BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024K14

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             187   2e-60   Nicotiana tomentosiformis
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        187   2e-60   Nicotiana tomentosiformis
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        187   3e-60   Nicotiana sylvestris
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        186   9e-60   Nicotiana tomentosiformis
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         183   2e-59   Jatropha curcas
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        182   4e-59   Nicotiana sylvestris
ref|XP_002301485.1|  60S ribosomal protein L18                          181   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        182   1e-58   Nicotiana tomentosiformis
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             180   2e-58   Eucalyptus grandis [rose gum]
ref|NP_001237789.1|  uncharacterized protein LOC100500164               181   3e-58   Glycine max [soybeans]
gb|KHN20393.1|  60S ribosomal protein L18-2                             180   4e-58   Glycine soja [wild soybean]
gb|KJB41868.1|  hypothetical protein B456_007G127300                    182   4e-58   Gossypium raimondii
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        179   4e-58   Populus euphratica
ref|XP_002320999.1|  60S ribosomal protein L18                          178   6e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        178   7e-58   Solanum lycopersicum
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        178   7e-58   Solanum tuberosum [potatoes]
gb|KJB45330.1|  hypothetical protein B456_007G301700                    181   8e-58   Gossypium raimondii
gb|KJB41867.1|  hypothetical protein B456_007G127300                    181   8e-58   Gossypium raimondii
gb|KJB45331.1|  hypothetical protein B456_007G301700                    181   9e-58   Gossypium raimondii
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       180   1e-57   Gossypium arboreum [tree cotton]
gb|KJB82632.1|  hypothetical protein B456_013G206100                    181   1e-57   Gossypium raimondii
ref|NP_001236701.1|  uncharacterized protein LOC100306301               177   2e-57   
gb|KHN43503.1|  60S ribosomal protein L18-2                             177   2e-57   Glycine soja [wild soybean]
ref|XP_007031040.1|  Ribosomal protein L18                              180   3e-57   Theobroma cacao [chocolate]
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    180   3e-57   
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        177   3e-57   Glycine max [soybeans]
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             176   3e-57   Phaseolus vulgaris [French bean]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       180   3e-57   Cucumis sativus [cucumbers]
emb|CDP17112.1|  unnamed protein product                                175   4e-57   Coffea canephora [robusta coffee]
gb|KJB23304.1|  hypothetical protein B456_004G091200                    179   4e-57   Gossypium raimondii
ref|XP_002523106.1|  60S ribosomal protein L18, putative                176   4e-57   Ricinus communis
emb|CBI39539.3|  unnamed protein product                                176   5e-57   Vitis vinifera
gb|KJB23303.1|  hypothetical protein B456_004G091200                    179   5e-57   Gossypium raimondii
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             176   5e-57   Phaseolus vulgaris [French bean]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    180   6e-57   Gossypium raimondii
ref|NP_001236071.1|  uncharacterized protein LOC100499789               176   8e-57   Glycine max [soybeans]
ref|XP_006382454.1|  60S ribosomal protein L18                          177   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             177   1e-56   Populus euphratica
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       177   1e-56   Gossypium arboreum [tree cotton]
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         174   1e-56   Jatropha curcas
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        173   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        176   2e-56   Vitis vinifera
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             177   2e-56   Cucumis melo [Oriental melon]
gb|KHN20252.1|  60S ribosomal protein L18-3                             177   2e-56   Glycine soja [wild soybean]
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             173   3e-56   Populus euphratica
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             174   3e-56   Phaseolus vulgaris [French bean]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        172   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        172   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    176   4e-56   
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             175   4e-56   Vitis vinifera
ref|XP_002512455.1|  60S ribosomal protein L18, putative                171   4e-56   
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    176   4e-56   Theobroma cacao [chocolate]
gb|AFK49563.1|  unknown                                                 175   4e-56   Lotus japonicus
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             175   5e-56   Eucalyptus grandis [rose gum]
gb|KHN03962.1|  60S ribosomal protein L18-2                             173   5e-56   Glycine soja [wild soybean]
emb|CDO98841.1|  unnamed protein product                                176   5e-56   Coffea canephora [robusta coffee]
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             175   6e-56   Sesamum indicum [beniseed]
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        172   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        174   6e-56   Cucumis sativus [cucumbers]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             174   7e-56   Cucumis melo [Oriental melon]
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        174   9e-56   Sesamum indicum [beniseed]
ref|XP_002319502.1|  60S ribosomal protein L18                          171   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        172   1e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK92688.1|  unknown                                                 171   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             172   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             171   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010088293.1|  60S ribosomal protein L18-3                        177   2e-55   
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        173   3e-55   Solanum tuberosum [potatoes]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             169   3e-55   
emb|CBI36879.3|  unnamed protein product                                171   5e-55   Vitis vinifera
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   5e-55   
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             171   5e-55   Prunus persica
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             172   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          169   6e-55   Cicer arietinum [garbanzo]
emb|CDY40718.1|  BnaC03g34340D                                          171   7e-55   Brassica napus [oilseed rape]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   7e-55   Malus domestica [apple tree]
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   8e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   1e-54   Elaeis guineensis
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             171   1e-54   Nelumbo nucifera [Indian lotus]
emb|CBI22977.3|  unnamed protein product                                175   1e-54   Vitis vinifera
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             170   1e-54   Vitis vinifera
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             170   2e-54   Pyrus x bretschneideri [bai li]
emb|CDX74138.1|  BnaA03g29090D                                          170   2e-54   
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             169   2e-54   Prunus persica
ref|XP_010094463.1|  60S ribosomal protein L18-2                        174   2e-54   
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             169   2e-54   Malus domestica [apple tree]
ref|XP_003591163.1|  Ribosomal protein L18                              169   2e-54   Medicago truncatula
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             169   3e-54   
gb|AFK45456.1|  unknown                                                 167   3e-54   Lotus japonicus
gb|KEH24393.1|  60S ribosomal protein L18-3                             167   3e-54   Medicago truncatula
gb|AFK34017.1|  unknown                                                 167   3e-54   Medicago truncatula
ref|XP_010104147.1|  60S ribosomal protein L18-2                        174   3e-54   
gb|ACJ85943.1|  unknown                                                 167   3e-54   Medicago truncatula
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             171   3e-54   Capsella rubella
emb|CDY18813.1|  BnaAnng02780D                                          170   4e-54   Brassica napus [oilseed rape]
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             170   5e-54   Brassica rapa
gb|KJB82634.1|  hypothetical protein B456_013G206100                    169   5e-54   Gossypium raimondii
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        180   6e-54   Nicotiana sylvestris
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             167   6e-54   
ref|XP_002874343.1|  60S ribosomal protein L18                          167   7e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             171   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             169   7e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        170   7e-54   Camelina sativa [gold-of-pleasure]
gb|AAO46881.1|  60S ribosomal protein                                   166   7e-54   Medicago sativa [alfalfa]
ref|NP_187210.1|  60S ribosomal protein L18-2                           169   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        170   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    176   1e-53   
ref|NP_198137.1|  60S ribosomal protein L18-3                           166   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235897.1|  uncharacterized protein LOC100527681               168   1e-53   
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    168   2e-53   
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       168   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             170   2e-53   Elaeis guineensis
gb|EMS45435.1|  60S ribosomal protein L18-2                             167   2e-53   Triticum urartu
gb|ABK26318.1|  unknown                                                 166   3e-53   Picea sitchensis
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             166   4e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             170   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             169   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             167   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        166   5e-53   Brassica rapa
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             167   6e-53   Phoenix dactylifera
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        169   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          165   1e-52   Sorghum bicolor [broomcorn]
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        167   1e-52   Phoenix dactylifera
gb|EMT12638.1|  60S ribosomal protein L18-2                             164   1e-52   
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        167   2e-52   Phoenix dactylifera
ref|XP_006433452.1|  hypothetical protein CICLE_v10002597mg             176   2e-52   
gb|ABK21809.1|  unknown                                                 164   2e-52   Picea sitchensis
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        164   2e-52   
gb|ADD54595.1|  putative ribosomal protein L18                          175   2e-52   Linum usitatissimum
emb|CDY05559.1|  BnaA02g31320D                                          162   2e-52   
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             166   3e-52   Elaeis guineensis
emb|CDY66803.1|  BnaAnng22990D                                          162   3e-52   Brassica napus [oilseed rape]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             176   3e-52   Citrus clementina [clementine]
emb|CDX99969.1|  BnaC09g03320D                                          161   3e-52   
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          167   3e-52   Amborella trichopoda
emb|CDX80616.1|  BnaC07g28280D                                          162   3e-52   
emb|CDY19736.1|  BnaA09g03890D                                          161   3e-52   Brassica napus [oilseed rape]
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        162   3e-52   Brassica rapa
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             161   4e-52   Brassica rapa
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        161   5e-52   Brassica rapa
emb|CDY25018.1|  BnaC02g39900D                                          160   6e-52   Brassica napus [oilseed rape]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        169   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        162   8e-52   
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          175   9e-52   Cicer arietinum [garbanzo]
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          162   1e-51   Sorghum bicolor [broomcorn]
gb|ABK22247.1|  unknown                                                 160   1e-51   Picea sitchensis
ref|XP_006840598.1|  hypothetical protein AMTR_s00343p00015240          165   1e-51   
gb|EPS67068.1|  hypothetical protein M569_07709                         163   1e-51   Genlisea aurea
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        161   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_001781485.1|  predicted protein                                  162   2e-51   
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             159   2e-51   Capsella rubella
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        159   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    159   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001131538.1|  uncharacterized protein LOC100192878               160   2e-51   Zea mays [maize]
ref|XP_001760902.1|  predicted protein                                  162   3e-51   
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    164   3e-51   
ref|NP_001050069.1|  Os03g0341100                                       160   4e-51   
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    160   4e-51   Arabis alpina [alpine rockcress]
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        162   5e-51   
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        157   1e-50   
ref|NP_001132852.1|  uncharacterized protein LOC100194344               157   2e-50   Zea mays [maize]
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        160   2e-50   Oryza brachyantha
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                161   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        172   2e-50   Glycine max [soybeans]
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                155   4e-50   Phaseolus vulgaris [French bean]
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  156   4e-50   Miscanthus sinensis
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             154   4e-50   Nicotiana tomentosiformis
gb|AFW77276.1|  hypothetical protein ZEAMMB73_917876                    156   4e-50   
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          156   4e-50   Sorghum bicolor [broomcorn]
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 156   8e-50   Ostreococcus tauri
gb|KDO39192.1|  hypothetical protein CISIN_1g030771mg                   169   1e-49   Citrus sinensis [apfelsine]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        155   1e-49   Setaria italica
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             169   1e-49   Citrus clementina [clementine]
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    155   2e-49   Triticum aestivum [Canadian hard winter wheat]
gb|EMT18368.1|  60S ribosomal protein L18-2                             155   2e-49   
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        158   2e-49   Oryza brachyantha
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    152   2e-49   Tarenaya hassleriana [spider flower]
dbj|BAJ90421.1|  predicted protein                                      155   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             152   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        154   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        154   5e-49   Oryza brachyantha
gb|EMS65848.1|  60S ribosomal protein L18-2                             157   7e-49   Triticum urartu
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    153   7e-49   Ostreococcus lucimarinus CCE9901
emb|CDY05183.1|  BnaC05g46200D                                          167   9e-49   
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        151   9e-49   Setaria italica
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    167   1e-48   Arabis alpina [alpine rockcress]
ref|NP_001060617.1|  Os07g0674700                                       154   2e-48   
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             151   2e-48   Solanum lycopersicum
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    157   2e-48   Chlamydomonas reinhardtii
ref|NP_001054688.1|  Os05g0155100                                       151   3e-48   
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          165   4e-48   
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        152   1e-47   Nicotiana tomentosiformis
gb|KJB26287.1|  hypothetical protein B456_004G239000                    148   1e-47   Gossypium raimondii
gb|ABA26976.1|  TO23-2rc                                                160   2e-47   Taraxacum officinale [dandelion]
gb|KIZ05100.1|  60S ribosomal protein L18-3                             153   7e-47   Monoraphidium neglectum
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    148   7e-47   Arabis alpina [alpine rockcress]
ref|XP_003626231.1|  60S ribosomal protein L18                          162   9e-47   Medicago truncatula
ref|XP_001751734.1|  predicted protein                                  161   2e-46   
ref|XP_007510670.1|  predicted protein                                  155   4e-46   Bathycoccus prasinos
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                157   3e-45   Miscanthus sinensis
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             150   3e-45   Fragaria vesca subsp. vesca
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             140   3e-45   Selaginella moellendorffii
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             140   3e-45   Selaginella moellendorffii
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    147   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       139   7e-45   Gossypium arboreum [tree cotton]
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                139   8e-45   Erythranthe guttata [common monkey flower]
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              149   9e-45   Chlorella variabilis
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        156   1e-44   
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         156   1e-44   Cicer arietinum [garbanzo]
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    156   1e-44   Volvox carteri f. nagariensis
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    145   2e-44   Coccomyxa subellipsoidea C-169
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082    160   2e-44   
dbj|BAJ93091.1|  predicted protein                                      156   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBK21900.2|  Ribosomal protein L18e                                 153   9e-44   Blastocystis hominis
ref|XP_001760959.1|  predicted protein                                  154   1e-43   
ref|XP_001785869.1|  predicted protein                                  153   3e-43   
emb|CBK22327.2|  unnamed protein product                                153   3e-43   Blastocystis hominis
emb|CBK22442.2|  unnamed protein product                                153   3e-43   Blastocystis hominis
ref|XP_003056676.1|  predicted protein                                  138   2e-42   Micromonas pusilla CCMP1545
ref|XP_011396696.1|  60S ribosomal protein L18-3                        140   5e-42   Auxenochlorella protothecoides
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             137   3e-41   Nannochloropsis gaditana
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g             145   8e-41   Phaseolus vulgaris [French bean]
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              144   1e-40   Batrachochytrium dendrobatidis JAM81
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    145   1e-40   Tarenaya hassleriana [spider flower]
gb|KJB82633.1|  hypothetical protein B456_013G206100                    144   2e-40   Gossypium raimondii
gb|KJB22517.1|  hypothetical protein B456_004G052100                    144   3e-40   Gossypium raimondii
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      140   5e-40   Ectocarpus siliculosus
gb|KJB23305.1|  hypothetical protein B456_004G091200                    142   7e-40   Gossypium raimondii
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             122   1e-39   Nicotiana sylvestris
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             136   2e-39   Emiliania huxleyi CCMP1516
ref|XP_009834317.1|  hypothetical protein H257_09702                    137   4e-39   Aphanomyces astaci
ref|XP_008876054.1|  hypothetical protein H310_11242                    136   8e-39   Aphanomyces invadans
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              141   9e-39   Aureococcus anophagefferens
ref|XP_008607735.1|  60S ribosomal protein                              136   1e-38   Saprolegnia diclina VS20
ref|XP_005715661.1|  unnamed protein product                            139   2e-38   Chondrus crispus [carageen]
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         140   2e-38   Acanthamoeba castellanii str. Neff
