BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024J17

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   2e-72   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    243   2e-72   Nicotiana tomentosiformis
emb|CDO97777.1|  unnamed protein product                                239   6e-71   Coffea canephora [robusta coffee]
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   2e-69   Nicotiana tomentosiformis
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    234   3e-69   Sesamum indicum [beniseed]
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   9e-69   Nicotiana sylvestris
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   1e-68   Nicotiana sylvestris
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   2e-67   Nicotiana sylvestris
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   3e-67   Nicotiana sylvestris
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   3e-67   
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    229   3e-67   
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                227   9e-67   Erythranthe guttata [common monkey flower]
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                227   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-66   Sesamum indicum [beniseed]
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   6e-66   Solanum lycopersicum
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   5e-65   Nicotiana tomentosiformis
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    218   2e-63   Vitis vinifera
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   6e-63   Solanum tuberosum [potatoes]
emb|CBI35784.3|  unnamed protein product                                215   4e-62   Vitis vinifera
gb|ABO31100.1|  ovule receptor-like kinase 28                           215   4e-62   Solanum chacoense
gb|EPS61932.1|  ovule receptor-like kinase 28                           211   8e-61   Genlisea aurea
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   4e-58   Solanum tuberosum [potatoes]
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    203   6e-58   Solanum lycopersicum
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    199   2e-56   Populus euphratica
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    191   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    191   1e-53   
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         191   2e-53   Jatropha curcas
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             191   2e-53   Eutrema salsugineum [saltwater cress]
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    191   2e-53   Isatis tinctoria [woad]
emb|CDY36601.1|  BnaC06g06540D                                          191   3e-53   Brassica napus [oilseed rape]
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   4e-53   Camelina sativa [gold-of-pleasure]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  190   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  190   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    190   4e-53   Camelina sativa [gold-of-pleasure]
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    190   5e-53   Arabis alpina [alpine rockcress]
emb|CDY24077.1|  BnaA06g00750D                                          190   5e-53   Brassica napus [oilseed rape]
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    190   5e-53   Brassica rapa
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    189   6e-53   Brassica rapa
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             188   2e-52   Capsella rubella
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    188   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   4e-52   Malus domestica [apple tree]
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   6e-52   
gb|AAG51973.1|AC024260_11  leucine-rich repeat transmembrane prot...    184   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489831.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    187   7e-52   Prunus mume [ume]
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   7e-52   Phoenix dactylifera
emb|CDY02495.1|  BnaA08g01020D                                          186   7e-52   
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    186   8e-52   Tarenaya hassleriana [spider flower]
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    186   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             186   2e-51   Capsella rubella
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    185   2e-51   Arabis alpina [alpine rockcress]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             185   2e-51   Citrus clementina [clementine]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010655240.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   3e-51   
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   3e-51   Eucalyptus grandis [rose gum]
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             185   3e-51   
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   4e-51   Vitis vinifera
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    184   5e-51   
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          184   5e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CBI18374.3|  unnamed protein product                                184   6e-51   Vitis vinifera
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       184   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   7e-51   Populus euphratica
emb|CDY25686.1|  BnaC03g69890D                                          184   7e-51   Brassica napus [oilseed rape]
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    183   8e-51   
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     183   9e-51   Eucalyptus grandis [rose gum]
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    183   1e-50   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   5e-50   Populus euphratica
ref|XP_002513297.1|  strubbelig receptor, putative                      181   5e-50   
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   2e-49   Citrus sinensis [apfelsine]
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    180   2e-49   Fragaria vesca subsp. vesca
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   2e-49   
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   2e-49   Cucumis melo [Oriental melon]
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             179   3e-49   Prunus persica
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    178   6e-49   
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    178   7e-49   Zea mays [maize]
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         178   7e-49   Jatropha curcas
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   8e-49   Populus euphratica
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   8e-49   
gb|KDO67050.1|  hypothetical protein CISIN_1g040888mg                   175   1e-48   Citrus sinensis [apfelsine]
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   1e-48   
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             177   1e-48   
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   1e-48   Cucumis sativus [cucumbers]
