +KVV+R LPP+L +  L E +    S  +++  F P   S     +SRAY+ FK PED+I
Sbjct  43   SKVVIRRLPPSLSKDQLQEHLSPLPS--FDYFEFFPADQSLYPHLFSRAYINFKNPEDII  100

Query  449  EFAEFFNGHLFVN  487
             F + F+G++F++
Sbjct  101  IFRDRFDGYVFID  113



>gb|KDN51831.1| hypothetical protein RSAG8_00380, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=333

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  433
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  30   RLKVVIRRLPPNLPENIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  89

Query  434  PEDVIEFAEFFNGHLF  481
            PE ++ F   +NGH+F
Sbjct  90   PEAIVVFNRGYNGHVF  105



>ref|XP_006676092.1| hypothetical protein BATDEDRAFT_84963 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83414.1| hypothetical protein BATDEDRAFT_84963 [Batrachochytrium dendrobatidis 
JAM81]
Length=510

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  254  VPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQK---QQTYSRAYVE  424
             P  R K+V+R LPPTLP+      + S++    +W  +  GK+++K   Q  +SRAY+ 
Sbjct  55   TPKLRTKIVVRRLPPTLPRDAFFNTI-SKWLDYIDWSEYVSGKLAKKLAKQNVFSRAYLN  113

Query  425  FKRPEDVIEFAEFFNGHLFVN  487
            F   + V++F +  NGHLFV+
Sbjct  114  FIDCDSVLDFFKSCNGHLFVD  134



>gb|EJU05580.1| hypothetical protein DACRYDRAFT_104067 [Dacryopinax sp. DJM-731 
SS1]
Length=469

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +2

Query  254  VPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGR-YNWVSFHPGKISQK---QQTYSRAYV  421
            V   R KV++R LPP LP+A   + V+   +     W  F+ GKI  K   +   SRAY+
Sbjct  36   VSATRLKVIVRRLPPNLPEAVFWKSVEPWVNEENTTWRIFYSGKIKPKLENENVPSRAYI  95

Query  422  EFKRPEDVIEFAEFFNGHLF  481
             FK PE V +F+  +NGH F
Sbjct  96   MFKTPEQVAQFSSAYNGHAF  115



>gb|EUC62084.1| Smg-4/UPF3 family protein [Rhizoctonia solani AG-3 Rhs1AP]
Length=821

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  433
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  384  RLKVVVRRLPPNLPETIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  443

Query  434  PEDVIEFAEFFNGHLF  481
            PE V+ F   +NGH+F
Sbjct  444  PEAVVVFNRDYNGHVF  459



>gb|KEP50606.1| Smg-4/UPF3 family protein [Rhizoctonia solani 123E]
Length=821

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +2

Query  266  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  433
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  384  RLKVVVRRLPPNLPETIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  443

Query  434  PEDVIEFAEFFNGHLF  481
            PE V+ F   +NGH+F
Sbjct  444  PEAVVVFNRDYNGHVF  459



>ref|XP_010930557.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=558

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  392  KQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVN  487
            K Q YSRAY+ FKR EDV+EFAE F+GH+FVN
Sbjct  32   KNQRYSRAYLNFKRLEDVVEFAELFDGHIFVN  63



>ref|XP_011501641.1| PREDICTED: regulator of nonsense transcripts 3A [Ceratosolen 
solmsi marchali]
Length=657

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  272  KVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVIE  451
            KVV+R LPPT+ Q   +E+V       YN++ F    +S  Q  YSRAY++F   +D+  
Sbjct  45   KVVIRRLPPTMTQEQFLEQVSPL--PEYNYMYFAKADMSLGQYAYSRAYIDFIDQQDIFG  102

Query  452  FAEFFNGHLFVN  487
            F E F+ ++FV+
Sbjct  103  FREKFDNYVFVD  114



>gb|EXX69496.1| hypothetical protein RirG_095570 [Rhizophagus irregularis DAOM 
197198w]
Length=548