ref|XP_001640445.1|  predicted protein                                  140   3e-38   Nematostella vectensis
gb|EPZ37075.1|  60S ribosomal protein L18-2                             139   6e-38   Rozella allomycis CSF55
ref|XP_002771969.1|  60S ribosomal protein L18, putative                139   8e-38   Perkinsus marinus ATCC 50983
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg             137   9e-38   
ref|XP_004991895.1|  ribosomal protein l18                              138   1e-37   Salpingoeca rosetta
gb|ACD65122.1|  putative 60S ribosomal protein RPL18                    136   2e-37   Novocrania anomala
ref|XP_001745439.1|  hypothetical protein                               136   2e-37   Monosiga brevicollis MX1
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             130   3e-37   Phytophthora sojae
ref|XP_005704346.1|  60S ribosomal protein L18e                         128   3e-37   Galdieria sulphuraria
ref|XP_002506220.1|  ribosomal protein L18                              142   4e-37   Micromonas commoda
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          137   4e-37   
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  137   5e-37   
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          137   6e-37   Apis mellifera [bee]
ref|XP_008891573.1|  hypothetical protein PPTG_02269                    128   7e-37   Phytophthora parasitica INRA-310
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  134   8e-37   Capitella teleta
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          136   8e-37   Apis florea [dwarf honeybee]
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  136   8e-37   Tribolium castaneum [rust-red flour beetle]
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               134   9e-37   Chrysemys picta bellii
gb|ABR23470.1|  60s ribosomal protein L18                               136   1e-36   Ornithodoros parkeri
gb|KFM61778.1|  60S ribosomal protein L18                               135   1e-36   Stegodyphus mimosarum
gb|ADV03016.1|  ribosomal protein L18                                   136   1e-36   Karlodinium veneficum
ref|XP_002901873.1|  60S ribosomal protein L18-2                        126   1e-36   Phytophthora infestans T30-4
gb|ADV03044.1|  ribosomal protein L18                                   135   1e-36   Amphidinium carterae
gb|AFW81438.1|  hypothetical protein ZEAMMB73_288952                    111   1e-36   
emb|CCI45423.1|  unnamed protein product                                134   1e-36   Albugo candida
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               135   2e-36   Camponotus floridanus
gb|EAW52364.1|  ribosomal protein L18, isoform CRA_f                    134   2e-36   Homo sapiens [man]
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               134   2e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    134   2e-36   Nannospalax galili
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               134   3e-36   
ref|XP_007928296.1|  hypothetical protein MYCFIDRAFT_208218             134   3e-36   Pseudocercospora fijiensis CIRAD86
gb|ABD77166.1|  ribosomal protein L18                                   134   3e-36   Aotus trivirgatus [night monkey]
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    134   3e-36   Nannospalax galili
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               135   3e-36   Harpegnathos saltator
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             135   3e-36   Branchiostoma floridae
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               134   3e-36   Tupaia chinensis
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               134   3e-36   
gb|EFN87206.1|  60S ribosomal protein L18                               134   3e-36   Harpegnathos saltator
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              134   4e-36   Panthera tigris altaica
ref|NP_112364.1|  60S ribosomal protein L18                             134   4e-36   Rattus norvegicus [brown rat]
ref|XP_008888411.1|  ribosomal protein RPL18                            134   4e-36   
emb|CAM91786.1|  hypothetical protein                                   133   4e-36   Platynereis dumerilii
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               134   4e-36   
ref|XP_002371723.1|  60S ribosomal protein L18, putative                134   4e-36   
gb|KDD74971.1|  hypothetical protein H632_c955p1                        126   4e-36   
gb|ABD77167.1|  ribosomal protein L18                                   133   5e-36   
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   134   5e-36   
gb|EAW52359.1|  ribosomal protein L18, isoform CRA_b                    134   5e-36   
ref|NP_001182442.1|  60S ribosomal protein L18                          133   6e-36   
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               133   6e-36   
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              133   6e-36   
emb|CCA16204.1|  60S ribosomal protein L182 putative                    132   6e-36   
gb|ABD77159.1|  ribosomal protein L18                                   133   6e-36   
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              133   7e-36   
gb|ACN41161.1|  unknown                                                 132   7e-36   
gb|KFG34549.1|  ribosomal protein RPL18                                 134   7e-36   
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              133   8e-36   
gb|ABD77176.1|  ribosomal protein L18                                   133   8e-36   
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               133   8e-36   
ref|XP_004440285.1|  PREDICTED: ribosomal protein L18-like isoform 2    133   8e-36   
gb|ABD77155.1|  ribosomal protein L18                                   133   9e-36   
ref|NP_001257419.1|  60S ribosomal protein L18 isoform 2                133   9e-36   
ref|XP_006039668.1|  PREDICTED: 60S ribosomal protein L18-like          132   9e-36   
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    134   9e-36   
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               133   9e-36   
gb|ABD77170.1|  ribosomal protein L18                                   133   9e-36   
ref|XP_003376452.1|  60S ribosomal protein L18                          134   1e-35   
gb|ABD77165.1|  ribosomal protein L18                                   133   1e-35   
gb|EFB23978.1|  hypothetical protein PANDA_006316                       133   1e-35   
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    132   1e-35   
gb|ABD77168.1|  ribosomal protein L18                                   132   1e-35   
gb|AAN73381.1|  ribosomal protein L18                                   133   1e-35   
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    134   1e-35   
gb|ABD77169.1|  ribosomal protein L18                                   132   1e-35   
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               132   1e-35   
gb|ABD77171.1|  ribosomal protein L18                                   132   1e-35   
ref|XP_005664749.1|  PREDICTED: 60S ribosomal protein L18-like          132   1e-35   
gb|ABW23172.1|  ribosomal protein rpl18                                 133   1e-35   
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               133   2e-35   
ref|NP_001015556.1|  60S ribosomal protein L18                          132   2e-35   
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    132   2e-35   
gb|ABD77157.1|  ribosomal protein L18                                   132   2e-35   
gb|ABD77156.1|  ribosomal protein L18                                   132   2e-35   
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              133   2e-35   
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    132   2e-35   
ref|XP_008046838.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    132   2e-35   
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               132   2e-35   
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          132   2e-35   
ref|XP_010760695.1|  60S ribosomal protein L18-B                        133   2e-35   
gb|KDR14978.1|  60S ribosomal protein L18                               132   3e-35   
gb|AAH21743.1|  Ribosomal protein L18                                   131   3e-35   
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...    131   3e-35   
ref|XP_005434338.1|  PREDICTED: 60S ribosomal protein L18-like          131   3e-35   
ref|NP_001011030.1|  60S ribosomal protein L18                          132   3e-35   
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     130   3e-35   
gb|ABD77175.1|  ribosomal protein L18                                   131   3e-35   
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       137   4e-35   
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       137   4e-35   
gb|ELR56635.1|  60S ribosomal protein L18                               132   4e-35   
ref|XP_003626232.1|  60S ribosomal protein L18                          130   4e-35   
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               130   4e-35   
gb|KHJ42803.1|  eukaryotic ribosomal protein L18                        132   4e-35   
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    131   4e-35   
ref|XP_006779428.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    131   4e-35   
gb|ABD77172.1|  ribosomal protein L18                                   131   4e-35   
gb|KFH61892.1|  60S ribosomal protein L18-B                             132   5e-35   
gb|ELK25489.1|  60S ribosomal protein L18                               131   5e-35   
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               132   5e-35   
gb|EFZ15690.1|  hypothetical protein SINV_04174                         132   5e-35   
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               132   5e-35   
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          132   5e-35   
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  126   5e-35   
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  125   6e-35   
emb|CAJ17294.1|  ribosomal protein L18e                                 131   6e-35   
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             131   6e-35   
ref|XP_001092745.1|  PREDICTED: 60S ribosomal protein L18-like          130   6e-35   
ref|XP_003886070.1|  Ribosomal protein L18, related                     131   6e-35   
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               131   7e-35   
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like              131   7e-35   
ref|XP_004345091.2|  ribosomal protein L18e                             130   7e-35   
ref|NP_001187045.1|  60S ribosomal protein L18                          128   7e-35   
gb|ABW90395.1|  putative ribosomal protein L18                          124   8e-35   
ref|XP_007833554.1|  60S ribosomal protein L18-B                        129   8e-35   
gb|EHH30225.1|  hypothetical protein EGK_10844                          131   8e-35   
ref|XP_004271136.1|  PREDICTED: 60S ribosomal protein L18 isoform 2     130   8e-35   
gb|ACR35483.1|  unknown                                                 129   9e-35   
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               131   9e-35   
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18               131   1e-34   
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          131   1e-34   
gb|KJE95959.1|  ribosomal protein L18e                                  130   1e-34   
ref|XP_003851550.1|  60S ribosomal protein L18                          130   1e-34   
ref|XP_009158973.1|  50S ribosomal protein L18e                         130   1e-34   
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    130   1e-34   
ref|XP_666665.1|  eukaryotic ribosomal protein L18                      130   1e-34   
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   123   1e-34   
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   130   1e-34   
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   124   1e-34   
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               132   1e-34   
ref|NP_001082683.1|  60S ribosomal protein L18-B                        130   1e-34   
dbj|GAD98621.1|  60S ribosomal protein L18                              127   1e-34   
ref|XP_009053775.1|  hypothetical protein LOTGIDRAFT_70408              129   1e-34   
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   130   1e-34   
gb|ELR09673.1|  hypothetical protein GMDG_04159                         122   1e-34   
gb|KEF62683.1|  large subunit ribosomal protein L18e                    123   2e-34   
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          130   2e-34   
gb|AFJ91753.1|  ribosomal protein L18                                   129   2e-34   
ref|XP_005798872.1|  PREDICTED: 60S ribosomal protein L18-like          127   2e-34   
ref|XP_003177852.1|  60S ribosomal protein L18                          127   2e-34   
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  130   2e-34   
ref|XP_004646586.1|  PREDICTED: 60S ribosomal protein L18               129   2e-34   
emb|CDW59090.1|  60S ribosomal protein L18                              130   2e-34   
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               130   2e-34   
emb|CCU77907.1|  putative 60S ribosomal protein L18                     122   3e-34   
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         130   3e-34   
ref|XP_755074.1|  60S ribosomal protein L18                             129   3e-34   
ref|XP_002400316.1|  ribosomal protein L18, putative                    130   3e-34   
ref|XP_001260260.1|  60S ribosomal protein L18                          129   3e-34   
gb|AAX48850.1|  L18                                                     128   3e-34   
ref|NP_001018228.1|  60S ribosomal protein L18                          129   3e-34   
gb|KIK07697.1|  hypothetical protein K443DRAFT_673271                   127   3e-34   
emb|CAA24700.1|  ribosomal protein L14                                  128   4e-34   
gb|ABZ04231.1|  ribosomal protein rpl18                                 127   4e-34   
ref|XP_625654.1|  60S ribosomal protein L18                             129   4e-34   
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    131   4e-34   
ref|XP_007550032.1|  PREDICTED: 60S ribosomal protein L18               127   4e-34   
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               127   4e-34   
ref|XP_007722189.1|  large subunit ribosomal protein L18e               129   4e-34   
ref|XP_007779084.1|  60S ribosomal protein L18-B                        129   4e-34   
ref|XP_008429815.1|  PREDICTED: 60S ribosomal protein L18               127   4e-34   
gb|KIW11507.1|  60S ribosomal protein L18-A                             125   5e-34   
gb|KIW43484.1|  60S ribosomal protein L18-B                             125   5e-34   
ref|XP_007804599.1|  hypothetical protein EPUS_07572                    129   5e-34   
dbj|GAA86323.1|  60S ribosomal protein L18                              128   5e-34   
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    127   5e-34   
ref|NP_001082681.1|  60S ribosomal protein L18-A                        129   6e-34   
gb|ABD77164.1|  ribosomal protein L18                                   128   6e-34   
emb|CAB40827.1|  unnamed protein product                                129   6e-34   
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...    129   6e-34   
gb|KFZ07357.1|  hypothetical protein V501_06543                         121   7e-34   
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          129   7e-34   
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      122   7e-34   
ref|XP_009497917.1|  50S ribosomal protein L18e                         129   7e-34   
emb|CAD91422.1|  ribosomal protein L18                                  129   8e-34   
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like          126   8e-34   
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  122   9e-34   
gb|EYE97298.1|  ribosomal protein L18e                                  127   9e-34   
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          128   9e-34   
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         128   1e-33   
gb|ELW47918.1|  60S ribosomal protein L18                               127   1e-33   
emb|CAA28689.1|  ribosomal protein L14                                  128   1e-33   
gb|EKG21215.1|  Ribosomal protein L18e                                  128   1e-33   
gb|AAN73382.1|  ribosomal protein L18                                   122   1e-33   
gb|KIV96156.1|  60S ribosomal protein L18-B                             122   1e-33   
gb|EKC43150.1|  60S ribosomal protein L18                               128   1e-33   
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         128   1e-33   
ref|XP_001194156.2|  PREDICTED: 60S ribosomal protein L18-like          126   1e-33   
gb|AEE61752.1|  unknown                                                 125   1e-33   
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                  124   1e-33   
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          125   1e-33   
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    122   1e-33   
gb|KIW75160.1|  60S ribosomal protein L18-A                             128   1e-33   
ref|XP_001884425.1|  60S ribosomal protein L18                          125   1e-33   
ref|XP_001538041.1|  60S ribosomal protein L18                          128   1e-33   
ref|XP_001209532.1|  60S ribosomal protein L18                          126   2e-33   
ref|XP_006903368.1|  PREDICTED: ribosomal protein L18-like              127   2e-33   
emb|CCQ18599.1|  60S ribosomal protein L18                              125   2e-33   
gb|KIY03022.1|  60S ribosomal protein L18-A                             128   2e-33   
gb|EPY50895.1|  60S ribosomal protein L18                               127   2e-33   
ref|XP_002378206.1|  60S ribosomal protein L18                          127   2e-33   
gb|KIW69267.1|  hypothetical protein PV04_05151                         127   2e-33   
gb|EPS29111.1|  hypothetical protein PDE_04060                          126   2e-33   
gb|ACF83096.1|  unknown                                                 125   2e-33   
gb|KIW89279.1|  60S ribosomal protein L18-A                             127   2e-33   
ref|XP_001550924.1|  60S ribosomal protein L18                          122   2e-33   
ref|XP_663404.1|  hypothetical protein AN5800.2                         127   2e-33   
ref|XP_008714847.1|  hypothetical protein HMPREF1541_02269              125   2e-33   
gb|KIV82136.1|  60S ribosomal protein L18-A                             122   3e-33   
ref|XP_001267682.1|  60S ribosomal protein L18                          127   3e-33   
gb|KFY46288.1|  hypothetical protein V495_02580                         120   3e-33   
ref|XP_002473682.1|  60S ribosomal protein L18                          122   3e-33   
ref|XP_007742086.1|  large subunit ribosomal protein L18e               127   3e-33   
ref|XP_001244800.1|  60S ribosomal protein L18                          123   3e-33   
gb|EEH22502.1|  60S ribosomal protein L18-B                             127   3e-33   
ref|XP_010883138.1|  PREDICTED: 60S ribosomal protein L18               125   3e-33   
ref|XP_007677109.1|  hypothetical protein BAUCODRAFT_122987             127   3e-33   
gb|AAW25981.1|  SJCHGC06655 protein                                     127   3e-33   
emb|CAX79061.1|  ribosomal protein L18                                  127   3e-33   
sp|Q962Y8.1|RL18_SPOFR  RecName: Full=60S ribosomal protein L18         127   3e-33   
gb|KFY89224.1|  hypothetical protein V500_05886                         121   4e-33   
gb|ACO15258.1|  60S ribosomal protein L18                               127   4e-33   
emb|CAX72134.1|  ribosomal protein L18                                  127   4e-33   
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207              123   4e-33   
emb|CCD58684.1|  60S ribosomal protein L18, putative                    127   4e-33   
gb|KFZ15448.1|  hypothetical protein V502_05612                         121   5e-33   
ref|XP_002470390.1|  60S ribosomal protein L18                          122   5e-33   
ref|XP_003050699.1|  60S ribosomal protein L18                          117   5e-33   
gb|EHB09316.1|  60S ribosomal protein L18                               126   5e-33   
gb|AAS49555.1|  ribosomal protein L18                                   126   5e-33   
ref|XP_001588139.1|  60S ribosomal protein L18                          121   5e-33   
gb|ACO51847.1|  60S ribosomal protein L18                               123   6e-33   
gb|KDR74387.1|  hypothetical protein GALMADRAFT_250303                  122   6e-33   
gb|EGU80235.1|  hypothetical protein FOXB_09162                         117   6e-33   
dbj|BAN21088.1|  ribosomal protein L18                                  126   6e-33   
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                   124   6e-33   
ref|XP_003022831.1|  hypothetical protein TRV_03055                     126   7e-33   
gb|EME42520.1|  hypothetical protein DOTSEDRAFT_73384                   126   7e-33   
gb|KIW61527.1|  hypothetical protein PV05_01638                         126   7e-33   
ref|XP_002173803.1|  60S ribosomal protein L18                          122   7e-33   
ref|XP_002296155.1|  RL18, ribosomal protein 18, 60S large riboso...    126   7e-33   
gb|EGD98734.1|  60S ribosomal protein L18                               126   7e-33   
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767             126   7e-33   
ref|XP_002790069.1|  60S ribosomal protein L18                          126   7e-33   
ref|XP_007797810.1|  putative 60s ribosomal protein l18 protein         120   7e-33   
ref|XP_007392123.1|  hypothetical protein PHACADRAFT_181562             122   8e-33   
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                   119   8e-33   
ref|XP_008727056.1|  hypothetical protein G647_04492                    126   8e-33   
ref|NP_001003432.1|  60S ribosomal protein L18                          124   8e-33   
gb|ABO26684.1|  ribosomal protein l18                                   126   9e-33   
gb|KIM67674.1|  hypothetical protein SCLCIDRAFT_13851                   118   9e-33   
gb|KFY54291.1|  hypothetical protein V496_07299                         119   1e-32   
gb|EDM07303.1|  rCG53680, isoform CRA_b                                 122   1e-32   
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487             119   1e-32   
ref|XP_009049705.1|  hypothetical protein LOTGIDRAFT_205248             125   1e-32   