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    177   2e-48   Brassica rapa
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                177   2e-48   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDX97567.1|  BnaA05g25120D                                          177   2e-48   
gb|KHG25534.1|  protein strubbelig-receptor family 6                    176   3e-48   Gossypium arboreum [tree cotton]
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   3e-48   Elaeis guineensis
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   8e-48   
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   9e-48   Citrus sinensis [apfelsine]
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             175   1e-47   
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               174   1e-47   Morus notabilis
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             174   2e-47   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB67061.1|  hypothetical protein B456_010G172500                    173   4e-47   Gossypium raimondii
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             173   4e-47   Eutrema salsugineum [saltwater cress]
gb|KJB67062.1|  hypothetical protein B456_010G172500                    173   4e-47   Gossypium raimondii
gb|KJB57112.1|  hypothetical protein B456_009G148500                    173   5e-47   Gossypium raimondii
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    172   8e-47   Fragaria vesca subsp. vesca
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             172   8e-47   
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   9e-47   Tarenaya hassleriana [spider flower]
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    172   9e-47   Gossypium arboreum [tree cotton]
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                172   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   1e-46   
ref|XP_006845114.1|  hypothetical protein AMTR_s00005p00184180          161   2e-46   
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    171   2e-46   
gb|EEC81030.1|  hypothetical protein OsI_23812                          170   4e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   4e-46   Brassica rapa
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   4e-46   
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   4e-46   Zea mays [maize]
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   5e-46   Populus euphratica
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   5e-46   Zea mays [maize]
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 170   5e-46   Medicago truncatula
ref|XP_008649051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   7e-46   Zea mays [maize]
ref|XP_008649052.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   7e-46   Zea mays [maize]
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     169   7e-46   Eucalyptus grandis [rose gum]
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    169   8e-46   Prunus mume [ume]
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   8e-46   
gb|KJB67277.1|  hypothetical protein B456_010G183400                    169   9e-46   Gossypium raimondii
gb|EEC85048.1|  hypothetical protein OsI_32379                          169   9e-46   Oryza sativa Indica Group [Indian rice]
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       169   9e-46   Cucumis sativus [cucumbers]
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   9e-46   Eucalyptus grandis [rose gum]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-45   Eucalyptus grandis [rose gum]
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       169   1e-45   Cucumis sativus [cucumbers]
gb|KJB67280.1|  hypothetical protein B456_010G183400                    169   1e-45   Gossypium raimondii
emb|CDY39110.1|  BnaA01g29460D                                          169   1e-45   Brassica napus [oilseed rape]
emb|CDX98445.1|  BnaC05g39300D                                          169   1e-45   
gb|KJB67278.1|  hypothetical protein B456_010G183400                    169   1e-45   Gossypium raimondii
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-45   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    169   1e-45   Gossypium raimondii
ref|XP_007139054.1|  hypothetical protein PHAVU_009G260900g             167   2e-45   Phaseolus vulgaris [French bean]
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   2e-45   Setaria italica
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          168   2e-45   Amborella trichopoda
gb|EEE70214.1|  hypothetical protein OsJ_30326                          168   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    168   3e-45   Sesamum indicum [beniseed]
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   3e-45   Glycine max [soybeans]
ref|NP_001063921.1|  Os09g0559900                                       168   3e-45   
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_010913801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   3e-45   Elaeis guineensis
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             168   3e-45   Phaseolus vulgaris [French bean]
ref|XP_007023606.1|  Strubbelig-receptor family 5 isoform 2             169   3e-45   
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          167   4e-45   Sorghum bicolor [broomcorn]
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   5e-45   Elaeis guineensis
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             169   5e-45   
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             167   6e-45   Phaseolus vulgaris [French bean]
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   6e-45   Phoenix dactylifera
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             167   7e-45   
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 167   7e-45   
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-45   
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-45   Cucumis melo [Oriental melon]
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-45   Zea mays [maize]
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    167   9e-45   Glycine soja [wild soybean]
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          166   1e-44   Sorghum bicolor [broomcorn]
gb|EPS68087.1|  hypothetical protein M569_06686                         166   1e-44   Genlisea aurea
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             166   1e-44   
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         166   1e-44   Jatropha curcas
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    166   1e-44   Glycine soja [wild soybean]
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      166   1e-44   
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   2e-44   
gb|KGN45432.1|  hypothetical protein Csa_7G447940                       159   2e-44   Cucumis sativus [cucumbers]
ref|XP_006425179.1|  hypothetical protein CICLE_v10030356mg             165   2e-44   
ref|XP_004159013.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   2e-44   
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    165   2e-44   Cucumis sativus [cucumbers]