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQ---KQQTYSRAYVEF  427
            + + KVV+R LPP +P++   E V    +     W  FH G+IS+   K+  +SRAY  F
Sbjct  25   VTKTKVVVRRLPPLIPESLFFESVKQWVNEETCTWSRFHQGRISKSKNKESIFSRAYFHF  84

Query  428  KRPEDVIEFAEFFNGHLFVN  487
            K  E V+EF   ++ HLF++
Sbjct  85   KTVEQVLEFHRGYDNHLFID  104



>gb|KIM41523.1| hypothetical protein M413DRAFT_445507 [Hebeloma cylindrosporum 
h7]
Length=127

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +2

Query  257  PLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVE  424
            P +R K V+R LPP LP+    + V    +     W  F+PGK+ +K   +   SRAY+ 
Sbjct  28   PNERLKTVVRRLPPNLPEEVFWQSVQPWVTEDTAVWKVFYPGKLRKKLNKENIPSRAYIA  87

Query  425  FKRPEDVIEFAEFFNGHLF  481
            FK  E +  F+  ++GH+F
Sbjct  88   FKNEEQLASFSRGYDGHIF  106



>ref|XP_007263451.1| hypothetical protein FOMMEDRAFT_165771 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD05305.1| hypothetical protein FOMMEDRAFT_165771 [Fomitiporia mediterranea 
MF3/22]
Length=522

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQK---QQTYSRAYVEF  427
            +DR K V+R LPP LP+    + V    +    +W +F+ GK+ +K   + T SRAY+ F
Sbjct  35   VDRLKAVVRRLPPNLPEDVFWQSVQPWVTDESVSWRTFYSGKVRKKYNKENTPSRAYIAF  94

Query  428  KRPEDVIEFAEFFNGHLF  481
            K  E +  F++ ++GH+F
Sbjct  95   KTAEQLATFSQAYDGHIF  112



>gb|KIJ64775.1| hypothetical protein HYDPIDRAFT_28135 [Hydnomerulius pinastri 
MD-312]
Length=470

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +2

Query  263  DRAKVVLRHLPPTLPQATLIEKVDSRFSG-RYNWVSFHPGKISQ---KQQTYSRAYVEFK  430
            +R K V+R LPP LP+    + V +  +     W +FHPGK+ +   K+   SRAY+ FK
Sbjct  28   ERIKTVVRRLPPNLPEEIFWQSVQAWVTDDTVTWKAFHPGKLRKRVNKESLPSRAYIAFK  87

Query  431  RPEDVIEFAEFFNGHLF  481
              E +  F+  ++GHLF
Sbjct  88   NEEQLATFSREYDGHLF  104



>ref|XP_010738428.1| PREDICTED: regulator of nonsense transcripts 3A [Larimichthys 
crocea]
Length=468

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +2

Query  269  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  448
             KVVLR LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVLRRLPPNLSKEQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKSPEDIL  103

Query  449  EFAEFFNGHLFVN  487
             F + F+G++F++
Sbjct  104  LFRDRFDGYVFID  116



>gb|KIK61351.1| hypothetical protein GYMLUDRAFT_58885 [Gymnopus luxurians FD-317 
M1]
Length=529

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +2

Query  260  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGR-YNWVSFHPGKISQ---KQQTYSRAYVEF  427
            L+R K V+R LPP LP+    + V +  + +   W +++PGK+     K+   SRAY+ F
Sbjct  42   LERLKTVVRKLPPNLPEEIFWQSVQTWVTEQTVTWKAYYPGKLRNSPNKENVPSRAYIAF  101

Query  428  KRPEDVIEFAEFFNGHLF  481
            K  E +  F+  ++GHLF
Sbjct  102  KNEEQLALFSREYDGHLF  119



>ref|XP_010903997.1| PREDICTED: regulator of nonsense transcripts 3A isoform X2 [Esox 
lucius]
Length=486

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  269  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  448
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKDQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKNPEDIL  103

Query  449  EFAEFFNGHLFVN  487
             F++ F+G++F++
Sbjct  104  LFSDRFDGYVFID  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960