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   187 bits (474),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GKEDK+ V+VGTITDDVRAYEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   187 bits (474),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKEDKIAV+VGTITDDVRAY+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEDKIAVIVGTITDDVRAYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   187 bits (475),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   186 bits (471),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFN VILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEV
Sbjct  35   FLVRRTGSKFNTVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   183 bits (465),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLISFT GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISFTKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   182 bits (463),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTG KFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE KIAV+VGTITDDVRAY+V
Sbjct  35   FLVRRTGCKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEGKIAVIVGTITDDVRAYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   181 bits (459),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGKEDKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.0 bits (175),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   182 bits (462),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            F VRRT SKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE+KIAV+VGTITDDVRAY+V
Sbjct  35   FFVRRTESKFNAVILKRLFMSKTNKPPLSLSRLISYVKGKENKIAVIVGTITDDVRAYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.9 bits (172),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRFF
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFF  36



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   180 bits (456),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VGTITDD+R +EV
Sbjct  35   FLVRRTGSKFNAVVLKRLFMSKVNKPPLSLSRLIRYTQGKEDKIAVVVGTITDDIRVHEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   181 bits (458),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG ITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGNITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   180 bits (456),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  122  FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  181

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  182  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  219


 Score = 71.6 bits (174),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  88   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  123



>gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=178

 Score =   182 bits (461),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   179 bits (454),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI++  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLITYMKGKEGKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   178 bits (452),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPL+LSRLI++  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLALSRLITYMKGKEGKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   178 bits (452),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VLVGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   178 bits (452),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VLVGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   181 bits (458),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   181 bits (458),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=195

 Score =   181 bits (458),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRF  194
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRF  35



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   180 bits (456),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   181 bits (458),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFL  36



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   177 bits (448),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   177 bits (448),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   180 bits (457),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   180 bits (456),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R YEV
Sbjct  237  FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEV  296

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  297  PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLG  334


 Score = 68.6 bits (166),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  202  VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  238



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   177 bits (450),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG+ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   176 bits (446),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE+KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKENKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   180 bits (456),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R YEV
Sbjct  92   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEV  151

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  152  PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLG  189


 Score = 68.2 bits (165),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  57   VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  93



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   175 bits (444),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFN VILKRLFMSK NKP LSLSRLI++T GKEDKIAV+VGT+TDD R YEV
Sbjct  82   FLVRRTGSKFNVVILKRLFMSKINKPALSLSRLITYTKGKEDKIAVVVGTVTDDTRVYEV  141

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  142  PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  179


 Score = 72.8 bits (177),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  83



>gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=159

 Score =   179 bits (454),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI+KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIDKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  36



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   176 bits (447),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE+KIAV+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKENKIAVIVGTVTDDVRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.6 bits (174),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  36



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   176 bits (446),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  97   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEV  156

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  157  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  194


 Score = 72.0 bits (175),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  98



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   179 bits (453),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI+KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIDKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  36



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   176 bits (447),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   180 bits (457),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+VG +TDD+R YEV
Sbjct  75   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEV  134

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  135  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  172


 Score = 67.4 bits (163),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  42   GIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  76



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   176 bits (445),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYAKGKEDKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   177 bits (448),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   177 bits (448),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   177 bits (450),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFM K NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  55   FLVRRTGSKFNAVILKRLFMCKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRIYEV  114

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFTKTARARI+KAGGECLTFDQLALRAPLG
Sbjct  115  PALKVTALRFTKTARARIDKAGGECLTFDQLALRAPLG  152


 Score = 68.9 bits (167),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  21   MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  56



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   174 bits (441),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKTPLSLSRLIRFMKGKESKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   173 bits (439),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED+I V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKEDQIGVIVGTVTDDARVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   176 bits (446),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   177 bits (450),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFMKGKESKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  36



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   177 bits (449),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG+ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  2    GIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   173 bits (438),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   174 bits (442),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PQLKITALKFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.9 bits (172),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   172 bits (437),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GK+DKI V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   172 bits (436),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED I V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMEGKEDNIGVIVGTVTDDARVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   176 bits (447),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   175 bits (443),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   171 bits (434),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE K AV+VGT+TDD+R YEV
Sbjct  251  FLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKESKTAVVVGTVTDDIRVYEV  310

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV AL+FT+TARARIEKAGGECLTFDQLA+RAPLG
Sbjct  311  PALKVTALKFTETARARIEKAGGECLTFDQLAMRAPLG  348


 Score = 73.2 bits (178),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            +MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  216  SMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  252



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   176 bits (447),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   175 bits (444),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKEDK+ V+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYAKGKEDKVVVIVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   175 bits (443),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +T GKEDKIAV+VGT+TDD+R Y+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYTQGKEDKIAVVVGTVTDDIRVYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+T RARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETVRARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   173 bits (439),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ AL+FT+ ARARIEKAGGECLTFD+LALRAPLG
Sbjct  95   PALKITALKFTERARARIEKAGGECLTFDELALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   176 bits (447),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAV+LKRLFMSKTNKPPLSLSRL+ F  GKEDKIAVLVGT+TDD R YEV
Sbjct  91   FLVRRTGSRFNAVLLKRLFMSKTNKPPLSLSRLVKFMEGKEDKIAVLVGTVTDDTRVYEV  150

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  151  PTLKVAALRFTERARARIEKAGGECLTFDQLALRAPLG  188


 Score = 67.8 bits (164),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRF 
Sbjct  57   MGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFL  92



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   175 bits (444),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVLVG++TDD+R +EV
Sbjct  35   FLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVLVGSVTDDIRVHEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010559184.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=145

 Score =   172 bits (436),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GK+DKI V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.0 bits (175),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   174 bits (441),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI + +GKE +IAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMNGKEGRIAVIVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   174 bits (441),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMKGKEAKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   174 bits (442),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVLVG++TDD+R +EV
Sbjct  35   FLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVLVGSVTDDMRVHEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   171 bits (433),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   172 bits (435),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAV+LKRLFMSK NK PLSLSRL+ +  GK+ +IAVLVGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVVLKRLFMSKINKAPLSLSRLVKYMEGKDGRIAVLVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KVCALRFT+TARARIEKAGGEC+TFDQLALRAPLG
Sbjct  95   PTMKVCALRFTETARARIEKAGGECITFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFL  36



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   171 bits (433),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 72.4 bits (176),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   172 bits (437),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKED+I V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDQIGVIVGTVTDDVRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   171 bits (433),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FN V+LKRLFMSK NK PLSLSRLI++  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSSFNGVVLKRLFMSKINKAPLSLSRLITYMKGKEDKIAVIVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.6 bits (174),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFL  36



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   177 bits (448),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI F  GKEDK+AV+VGT+TDD+R YEV
Sbjct  45   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRFMKGKEDKVAVVVGTVTDDIRVYEV  104

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  105  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  142


 Score = 65.9 bits (159),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  12   GIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  46



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   173 bits (439),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVIVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   169 bits (429),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 90/98 (92%), Gaps = 3/98 (3%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GK   IAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGK---IAVVVGTITDDIRVYEV  91

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  92   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  129


 Score = 72.0 bits (175),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   171 bits (433),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  145  FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEV  204

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  205  PCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  242


 Score = 70.1 bits (170),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  111  MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFL  146



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   171 bits (434),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   171 bits (433),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   171 bits (434),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYMQGKDNKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   172 bits (436),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NK P+SLSRL+ F  GKEDK+AV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSSFNAVILKRLFMSKVNKAPISLSRLVRFMQGKEDKVAVIVGTVTDDLRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   169 bits (429),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESSFNAVILKRLFMSKVNKPPLSLSRLIRFMKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   171 bits (432),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  75   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  134

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  135  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  172


 Score = 70.1 bits (170),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  40   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  76



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   171 bits (432),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDSKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   171 bits (432),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMS+ NKPP+SLSRLI F  GKEDKIAV+VG +TDD R YE+
Sbjct  35   FLVRRTGSKFNAVILKRLFMSRVNKPPISLSRLIKFMKGKEDKIAVVVGAVTDDTRVYEL  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   171 bits (434),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVIL+RLFMSK NKPPLSL RL++F  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSRFNAVILRRLFMSKVNKPPLSLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARIVKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   171 bits (434),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMS+ NK P+SLSRLISF  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLISFMKGKEDKIAVIVGTVTDDTRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   175 bits (443),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVLVGT+TDD+R YEV
Sbjct  102  FLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEV  161

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  162  PTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  199


 Score = 65.1 bits (157),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  96   IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  70   IDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  103



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   170 bits (430),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   170 bits (430),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R Y+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.3 bits (168),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   170 bits (430),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  61   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  120

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  121  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  158


 Score = 69.7 bits (169),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  26   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  62



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   169 bits (429),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLSRLI + +GK+ KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFSAVILKRLFMSKVNKAPLSLSRLIRYMNGKDGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   174 bits (442),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGT+TDD+R Y+V
Sbjct  46   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDV  105

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLG
Sbjct  106  PALKVTALRFTETARARIEKAGGECLTFDQLALKAPLG  143


 Score = 64.7 bits (156),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  13   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  47



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   169 bits (429),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTASKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVVVGTITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   169 bits (427),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T+GKE KIAV+VG ITDDVR  EV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTNGKEGKIAVVVGAITDDVRVNEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIE AGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTERARARIESAGGECLTFDQLALRAPLG  132


 Score = 70.5 bits (171),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   169 bits (428),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTSSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   167 bits (423),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FN+VILKRLFMSK NK PLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNSVILKRLFMSKVNKAPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL APLG
Sbjct  95   PALKVAALRFTETARARIEKAGGECLTFDQLALIAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   167 bits (423),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   167 bits (423),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   174 bits (441),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGT+TDD+R Y+V
Sbjct  57   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDV  116

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLG
Sbjct  117  PALKVTALRFTETARARIEKAGGECLTFDQLALKAPLG  154


 Score = 64.3 bits (155),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  24   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  58



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   167 bits (423),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   171 bits (432),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   170 bits (431),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  97   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  156

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  157  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  194


 Score = 67.8 bits (164),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  63   MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  98



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   170 bits (430),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   169 bits (427),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 3/98 (3%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GK   IAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGK---IAVVVGTVTDDIRVYEV  91

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  92   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  129


 Score = 68.9 bits (167),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFL  36



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   180 bits (457),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLV+RTGSKFN VILK LFMSKTNKPPLSLSRLIS+  GKEDKI V+VGTITDDVRAY+V
Sbjct  35   FLVQRTGSKFNTVILKWLFMSKTNKPPLSLSRLISYAKGKEDKIVVIVGTITDDVRAYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRF        VQR  S+
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFL-------VQRTGSK  43



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   167 bits (423),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+GSKFNAVILKRLFMSK NK PLSLSRL++F  GKE KIAVLVGTITDD+R +E+
Sbjct  78   FLVRRSGSKFNAVILKRLFMSKVNKAPLSLSRLVTFMKGKEGKIAVLVGTITDDLRIHEI  137

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  138  PAMKVTALRFTERARARIEKAGGECLTFDQLALKAPLG  175


 Score = 70.5 bits (171),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  44   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  79



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   167 bits (423),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALKAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   171 bits (432),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 66.6 bits (161),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   169 bits (429),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTVTDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   170 bits (431),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK P+SLSRL+ F SGKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPISLSRLVEFMSGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 66.6 bits (161),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   166 bits (420),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALKAPLG  132


 Score = 71.2 bits (173),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   169 bits (428),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   170 bits (430),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 66.6 bits (161),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   176 bits (447),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  34   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  94   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  131


 Score = 60.5 bits (145),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFL  35



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   166 bits (420),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ S FNAVILKRLFMSK NK PLSLSRL+ F +GK+DKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKDDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   168 bits (425),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  196  LVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVP  375
            LVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVP
Sbjct  36   LVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVP  95

Query  376  ALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            ALK+ AL+ T+ ARARIEKAGGECLTFD+LALRAPLG
Sbjct  96   ALKITALKSTERARARIEKAGGECLTFDELALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYR  191
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYR  34



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   168 bits (425),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GKEDKIAV+VGT+TDD R YEV
Sbjct  836  FLVRRTGSRFNAVILKRLFMSKVNRPPISLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEV  895

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGEC TFDQLALR+PLG
Sbjct  896  PAMKVTALRFTETARARILKAGGECFTFDQLALRSPLG  933


 Score = 67.8 bits (164),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRF 
Sbjct  802  MGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFL  837



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   168 bits (425),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN VILKRLFMSK N+ PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTNSKFNGVILKRLFMSKVNRAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   170 bits (431),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPP+SL RLI F  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPISLKRLIRFMEGKEDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI +AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARILQAGGECLTFDQLALRAPLG  132


 Score = 65.5 bits (158),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   167 bits (423),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GKEDKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKEDKIAVIVGTITDDQRVYEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQ  218
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF     + Q
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQ  43