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   2e-44   Zea mays [maize]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   2e-44   Nelumbo nucifera [Indian lotus]
dbj|BAK07184.1|  predicted protein                                      165   4e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG18134.1|  protein strubbelig-receptor family 6                    164   5e-44   Gossypium arboreum [tree cotton]
emb|CDY33226.1|  BnaC01g36990D                                          164   5e-44   Brassica napus [oilseed rape]
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   5e-44   
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   6e-44   Cicer arietinum [garbanzo]
ref|XP_007024796.1|  Strubbelig-receptor family 6                       164   7e-44   
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   7e-44   
gb|KJB69229.1|  hypothetical protein B456_011G011800                    163   8e-44   Gossypium raimondii
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    164   8e-44   
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    164   8e-44   Vitis vinifera
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      164   8e-44   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   9e-44   Zea mays [maize]
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      164   1e-43   
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   1e-43   
gb|KJB69230.1|  hypothetical protein B456_011G011800                    163   1e-43   Gossypium raimondii
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             163   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-43   
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-43   Glycine max [soybeans]
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    163   1e-43   Zea mays [maize]
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001174920.1|  Os06g0634500                                       153   2e-43   
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    163   2e-43   Brachypodium distachyon [annual false brome]
gb|KJB70030.1|  hypothetical protein B456_011G054100                    163   2e-43   Gossypium raimondii
gb|KJB69228.1|  hypothetical protein B456_011G011800                    162   3e-43   Gossypium raimondii
gb|KHG11352.1|  protein strubbelig-receptor family 8                    162   4e-43   Gossypium arboreum [tree cotton]
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        162   4e-43   Glycine soja [wild soybean]
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   4e-43   
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    162   4e-43   Gossypium arboreum [tree cotton]
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             162   4e-43   Phaseolus vulgaris [French bean]
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          162   5e-43   Sorghum bicolor [broomcorn]
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    161   5e-43   
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               162   6e-43   
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   6e-43   Nelumbo nucifera [Indian lotus]
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    161   6e-43   Setaria italica
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   6e-43   Elaeis guineensis
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    160   1e-42   Populus euphratica
gb|EAY90345.1|  hypothetical protein OsI_11922                          161   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   1e-42   Glycine max [soybeans]
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    160   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   2e-42   Setaria italica
emb|CDX88495.1|  BnaC06g39390D                                          160   2e-42   
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   2e-42   Cucumis melo [Oriental melon]
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   2e-42   Glycine max [soybeans]
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    159   2e-42   Brassica rapa
emb|CDX87418.1|  BnaA07g34550D                                          159   3e-42   
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   3e-42   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             159   3e-42   
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          160   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   4e-42   Elaeis guineensis
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   5e-42   Solanum lycopersicum
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   5e-42   Solanum lycopersicum
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   5e-42   Phoenix dactylifera
gb|KJB56462.1|  hypothetical protein B456_009G120500                    159   7e-42   Gossypium raimondii
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          158   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049184.1|  Os03g0183800                                       158   9e-42   
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    158   1e-41   Populus euphratica
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    160   1e-41   Brachypodium distachyon [annual false brome]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    158   1e-41   Cucumis sativus [cucumbers]
gb|KDO78353.1|  hypothetical protein CISIN_1g005001mg                   155   1e-41   Citrus sinensis [apfelsine]
emb|CDP04441.1|  unnamed protein product                                158   1e-41   Coffea canephora [robusta coffee]
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    158   1e-41   Zea mays [maize]
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      158   1e-41   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    158   1e-41   Setaria italica
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-41   
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-41   Populus euphratica
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-41   Setaria italica
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-41   
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-41   Oryza brachyantha
gb|KDO78351.1|  hypothetical protein CISIN_1g005001mg                   156   3e-41   Citrus sinensis [apfelsine]
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO78348.1|  hypothetical protein CISIN_1g005001mg                   156   3e-41   Citrus sinensis [apfelsine]
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    157   3e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO78349.1|  hypothetical protein CISIN_1g005001mg                   156   3e-41   Citrus sinensis [apfelsine]
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      156   3e-41   Zea mays [maize]
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               156   4e-41   
ref|XP_006449792.1|  hypothetical protein CICLE_v10014418mg             155   4e-41   
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   5e-41   Citrus sinensis [apfelsine]
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   6e-41   
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   6e-41   Citrus sinensis [apfelsine]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   156   6e-41   Citrus sinensis [apfelsine]
ref|XP_002889223.1|  ATP binding protein                                155   7e-41   