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   166 bits (420),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GKEDKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKEDKIAVVVGTITDDNRVYEL  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +K+ ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PPVKITALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   166 bits (420),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMS+ NK P+SLSRLI +  GKE+KIAVLVGT+TDD R Y+V
Sbjct  35   FLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLIRYMEGKENKIAVLVGTVTDDTRVYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   170 bits (431),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 64.3 bits (155),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   169 bits (428),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 65.5 bits (158),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   167 bits (422),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLFRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   166 bits (421),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL +PLG
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALSSPLG  132


 Score = 67.8 bits (164),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   167 bits (422),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL +LI+F  GKEDKIAVLVGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKKLITFMEGKEDKIAVLVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+ V ALRFT+TARARI KAGGEC TFDQLALRAPLG
Sbjct  95   PAMTVTALRFTETARARILKAGGECWTFDQLALRAPLG  132


 Score = 67.0 bits (162),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   169 bits (427),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 64.7 bits (156),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   165 bits (417),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLVNFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   167 bits (422),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI F  GKEDKI V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLIRFMEGKEDKIVVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARILNAGGECLTFDQLALRAPLG  132


 Score = 66.6 bits (161),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   164 bits (416),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GK DKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKADKIAVIVGTITDDQRVYEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQ  218
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF     + Q
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQ  43



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   167 bits (422),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RL++F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLVTFMQGKDDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGECLTFDQLAL++PLG
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALQSPLG  132


 Score = 66.2 bits (160),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=171

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEV
Sbjct  35   FLVRRTDSNFNKVILKRLFMSKVNKPPLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL-------VRRTDSN  43



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   164 bits (416),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTSSSFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKIAVVVGTITDDNRVYEL  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PPVKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   164 bits (415),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSDFNAVILKRLFMSKTNRPPLSLRRLVNFMKGKENQIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R Y+V
Sbjct  2    FLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYDV  61

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  62   PAMKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  99



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   162 bits (409),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  70   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  129

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  130  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  167


 Score = 70.5 bits (171),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  71



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   166 bits (420),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NKPP+SL RL  F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPISLKRLAKFMEGKDDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+T RARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETVRARILKAGGECLTFDQLALRAPLG  132


 Score = 66.2 bits (160),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   162 bits (409),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F +GK+ KIAVLVGTITDD+R +E+
Sbjct  48   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMNGKDGKIAVLVGTITDDLRVHEI  107

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  108  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  145


 Score = 69.7 bits (169),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  14   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  49



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEV
Sbjct  35   FLVRRTDSNFNKVILKRLFMSKVNKPPLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 14/84 (17%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSEAS------VY  251
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF        V+R DS  +      ++
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL-------VRRTDSNFNKVILKRLF  53

Query  252  EQDQQASTVSLKADLFHVWKGGQD  323
                    +SL + L +  KG +D
Sbjct  54   MSKVNKPPLSL-SRLINFMKGKED  76



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   161 bits (408),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  58   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  117

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  118  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  155


 Score = 70.1 bits (170),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  24   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  59



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   167 bits (424),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F +GKEDK+AV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKFMAGKEDKVAVIVGTVTDDTRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+ ARARI KAGGECLTFD LALRAPLG
Sbjct  95   PALKVTALRFTERARARILKAGGECLTFDDLALRAPLG  132


 Score = 63.9 bits (154),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRF 
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFL  36



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   162 bits (409),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  80   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  139

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  140  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  177


 Score = 69.7 bits (169),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  46   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  81



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   161 bits (408),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  63   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  122

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  123  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  160


 Score = 70.1 bits (170),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  29   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  64



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   162 bits (409),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   161 bits (408),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   161 bits (407),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  70   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  129

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  130  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  167


 Score = 70.1 bits (170),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  71



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   160 bits (406),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L  F  GK+ KIAVLVGTITDD+R +E+
Sbjct  45   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLAEFMKGKDGKIAVLVGTITDDLRVHEI  104

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLG
Sbjct  105  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLG  142


 Score = 70.1 bits (170),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  11   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  46



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   169 bits (428),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVIL+RLFMSK N+PP+SL RLI+F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILRRLFMSKINRPPISLKRLITFMQGKDDKIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 61.2 bits (147),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFL  36



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   162 bits (410),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTITDDKRVYEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   175 bits (443),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVVVGAITDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   162 bits (409),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVKFMEGKSDQIAVIVGTVTDDKRINEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   160 bits (405),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DK+AV+VGTITDD R YE+
Sbjct  35   FLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKVAVVVGTITDDNRVYEL  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARI KAGGECLTFDQLAL APLG
Sbjct  95   PPVKVTALRFTETARARILKAGGECLTFDQLALCAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_006840598.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
 gb|ERN02273.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
Length=165

 Score =   165 bits (417),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFNAVILKRLFMSK N+PP+SLSRLI F  GKE KI V+VG +TDD R YEV
Sbjct  34   FLVRRTGSKFNAVILKRLFMSKINRPPISLSRLIKFMQGKEGKIGVIVGCVTDDTRVYEV  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLAL APLG
Sbjct  94   PALKVAALRFTETARARIVKAGGECLTFDQLALLAPLG  131


 Score = 64.7 bits (156),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK+TKRTAPKS D+YLKLLVKLYRF 
Sbjct  1    GIDLVAGGKSKKTKRTAPKSGDIYLKLLVKLYRFL  35



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   163 bits (413),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN V+LKRLFMS+ N+PPL LSRLI+   GKEDKIAVLVGTITDD R +EV
Sbjct  34   FLVRRTESKFNGVVLKRLFMSRVNRPPLRLSRLIAHMKGKEDKIAVLVGTITDDNRIHEV  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKV ALRFT+T RARIEKAGGECLTFDQLALRAPLG
Sbjct  94   PPLKVTALRFTETVRARIEKAGGECLTFDQLALRAPLG  131


 Score = 66.2 bits (160),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  35



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   161 bits (407),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FNAVILKRLFMSKTN+PPLSL RL+ F  GKE++IAV+VGTITDD + YEV
Sbjct  35   FLVRRTKNHFNAVILKRLFMSKTNRPPLSLRRLVKFMEGKENQIAVIVGTITDDKKVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLAL APLG
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALHAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   162 bits (410),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FN+V+LKRLFMS+TN+ PLS+SRL+ + +GKE KIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRTNRAPLSMSRLVKYMTGKEGKIAVLVGTITDDVRQFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFT+TARARI KAGGECLTFDQLALRAP G
Sbjct  95   PALKVCALRFTETARARILKAGGECLTFDQLALRAPTG  132


 Score = 67.0 bits (162),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFL  36



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   159 bits (402),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF  GK+ KI VLVGTITDD+R  E+
Sbjct  35   FLVRRSNSKFNAVILKRLFMSKVNKAPLSLSKLVSFMEGKDGKIGVLVGTITDDLRIQEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   159 bits (403),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VLVGTITDD+R +++
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLG  132


 Score = 69.7 bits (169),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   159 bits (403),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VLVGTITDD+R +++
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLG
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   160 bits (406),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   162 bits (409),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FN+V+LKRLFMS+ N+ PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRINRAPLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFT+TARARI KAGGECLTFDQLALRAP G
Sbjct  95   PALKVCALRFTETARARIVKAGGECLTFDQLALRAPTG  132


 Score = 66.6 bits (161),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFL  36



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   164 bits (416),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GK DKIAV+VGT+TDD R Y+V
Sbjct  246  FLVRRTGSRFNAVILKRLFMSKINRPPISLKRLVTFMEGKGDKIAVIVGTVTDDKRVYDV  305

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFD LALRAPLG
Sbjct  306  PALKVTALRFTETARARILKAGGECLTFDHLALRAPLG  343


 Score = 63.9 bits (154),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  213  GIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  247



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   160 bits (406),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI   GGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIVNTGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFL  36



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   160 bits (405),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NK PLSLSRL+   SGK+DKIAVLVGTITDDVR +++
Sbjct  35   FLVRRTQSNFNKVILKRLFMSKVNKAPLSLSRLVELMSGKDDKIAVLVGTITDDVRVHDI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVAALRFTERARARIVKAGGECLTFDQLALRAPLG  132


 Score = 67.8 bits (164),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   162 bits (410),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK N+PP+SL RLI+F   K+DKIAV+VGT+TDD R Y+V
Sbjct  35   FLVRRTESKFNAVILKRLFMSKNNRPPISLKRLITFMERKDDKIAVIVGTVTDDKRVYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLG  132


 Score = 65.5 bits (158),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   157 bits (398),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EV
Sbjct  70   FLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEV  129

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  130  PAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  167


 Score = 68.9 bits (167),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  36   MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  71



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   157 bits (397),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   160 bits (406),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+T RARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETVRARIVNAGGECLTFDQLALRAPLG  132


 Score = 65.1 bits (157),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFL  36



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   161 bits (408),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +1

Query  190  DFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  369
             FLVRRTGSKFN V+ KRL MS+ N+PPLSLSRL +   GKE++IAVLVG++TDD+R +E
Sbjct  34   SFLVRRTGSKFNEVVRKRLTMSRVNRPPLSLSRLSALMKGKENQIAVLVGSVTDDIRVHE  93

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  94   IPAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 64.7 bits (156),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY F 
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFL  36



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEV
Sbjct  62   FLVRRTDSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVVVGTVTDDIRVYEV  121

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  122  PALKITALKFTERARARIEKAGGECLTFDQLALRAPLG  159


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  28   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL-------VRRTDSN  70



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   155 bits (393),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 90/133 (68%), Gaps = 35/133 (26%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK--------------------  312
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GK                    
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKVCLSIFFTSCTGVASSHIVL  94

Query  313  ---------------EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  447
                           EDKIAV+VGTITDD+R YEVP LK+ AL+FT+ ARARIEKAGGEC
Sbjct  95   LIIAYISTFYFCQMLEDKIAVVVGTITDDIRVYEVPQLKITALKFTERARARIEKAGGEC  154

Query  448  LTFDQLALRAPLG  486
            LTFDQLALRAPLG
Sbjct  155  LTFDQLALRAPLG  167


 Score = 69.3 bits (168),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   156 bits (394),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  133


 Score = 68.9 bits (167),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   154 bits (390),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+VGT+TDDVRAYEV
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVVVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|AFW77276.1| hypothetical protein ZEAMMB73_917876 [Zea mays]
Length=160

 Score =   156 bits (394),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  132


 Score = 68.6 bits (166),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   156 bits (394),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  133


 Score = 68.6 bits (166),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   156 bits (395),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR ++V
Sbjct  35   FLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G
Sbjct  95   PKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTG  132


 Score = 67.4 bits (163),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFL  36



>gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=170

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI+F  GK DKIAV+VGT+TDD+RAYEV
Sbjct  35   FLVRRTDSNFNKVILKRLFMSKVNKPPLSLSRLINFMKGK-DKIAVVVGTVTDDIRAYEV  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  94   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  131


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   155 bits (391),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK N+ PLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSPFNAVILKRLFMSKANRSPLSMRRLVKFMEGKGDQIAVIVGTVTDDKRITEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S F+ VILKRLFMSK NKPP+SLSRL  F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTDSNFDKVILKRLFMSKVNKPPMSLSRLTKFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   155 bits (393),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G
Sbjct  95   VPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTG  133


 Score = 67.0 bits (162),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   155 bits (393),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G
Sbjct  95   VPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTG  133


 Score = 67.0 bits (162),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   158 bits (399),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R YEV
Sbjct  35   FLERRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TA+ARI  AGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETAKARIINAGGECLTFDQLALRAPLG  132


 Score = 64.3 bits (155),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFL  36



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   152 bits (384),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   155 bits (392),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G
Sbjct  95   IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTG  133


 Score = 67.0 bits (162),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   152 bits (383),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKEDKI V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDKIGVVVGTVTDDVRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 70.1 bits (170),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   154 bits (389),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GK++K IAV+VGTITDD R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKDEKSIAVIVGTITDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP+G
Sbjct  95   IPAMKVTALRFTETARARIINAGGECLTFDQLALRAPMG  133


 Score = 67.4 bits (163),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFL  36



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   154 bits (390),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FL RRT SKFNAVILKRLFMSKTN+PPLSL RL  F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLYRRTKSKFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  133


 Score = 66.6 bits (161),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFL  36



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   157 bits (397),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  41   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  100

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G
Sbjct  101  VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTG  139


 Score = 63.5 bits (153),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRF 
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFL  42



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   153 bits (386),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT SKFN  +LKRLFMSKTN+PPLSLS++  F  GKE K+A +VGT+TDDVR ++V
Sbjct  35   FLARRTDSKFNDTVLKRLFMSKTNRPPLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFT+TARARI KAGG+C+TFDQLAL AP G
Sbjct  95   PALKVCALRFTETARARIIKAGGQCMTFDQLALSAPTG  132


 Score = 67.8 bits (164),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFL  36



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   167 bits (422),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  71   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  130

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+ ARA IEKAGGECLTFDQLALRAPLG
Sbjct  131  PAIKVTALRFTERARASIEKAGGECLTFDQLALRAPLG  168


 Score = 53.5 bits (127),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK+TKRTAPKSDDVYL      YRF 
Sbjct  38   GIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFL  72



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   151 bits (382),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT S FNAVILKRLFMSK N+PP+SL RL +F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSSFNAVILKRLFMSKANRPPISLRRLANFMKGKEEKNIAVIVGTVTDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   IPAMKVTALRFTETARARIINAGGECLTFDQLALRAPLG  133


 Score = 68.6 bits (166),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRR+ SKFNAVILKRLFMSK NK PLSLSRL  F  GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSDSKFNAVILKRLFMSKVNKAPLSLSRLAEFLKGKEDKIAVLVGTITDDLRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PALKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF        V+R DS+
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL-------VRRSDSK  43



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   154 bits (389),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK--------EDKIAVLVGTIT  348
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK         D+IAV+VGT+T
Sbjct  35   FLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVT  94

Query  349  DDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            DD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   DDKRIYEVPAMKVAALRFTETARARIINAGGECLTFDQLALRAPLG  140


 Score = 65.1 bits (157),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFL  36



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   151 bits (381),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEV
Sbjct  35   FLSRRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVVVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 68.2 bits (165),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFL  36



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   157 bits (397),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE K+AV+V T+TDDVR +EV
Sbjct  35   FLVRRTESKFNKVILKRLFMSKTNRPPLSLSKLAAFMKGKESKVAVIVATVTDDVRLFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L+VCALRFT+TARARI KAGGECLTFDQLAL+ P G
Sbjct  95   PKLRVCALRFTETARARITKAGGECLTFDQLALQRPTG  132


 Score = 62.0 bits (149),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRF 
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFL  36



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   151 bits (381),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKE-DKIAVLVGTITDDVRAYE  369
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL  F  GKE + IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQE  94

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +P +KV ALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  95   IPKMKVTALRFTETARARIVNAGGECLTFDQLALRAPLG  133


 Score = 67.8 bits (164),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+VG +TDD+R Y+V
Sbjct  35   FLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   152 bits (385),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+ V+VGT+TDDVRAYEV
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVVVVVGTVTDDVRAYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P+LKV ALRFTKTARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PSLKVTALRFTKTARARIEKAGGECLTFDQLALRAPLG  132


 Score = 63.9 bits (154),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFL  36



>gb|KJB26287.1| hypothetical protein B456_004G239000 [Gossypium raimondii]
Length=224

 Score =   148 bits (373),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRL--------ISFTSGKEDKIAVLVGTIT  348
            FLVRR GS FNAVILKRLFM K NKPPLSL  +        +++    EDKI V+VGT+T
Sbjct  35   FLVRRAGSNFNAVILKRLFMRKVNKPPLSLYFICGSGFLGSLNYCWFGEDKIGVVVGTVT  94

Query  349  DDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            DD+R YEVPAL V ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   DDIRVYEVPALTVTALRFTETARARIEKAGGECLTFDQLALRAPLG  140


 Score = 68.2 bits (165),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>gb|ABA26976.1| TO23-2rc [Taraxacum officinale]
Length=102

 Score =   160 bits (406),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS FNAVILKRLFMSK NKPP+S SRL+ + +GK+DKIAV+VGT+TDDVR +E+
Sbjct  9    FLVRRTGSNFNAVILKRLFMSKVNKPPISFSRLVRYMAGKDDKIAVIVGTVTDDVRVHEI  68

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALR  474
            P +KV ALRFT+TARARIEKAGGECLTFDQLALR
Sbjct  69   PCMKVTALRFTETARARIEKAGGECLTFDQLALR  102



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   153 bits (387),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FNAV+LKRLFMSK N+PPLSLS+L  F +GKEDK+AVLVGT+TDDVR +EV
Sbjct  35   FLERRTESNFNAVVLKRLFMSKINRPPLSLSKLAKFMAGKEDKVAVLVGTVTDDVRLHEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L+V ALRFT+TARARI KAGGECLTFDQLAL  P G
Sbjct  95   PKLRVTALRFTETARARIVKAGGECLTFDQLALERPTG  132


 Score = 60.5 bits (145),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFL  36



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   148 bits (374),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK NK P SLSRL+   SGK+DKIAVLVGTI DDV  +++
Sbjct  47   FLVRRTQSNFNKVILKRLFMSKVNKAPFSLSRLVELMSGKDDKIAVLVGTIIDDVSVHDI  106

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
             A+KV ALRFT+ ARARI KAGG+CLTFDQLALRAPLG
Sbjct  107  LAIKVAALRFTERARARIVKAGGKCLTFDQLALRAPLG  144


 Score = 65.5 bits (158),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  14   GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  48



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK N+PP+SLS++I +  GK+ KI V+VG +TDD+R YEV
Sbjct  35   FLVRRTDSNFNAVILKRLFMSKVNRPPISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LK+ ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PVLKIAALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FN+VILKRLFMS+TN+ PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVILKRLFMSRTNRAPLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAP G
Sbjct  95   PALKVAALRFTETARARILKAGGECLTFDQLALRAPTG  132


 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF        V+R D+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFL-------VRRTDAP  43



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   155 bits (391),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT SKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR +EV
Sbjct  89   FLARRTDSKFNQTVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVACVVGTITDDVRMFEV  148

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRFT TARARI KAGGECLTFDQLAL+AP G
Sbjct  149  PKLTVCALRFTATARARIVKAGGECLTFDQLALKAPTG  186


 Score = 56.2 bits (134),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRF 
Sbjct  56   GIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFL  90



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  17   FLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQIAVIVGTVTDDKRINEV  76

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLG
Sbjct  77   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLG  114



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   150 bits (379),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  190  DFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  369
            DF+ RRT S F+ VI  RL MSK NK PLSLSRL  +  G EDKIAVLVGT+TDDVR  E
Sbjct  34   DFIHRRTKSHFSKVIRHRLCMSKVNKAPLSLSRLCRYMQGHEDKIAVLVGTVTDDVRIAE  93

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            VPALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLG
Sbjct  94   VPALKVTALRFTERARARIEKAGGECLTFDQLALRAPLG  132


 Score = 58.2 bits (139),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F 
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFI  36



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   140 bits (354),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVLVGT+TDD R   V
Sbjct  35   FLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVLVGTVTDDPRLATV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G
Sbjct  95   PAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTG  132


 Score = 67.4 bits (163),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL  36



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   140 bits (354),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVLVGT+TDD R   V
Sbjct  35   FLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVLVGTVTDDPRLAAV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G
Sbjct  95   PAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTG  132


 Score = 67.4 bits (163),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL  36



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   147 bits (372),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            +LVRRT SKFNAVILKRLFMSK NK PLSLSRL+ +  GK+ KIAV+VGT+TDDVR  +V
Sbjct  35   YLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVRYMDGKDGKIAVIVGTVTDDVRIEDV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAP  480
            PAL V ALRFT++ARARI KAGGECLTFDQLAL  P
Sbjct  95   PALTVTALRFTESARARIHKAGGECLTFDQLALPCP  130


 Score = 60.5 bits (145),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+ 
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYL  36



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   139 bits (350),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 76/98 (78%), Gaps = 13/98 (13%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGSKFN VILKRLFMSK NKPPLSLSRLI F  GK              +  YEV
Sbjct  35   FLVRRTGSKFNTVILKRLFMSKVNKPPLSLSRLIQFMKGK-------------GLWVYEV  81

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARIEKAGGECL+FDQLALRAPLG
Sbjct  82   PALKVTALRFTETARARIEKAGGECLSFDQLALRAPLG  119


 Score = 68.2 bits (165),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   139 bits (351),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGS FN++ILKRL MS+ N+PPLSLSRL S   GKE +IAVLVG+ITDD+R +E+
Sbjct  35   FLTRRTGSSFNSIILKRLIMSRVNRPPLSLSRLSSLMKGKEGQIAVLVGSITDDIRVHEI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  95   PAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLG  132


 Score = 67.4 bits (163),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFL  36



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   149 bits (376),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN V+LKRLFMSKTN+PPLSLS+L+ F  GKE K+AVLVGTITDD R +EV
Sbjct  35   FLVRRTESDFNKVVLKRLFMSKTNRPPLSLSKLVKFMEGKEGKLAVLVGTITDDTRLFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L+VCALR T+TARARI KAGGE +TFDQLAL AP G
Sbjct  95   PKLRVCALRVTETARARILKAGGEIITFDQLALIAPTG  132


 Score = 57.4 bits (137),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRF 
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFL  36



>ref|XP_003081305.1| ribosomal protein L18 (ISS) [Ostreococcus tauri]
Length=181

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR ++V
Sbjct  30   FLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDV  89

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G
Sbjct  90   PKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTG  127



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+VG +TDD+R Y+V
Sbjct  32   FLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDV  91

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPL  483
            P +KV AL+FT+TARARI+KAGGECLTFDQLALR PL
Sbjct  92   PTIKVTALKFTETARARIQKAGGECLTFDQLALRLPL  128


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 7/47 (15%)
 Frame = +3

Query  99   DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFL-------VRRTDSN  40



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE+K+AV+V T+TDDVR YEV
Sbjct  35   FLVRRTDSKFNKVILKRLFMSKTNRPPLSLSKLATFMKGKENKVAVIVATVTDDVRLYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L+V ALRFT+TARARI KAGGECLTFDQLAL  P G
Sbjct  95   PKLRVVALRFTETARARITKAGGECLTFDQLALERPTG  132


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRF        V+R DS+
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFL-------VRRTDSK  43



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   145 bits (365),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SKFN V+LKRLFMS+TN+PPLSLS+L +F  GKEDK AVL+GTITDDVR +EV
Sbjct  35   FLVRRTESKFNKVVLKRLFMSRTNRPPLSLSKLATFMKGKEDKTAVLIGTITDDVRLFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L V ALR T+TARARI  AGG+ LTFDQLAL AP G
Sbjct  95   PKLTVVALRVTETARARILGAGGKILTFDQLALLAPTG  132


 Score = 61.2 bits (147),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY F 
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFL  36



>ref|XP_010277700.1| PREDICTED: uncharacterized protein LOC104612082 [Nelumbo nucifera]
Length=491