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   8e-41   
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    155   8e-41   Arabis alpina [alpine rockcress]
gb|EEE67594.1|  hypothetical protein OsJ_25142                          155   8e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    155   8e-41   Medicago truncatula
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             155   9e-41   Citrus clementina [clementine]
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    155   1e-40   Nicotiana tomentosiformis
emb|CDX79126.1|  BnaA01g11930D                                          155   1e-40   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   1e-40   
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    155   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    155   1e-40   Fragaria vesca subsp. vesca
ref|NP_001060286.1|  Os07g0618400                                       155   1e-40   
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    155   1e-40   Brassica rapa
ref|XP_009146553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    155   1e-40   Brassica rapa
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    155   2e-40   Solanum lycopersicum
gb|EEC82450.1|  hypothetical protein OsI_26884                          155   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   2e-40   
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             154   3e-40   Capsella rubella
emb|CDX82908.1|  BnaC01g13580D                                          154   3e-40   
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   3e-40   
gb|KFK38641.1|  hypothetical protein AALP_AA3G141300                    154   3e-40   
ref|XP_010429764.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   3e-40   
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   4e-40   
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   5e-40   
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   5e-40   
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   6e-40   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   6e-40   
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             153   7e-40   
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  153   8e-40   
ref|XP_006383865.1|  hypothetical protein POPTR_0004s00710g             151   9e-40   
dbj|BAK02781.1|  predicted protein                                      153   9e-40   
emb|CDY44024.1|  BnaA05g26190D                                          152   9e-40   
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   1e-39   
ref|XP_002869840.1|  kinase                                             152   1e-39   
gb|KEH24658.1|  strubbelig-receptor family protein                      152   1e-39   
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             151   1e-39   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   1e-39   
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   1e-39   
emb|CDO97730.1|  unnamed protein product                                152   1e-39   
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    152   1e-39   
emb|CDY43376.1|  BnaA01g30070D                                          152   1e-39   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   2e-39   
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   2e-39   
emb|CDY23563.1|  BnaC05g40310D                                          151   2e-39   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             151   2e-39   
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             151   3e-39   
gb|EPS69681.1|  hypothetical protein M569_05081                         151   3e-39   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    151   3e-39   
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    151   4e-39   
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    151   4e-39   
ref|NP_566444.4|  STRUBBELIG-receptor family 4                          150   5e-39   
gb|KEH36931.1|  strubbelig-receptor family protein                      150   8e-39   
ref|NP_001064502.1|  Os10g0389800                                       150   8e-39   
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             150   9e-39   
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   9e-39   
gb|EEC66871.1|  hypothetical protein OsI_33412                          150   1e-38   
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   1e-38   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   1e-38   
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    150   1e-38   
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   1e-38   
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   1e-38   
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-38   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-38   
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    148   2e-38   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-38   
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          149   2e-38   
gb|KCW90298.1|  hypothetical protein EUGRSUZ_A02440                     148   4e-38   
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   4e-38   
ref|XP_010057986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    148   4e-38   
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   4e-38   
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    148   5e-38   
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    148   6e-38   
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   6e-38   
emb|CDX76385.1|  BnaA08g10150D                                          147   6e-38   
gb|EYU39916.1|  hypothetical protein MIMGU_mgv1a001954mg                148   6e-38   
emb|CDY27444.1|  BnaC03g64840D                                          147   6e-38   
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   6e-38   
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   7e-38   
tpg|DAA46921.1|  TPA: putative STRUBBELIG family receptor protein...    144   7e-38   
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             147   1e-37   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   1e-37   
ref|XP_006850050.1|  hypothetical protein AMTR_s00022p00198910          146   2e-37   
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    145   3e-37   
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    145   3e-37   
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    145   3e-37   
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          145   3e-37   
tpg|DAA46922.1|  TPA: putative STRUBBELIG family receptor protein...    145   4e-37   
emb|CDX98961.1|  BnaC09g48740D                                          145   6e-37   
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     145   8e-37   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     144   9e-37   
ref|XP_009122296.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    144   1e-36   
emb|CDX70063.1|  BnaA10g24120D                                          144   1e-36   
ref|XP_010914020.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    144   2e-36   
ref|XP_002532341.1|  Receptor protein kinase CLAVATA1 precursor, ...    143   3e-36   