 Score =   160 bits (406),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL+RRTGS FNAVILKRLFMS+ NK P+SLS LISF  GKEDKI V+VGT+TDD + YEV
Sbjct  306  FLIRRTGSNFNAVILKRLFMSRVNKAPMSLSILISFMKGKEDKIVVIVGTVTDDTQVYEV  365

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+T RARI K GGECLTFDQLALRAPLG
Sbjct  366  PALKVTALRFTETTRARILKVGGECLTFDQLALRAPLG  403


 Score = 45.1 bits (105),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 4/30 (13%)
 Frame = +3

Query  108  AGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            AGGKSK+TKRTAPKS D+YL    KLYRF 
Sbjct  282  AGGKSKKTKRTAPKSKDIYL----KLYRFL  307



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  369
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  59   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  118

Query  370  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G
Sbjct  119  IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTG  157



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   153 bits (386),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EV
Sbjct  38   FLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEV  97

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFT+TARARI KAGGEC+T DQLALRAP G
Sbjct  98   PALKVCALRFTETARARILKAGGECITLDQLALRAPTG  135


 Score = 50.4 bits (119),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG++    KR APKS++VYL LLV LYRF 
Sbjct  3    MGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFL  39



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FNAV+LKRLFMS+ N+PP+S+SRL+ +  GKEDKIAV+VG++TDD R YEV
Sbjct  35   FLVRRTDAPFNAVVLKRLFMSRINRPPISMSRLVRYMKGKEDKIAVIVGSVTDDTRIYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI K GGE LTFDQLALRAP G
Sbjct  95   PALKVAALRFTETARARILKNGGEVLTFDQLALRAPTG  132


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF        V+R D+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFL-------VRRTDAP  43



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT + FN+V+LKRLFMS+ N+PP+S+SRL+ + +GKE KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRINRPPISMSRLVKYMTGKEGKIAVIVGTVTDDTRIYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKV ALRFT+TARARI K+GGE LTFDQLALRAP G
Sbjct  95   PALKVAALRFTETARARILKSGGEVLTFDQLALRAPTG  132


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  239
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRF        V+R D+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL-------VRRTDAP  43



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 97/138 (70%), Gaps = 5/138 (4%)
 Frame = +1

Query  88   PWVSI*KPEVRASRRSA-----QLPSPtmft*sfs*sftDFLVRRTGSKFNAVILKRLFM  252
            PWV +   ++ A  R+      Q P       +   +   FL RRT ++F  V+LKRL+M
Sbjct  3    PWVKLPGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYM  62

Query  253  SKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEK  432
            S+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI K
Sbjct  63   SRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILK  122

Query  433  AGGECLTFDQLALRAPLG  486
            AGGEC+T DQLALRAP G
Sbjct  123  AGGECITLDQLALRAPTG  140



>emb|CBK22442.2| unnamed protein product [Blastocystis hominis]
Length=186

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EV
Sbjct  35   FLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PALKVCALRFT+TARARI KAGGEC+T DQLALRAP G
Sbjct  95   PALKVCALRFTETARARILKAGGECITLDQLALRAPTG  132



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   138 bits (348),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FN  +LKRLFMSK N+PPLSLS+L  F  G    ++ +VGT+TDD R +EV
Sbjct  35   FLARRTDSDFNKTVLKRLFMSKINRPPLSLSKLAKFHKGG---VSAIVGTVTDDARMFEV  91

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PA+KVCALRFT+TARARI KAGGEC+TFDQLAL AP G
Sbjct  92   PAMKVCALRFTETARARIIKAGGECMTFDQLALSAPTG  129


 Score = 60.5 bits (145),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRF 
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFL  36



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score =   140 bits (354),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN VILKRLFMSK N+PPLSLS+L  FT+G+  KIAVLVGT+TDD+R +EV
Sbjct  35   FLVRRTESDFNKVILKRLFMSKVNRPPLSLSKLAKFTAGQPGKIAVLVGTVTDDIRLHEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P ++V ALR T+TARARI  AGGE LT DQLAL AP G
Sbjct  95   PKIRVAALRVTETARARIVAAGGEVLTLDQLALLAPTG  132


 Score = 56.6 bits (135),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRF 
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFL  36



>gb|EWM27599.1| Ribosomal protein L18e/L15P [Nannochloropsis gaditana]
Length=191

 Score =   137 bits (346),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FNAVILKRLFMSK N+PP+++SRL+    GKE K AV+VGTITDD R  EV
Sbjct  36   FLARRTDSNFNAVILKRLFMSKNNRPPIAISRLVRHMKGKEGKTAVIVGTITDDARMLEV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L V AL+ T TARARI +AGGE LTFD+LALRAP G
Sbjct  96   PKLSVAALKVTATARARILQAGGEILTFDELALRAPKG  133


 Score = 57.4 bits (137),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MGIDLK+GG+    K RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLKSGGRRTGHKTRTAPKSDNVYLKLLVKLYRFL  37



>ref|XP_007143771.1| hypothetical protein PHAVU_007G100200g, partial [Phaseolus vulgaris]
 gb|ESW15765.1| hypothetical protein PHAVU_007G100200g, partial [Phaseolus vulgaris]
Length=148

 Score =   145 bits (366),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  208  TGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKV  387
            TGS FN VILKRLFMSK NKPPLSLSRLI  T GKEDKI V+VGT+ DD+  YEVP LK+
Sbjct  1    TGSNFNVVILKRLFMSKVNKPPLSLSRLIRHTKGKEDKIVVVVGTVPDDIIVYEVPQLKI  60

Query  388  CALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
              L+FT+ ARAR++K  GECLTFDQLALRAPLG
Sbjct  61   TTLKFTERARARVDKTYGECLTFDQLALRAPLG  93



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   144 bits (363),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT SKFN V+LKRLFMS+ N+PP+S+SRL  + SGKE+KIAV+VGT+TDD R  EV
Sbjct  35   FLARRTNSKFNQVVLKRLFMSRVNRPPISISRLSKYLSGKENKIAVVVGTVTDDNRLLEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P + V ALR T +ARARI KAGGE LTFDQLALR+PLG
Sbjct  95   PKISVAALRVTNSARARILKAGGEILTFDQLALRSPLG  132


 Score = 48.9 bits (115),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MG+DL+     K+  R APKSD+VYL+LLVKLYRF 
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFL  36



>ref|XP_010550998.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Tarenaya 
hassleriana]
Length=157

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  205  RTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALK  384
            RTGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+VGT+TDDVR YEVPALK
Sbjct  9    RTGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEVPALK  68

Query  385  VCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            V ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  69   VTALRFTETARARIEKAGGECLTFDQLALRAPLG  102



>gb|KJB82633.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=134

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  250  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  429
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  430  KAGGECLTFDQLALRAPLG  486
            KAGGECLTFDQLALRAPLG
Sbjct  61   KAGGECLTFDQLALRAPLG  79



>gb|KJB22517.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=134

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  250  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  429
            MSK NKPPLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  430  KAGGECLTFDQLALRAPLG  486
            KAGGECLTFDQLALRAPLG
Sbjct  61   KAGGECLTFDQLALRAPLG  79



>emb|CBJ25909.1| cytoplasmic ribosomal protein L18 [Ectocarpus siliculosus]
Length=192

 Score =   140 bits (352),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S F  V+LKRL+MSKTN+ PLSLSRL  +   KE   AVLVGT+TDDVR  EV
Sbjct  36   FLARRTDSAFANVVLKRLYMSKTNRAPLSLSRLARYMRNKETSTAVLVGTVTDDVRLLEV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRFT+TARARI  AGGEC+TFDQLALRAP G
Sbjct  96   PKLSVCALRFTETARARILAAGGECITFDQLALRAPKG  133


 Score = 51.2 bits (121),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGG+    K RT+PKSD+VYL LLVKL+RF 
Sbjct  1    MGIDLVAGGRRVGHKVRTSPKSDNVYLGLLVKLFRFL  37



>gb|KJB23305.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=134

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  250  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  429
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARID  60

Query  430  KAGGECLTFDQLALRAPLG  486
            KAGGECLTFDQLALRAPLG
Sbjct  61   KAGGECLTFDQLALRAPLG  79



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   122 bits (307),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 14/98 (14%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+             
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVV-------------  81

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
                V ALRFT+TARARIEKAGGECLTFDQLALRAPLG
Sbjct  82   -VGTVTALRFTETARARIEKAGGECLTFDQLALRAPLG  118


 Score = 66.6 bits (161),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFL  36



>ref|XP_005787945.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
 gb|EOD35516.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
Length=190

 Score =   136 bits (342),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  366
            FL RRT +KFN V+LKRLF SKTN+PP+S+  +  F +  G E KIAV+VG++TDDVR  
Sbjct  37   FLARRTDAKFNKVVLKRLFTSKTNRPPMSIKSIAKFMAREGNEGKIAVVVGSVTDDVRFL  96

Query  367  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            +VP L VCALRFT TARARI KAGGECLT DQLAL++PLG
Sbjct  97   DVPKLTVCALRFTATARARIVKAGGECLTLDQLALKSPLG  136


 Score = 52.8 bits (125),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 33/38 (87%), Gaps = 2/38 (5%)
 Frame = +3

Query  90   MGIDLKAGGK--SKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGID+KAGG+  +K++ RTAP S+++YL+L+VKLYRF 
Sbjct  1    MGIDIKAGGRKATKKSGRTAPVSENLYLRLIVKLYRFL  38



>ref|XP_009834317.1| hypothetical protein H257_09702 [Aphanomyces astaci]
 gb|ETV76192.1| hypothetical protein H257_09702 [Aphanomyces astaci]
Length=192

 Score =   137 bits (345),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT +KFN  +LKRL+MS+TN+PPLS++R+  + + KED+IAV+VGTITDD+R ++V
Sbjct  36   FLARRTDAKFNQNVLKRLYMSRTNQPPLSIARVARYMNKKEDQIAVVVGTITDDIRLFDV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L + AL FT++ARARI KAGGE LTFDQLALRAP G
Sbjct  96   PKLTIAALGFTESARARILKAGGEILTFDQLALRAPKG  133


 Score = 50.4 bits (119),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MG D+ AGGKS   K RTAPKS++VYL LLV+LYRF 
Sbjct  1    MGKDIVAGGKSTGRKSRTAPKSENVYLNLLVRLYRFL  37



>ref|XP_008876054.1| hypothetical protein H310_11242 [Aphanomyces invadans]
 gb|ETV95353.1| hypothetical protein H310_11242 [Aphanomyces invadans]
Length=192

 Score =   136 bits (343),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT +KFN  +LKRL+MS+TN+PP+S++R+  +   KED+IAV+VGTITDD+R ++V
Sbjct  36   FLARRTDAKFNQNVLKRLYMSRTNQPPMSIARVARYMKNKEDQIAVVVGTITDDIRLFDV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L + AL FT++ARAR+ KAGGE LTFDQLALRAP G
Sbjct  96   PKLTIAALGFTESARARVLKAGGEILTFDQLALRAPKG  133


 Score = 50.4 bits (119),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MG D+ AGGKS   K RTAPKS++VYL LLV+LYRF 
Sbjct  1    MGKDIVAGGKSTGRKSRTAPKSENVYLNLLVRLYRFL  37



>ref|XP_009036910.1| hypothetical protein AURANDRAFT_37496 [Aureococcus anophagefferens]
 gb|EGB08175.1| hypothetical protein AURANDRAFT_37496 [Aureococcus anophagefferens]
Length=192

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S F   +LKRLFMS+TN+PPLSLS L  F   K+DKIAVLVGTITDD R   V
Sbjct  36   FLARRTDSAFVKTVLKRLFMSRTNRPPLSLSALARFMREKDDKIAVLVGTITDDPRMLTV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P + VCALRFT+TARARI KAGGECLTFDQLALRAP G
Sbjct  96   PKMTVCALRFTETARARIVKAGGECLTFDQLALRAPKG  133



>ref|XP_008607735.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|EQC38911.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|KDO29707.1| 60S ribosomal protein [Saprolegnia parasitica CBS 223.65]
Length=192

 Score =   136 bits (342),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT +KFN V+LKRL+MS+TN+PP+S++R+  +   KEDKIAV+VGTITDD+R ++V
Sbjct  36   FLARRTDAKFNEVVLKRLYMSRTNQPPMSIARVARYMKNKEDKIAVVVGTITDDIRLFDV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L + AL FT+ ARAR+  AGGE LTFDQLALRAP G
Sbjct  96   PKLTIAALGFTEGARARVLAAGGEILTFDQLALRAPKG  133


 Score = 50.4 bits (119),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MG D+ AGGKS   K RTAPKS++VYL LLV+LYRF 
Sbjct  1    MGKDIIAGGKSTGRKSRTAPKSENVYLNLLVRLYRFL  37



>ref|XP_005715661.1| unnamed protein product [Chondrus crispus]
 emb|CDF35842.1| unnamed protein product [Chondrus crispus]
Length=185

 Score =   139 bits (350),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT  KFN ++LKRLFMS+T++PP+S+SR+ ++  G+EDK AV+VG + DD R  ++
Sbjct  35   FLARRTDEKFNGIVLKRLFMSRTSRPPMSVSRISAYMKGREDKTAVIVGKVLDDERMLDI  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCAL F+KTAR RIEKAGGECLTFDQLA+R+P G
Sbjct  95   PKLTVCALDFSKTARVRIEKAGGECLTFDQLAVRSPTG  132


 Score = 47.0 bits (110),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL+ GG+ K+  R APKS++ YL LLV+LY F 
Sbjct  1    MGIDLEKGGRIKKPGRRAPKSENPYLSLLVQLYSFL  36



>ref|XP_004358287.1| eukaryotic ribosomal protein L18, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25723.1| eukaryotic ribosomal protein L18, putative [Acanthamoeba castellanii 
str. Neff]
Length=186

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTG+ FN V+LKRL MS+TN+PPLSL +L  FT GKEDKIAV+VGT+TDD R  + 
Sbjct  35   FLARRTGADFNRVVLKRLCMSRTNQPPLSLIKLARFTKGKEDKIAVVVGTVTDDARLLKF  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRFT+ AR RI KAGGE LTFDQLALRAP G
Sbjct  95   PKLTVCALRFTEGARTRILKAGGEILTFDQLALRAPTG  132



>ref|XP_001640445.1| predicted protein [Nematostella vectensis]
 gb|EDO48382.1| predicted protein [Nematostella vectensis]
Length=188

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISF--TSGKEDKIAVLVGTITDDVRAY  366
            FL RRT +KFN +++KRL MS+T +PPLSL+RL+     SG +DKI V+VG+ITDD R +
Sbjct  34   FLSRRTNAKFNQIVMKRLCMSRTKRPPLSLARLVRKMKASGHKDKICVVVGSITDDKRIF  93

Query  367  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            EVPALK+CALRF++TARARI KAGGE LTFDQLALRAPLG
Sbjct  94   EVPALKICALRFSETARARILKAGGEILTFDQLALRAPLG  133



>gb|EPZ37075.1| 60S ribosomal protein L18-2 [Rozella allomycis CSF55]
Length=185

 Score =   139 bits (350),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRTG+KFN +ILKRLFMS+ N+ P+SLS +    SG+EDKIAVLVGT+TDDVR  E 
Sbjct  34   FLARRTGAKFNNIILKRLFMSRINRAPMSLSGVAKQMSGQEDKIAVLVGTVTDDVRLLEF  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L + ALRFTKTARARI KAGGE +T DQLALR+P G
Sbjct  94   PKLTIAALRFTKTARARIVKAGGEAITLDQLALRSPTG  131



>ref|XP_002771969.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002775843.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002780336.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
 gb|EER03785.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
 gb|EER07659.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
 gb|EER12131.1| 60S ribosomal protein L18, putative [Perkinsus marinus ATCC 50983]
Length=187

 Score =   139 bits (349),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FNA ILKRL  S+ N+P LSLS+L     GKEDKIAV+VGTITDD R +EV
Sbjct  35   FLARRTESSFNATILKRLQTSRRNRPTLSLSKLARHMKGKEDKIAVVVGTITDDARLFEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRF++TARARI KAGG C+TFDQLAL+AP G
Sbjct  95   PQLTVCALRFSETARARIVKAGGSCMTFDQLALKAPTG  132



>ref|XP_006298641.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31539.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=134

 Score =   137 bits (345),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  250  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  429
            MSK NK PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+PA+KV ALRFT+ ARARIE
Sbjct  1    MSKVNKAPLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEIPAMKVTALRFTERARARIE  60

Query  430  KAGGECLTFDQLALRAPLG  486
            KAGGECLTFDQLALRAPLG
Sbjct  61   KAGGECLTFDQLALRAPLG  79



>ref|XP_004991895.1| ribosomal protein l18 [Salpingoeca rosetta]
 gb|EGD75438.1| ribosomal protein l18 [Salpingoeca rosetta]
Length=186

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT S FN V+LKR+FMSK ++PP+SLSR++    G+E  IAV+VGT+TDD R  E+
Sbjct  34   FLVRRTNSSFNKVVLKRMFMSKIHRPPMSLSRIVQNMKGREQLIAVIVGTVTDDPRMLEL  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALRF++TAR RI  AGGECLTFDQLALR+P G
Sbjct  94   PKLTVCALRFSETARKRILAAGGECLTFDQLALRSPKG  131



>gb|ACD65122.1| putative 60S ribosomal protein RPL18 [Novocrania anomala]
Length=132

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  366
            FL RRT +KFN ++LKRLFMSK+N+PPLSLSRL+      G+EDKI V+VGTITDD+R  
Sbjct  34   FLARRTNAKFNKIVLKRLFMSKSNRPPLSLSRLVRKMKLKGREDKITVVVGTITDDIRIT  93

Query  367  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAP  480
            ++P LKVCALR T  ARARI K+GG+ +TFDQLALRAP
Sbjct  94   DIPKLKVCALRLTSGARARILKSGGKIITFDQLALRAP  131



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   136 bits (343),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FN V+L+RLFMS+ N+PPLSLS+L++    +E KIAV+VGT+TDDVR  EV
Sbjct  34   FLARRTESSFNKVVLRRLFMSRINRPPLSLSKLMTHMKKQESKIAVIVGTVTDDVRVIEV  93

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L VCALR T++AR RI  AGGE +TFDQLALRAP G
Sbjct  94   PKLTVCALRVTESARKRILAAGGEIMTFDQLALRAPTG  131


 Score = 45.8 bits (107),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFG  200
            MGID++    +K+ +RTAP+S+D YL+LLVKLYRF  
Sbjct  1    MGIDIRHH-HAKKGRRTAPESEDPYLRLLVKLYRFLA  36



>ref|XP_009519518.1| hypothetical protein PHYSODRAFT_284882 [Phytophthora sojae]
 gb|EGZ24230.1| hypothetical protein PHYSODRAFT_284882 [Phytophthora sojae]
Length=192

 Score =   130 bits (326),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT +KFN ++L+RL+ S TN+ PLSL ++  F    E KIAV+VGT+TDD+R   V
Sbjct  36   FLARRTDAKFNDIVLRRLYQSNTNQAPLSLGKVARFMKKHEGKIAVVVGTVTDDIRLLNV  95

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P L V AL FT+TARARI KAGGECL+FDQLALRAP G
Sbjct  96   PKLSVVALNFTETARARIVKAGGECLSFDQLALRAPKG  133


 Score = 52.0 bits (123),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFF  197
            MGIDL AGGK    K RT PKSD+VYL LLV+LYRF 
Sbjct  1    MGIDLVAGGKVVGKKNRTNPKSDNVYLNLLVRLYRFL  37



>ref|XP_005704346.1| 60S ribosomal protein L18e [Galdieria sulphuraria]
 gb|EME27826.1| 60S ribosomal protein L18e [Galdieria sulphuraria]
Length=190

 Score =   128 bits (321),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FL RRT S FN  +LKRLFMS+ N+PPL L RL+  +    DKI V+VG + DD R YEV
Sbjct  35   FLARRTNSNFNKTVLKRLFMSRNNQPPLCLGRLVKLSRKNSDKIIVIVGKVLDDERLYEV  94

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            P + VC L+ + +ARARI+KAGGE LTFDQLALR+P G
Sbjct  95   PKMTVCCLKISDSARARIQKAGGEVLTFDQLALRSPKG  132


 Score = 53.5 bits (127),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  197
            MGIDL+ GG+ K+  RTAPKS++ YL LLVKLYRF 
Sbjct  1    MGIDLEKGGRIKKRNRTAPKSENPYLLLLVKLYRFL  36



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  372
            FLVRRT SK N  ILKRLFMSK N+PPLSLS+L  F   K  +I+ +VGTITDD R +EV
Sbjct  237  FLVRRTDSKVNETILKRLFMSKINRPPLSLSKLAKFA--KPGQISAVVGTITDDARMFEV  294

Query  373  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            PAL+VCALRFT+TARARI KAGGEC+TFDQLAL+AP G
Sbjct  295  PALRVCALRFTETARARIVKAGGECITFDQLALQAPTG  332


 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 7/53 (13%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSEAS  245
            + GID++AGG++K+  RTAPKS++VYLKLLVKLYRF        V+R DS+ +
Sbjct  202  SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFL-------VRRTDSKVN  247



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score =   137 bits (344),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  366
            FL RRT +KFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  64   FLARRTNAKFNKIILKRLFMSKIHRPPISLARVVRFMKKPGRENAIAVIVGTVTDDARIF  123

Query  367  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            E+P L VCALR T+ ARARI KAGGE +TFDQLALRAP G
Sbjct  124  EIPKLTVCALRITEKARARILKAGGELITFDQLALRAPTG  163


 Score = 44.3 bits (103),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEE  206
            MGID+      ++ +RT PKS DVYL+LLVKLYRF    
Sbjct  31   MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARR  68



>gb|ESA23412.1| hypothetical protein GLOINDRAFT_342179 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78030.1| ribosomal 60S subunit protein L18A [Rhizophagus irregularis DAOM 
197198w]
Length=183

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  94   VSI*KPEVRASRRSAQLPSPtmft*sfs*sftDFLVRRTGSKFNAVILKRLFMSKTNKPP  273
            + I K  VR   R+A  P               FL RRT SKFN+ ILKRLFMS+ N+PP
Sbjct  3    IDIKKHHVRRKNRTA--PKSEDVYLRLLVKIYRFLARRTNSKFNSAILKRLFMSRINRPP  60

Query  274  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  453
            +S+SR++   S K  K AV+VGT+TDD R  EVP L V ALRFTKTA+ARI KAGGE LT
Sbjct  61   MSISRIVRNLSNKPGKTAVIVGTVTDDNRVLEVPKLSVAALRFTKTAKARILKAGGEVLT  120

Query  454  FDQLALRAPLG  486
             DQLALRAP G
Sbjct  121  LDQLALRAPTG  131



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +1

Query  193  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  366
            FL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPGRENAIAVIVGTVTDDARIF  93

Query  367  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLG  486
            E+P L VCALR T+ ARARI KAGGE ++FDQLALRAP G
Sbjct  94   EIPKLTVCALRITERARARILKAGGELISFDQLALRAPTG  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960