ref|XP_010552382.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    142   3e-36   
dbj|BAG99361.1|  unnamed protein product                                142   4e-36   
gb|KDO50163.1|  hypothetical protein CISIN_1g039558mg                   142   6e-36   
ref|XP_006492890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    142   7e-36   
gb|KDP24601.1|  hypothetical protein JCGZ_25517                         142   7e-36   
ref|XP_006399158.1|  hypothetical protein EUTSA_v10012782mg             142   9e-36   
ref|XP_002316560.2|  hypothetical protein POPTR_0011s01540g             140   1e-35   
dbj|BAB01397.1|  protein kinase-like protein                            143   1e-35   
dbj|BAK05038.1|  predicted protein                                      141   2e-35   
ref|XP_002882805.1|  predicted protein                                  142   2e-35   
gb|KFK25072.1|  hypothetical protein AALP_AA8G062600                    140   3e-35   
ref|XP_010534354.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   6e-35   
ref|XP_010534352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   6e-35   
ref|XP_006429833.1|  hypothetical protein CICLE_v10013344mg             139   8e-35   
gb|ACI49786.1|  At3g13065                                               138   8e-35   
ref|XP_010557935.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   9e-35   
ref|XP_011468063.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   1e-34   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   4e-34   
ref|XP_007204855.1|  hypothetical protein PRUPE_ppa026263mg             137   5e-34   
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   6e-34   
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    136   7e-34   
gb|EEC72655.1|  hypothetical protein OsI_06182                          136   1e-33   
ref|NP_001046150.1|  Os02g0190500                                       135   1e-33   
ref|XP_010456423.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   3e-33   
ref|XP_011075267.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    134   6e-33   
ref|XP_011004818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    134   6e-33   
ref|XP_008443075.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    133   1e-32   
ref|XP_004136737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   
gb|AAC27896.1|  leucine-rich repeat transmembrane protein kinase 3      130   1e-32   
ref|XP_009797583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   2e-32   
ref|NP_196300.1|  STRUBBELIG-receptor family 2                          132   2e-32   
ref|XP_008241034.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    132   2e-32   
ref|XP_010423292.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   
ref|XP_010672691.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    132   2e-32   
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    132   3e-32   
ref|XP_009612111.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    132   3e-32   
ref|XP_010491264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   4e-32   
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      131   4e-32   
ref|XP_010423291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    131   5e-32   
ref|XP_006287140.1|  hypothetical protein CARUB_v10000312mg             131   6e-32   
ref|XP_002871232.1|  hypothetical protein ARALYDRAFT_908613             131   7e-32   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    130   1e-31   
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   2e-31   
gb|KGN59317.1|  hypothetical protein Csa_3G809930                       129   3e-31   
emb|CDP20023.1|  unnamed protein product                                129   3e-31   
ref|XP_009370199.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   4e-31   
gb|KHN07244.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    129   6e-31   
ref|XP_007028952.1|  STRUBBELIG-receptor family 2, putative             129   6e-31   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    127   6e-31   
gb|EEE66066.1|  hypothetical protein OsJ_22073                          128   7e-31   
gb|KHG09080.1|  protein strubbelig-receptor family 5                    127   1e-30   
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              127   1e-30   
emb|CDP11378.1|  unnamed protein product                                123   2e-30   
ref|XP_006589916.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    126   2e-30   
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    126   3e-30   
ref|XP_008392158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    126   4e-30   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      127   4e-30   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    126   4e-30   
ref|XP_002308374.2|  leucine-rich repeat transmembrane protein ki...    126   4e-30   
gb|KHN28754.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    126   4e-30   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    127   4e-30   
ref|XP_008245351.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   5e-30   
ref|XP_010257427.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   5e-30   
ref|XP_010257424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   6e-30   
ref|XP_011468043.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   1e-29   
ref|XP_009376134.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    124   2e-29   
ref|XP_007145665.1|  hypothetical protein PHAVU_007G258000g             123   4e-29   
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               123   4e-29   
ref|XP_010236315.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   7e-29   
ref|XP_010557936.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   9e-29   
ref|XP_010102562.1|  hypothetical protein L484_018034                   119   1e-28   
ref|XP_004155578.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   1e-28   
gb|EPS64024.1|  hypothetical protein M569_10757                         122   1e-28   
ref|XP_004134722.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   1e-28   
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    122   2e-28   
gb|KEH41669.1|  strubbelig-receptor family 2 protein                    121   2e-28   
ref|XP_002451714.1|  hypothetical protein SORBIDRAFT_04g006475          121   2e-28   
ref|XP_010533880.1|  PREDICTED: protein STRUBBELIG                      121   2e-28   
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    121   2e-28   
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    121   2e-28   
ref|XP_001783845.1|  predicted protein                                  121   3e-28   
emb|CBI30038.3|  unnamed protein product                                120   3e-28   
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          119   4e-28   
ref|XP_010257426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    120   5e-28   
ref|XP_004507203.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    119   1e-27   
ref|XP_010476010.1|  PREDICTED: protein STRUBBELIG-like                 114   1e-27   
ref|XP_010456422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    112   1e-27   
ref|XP_006467860.1|  PREDICTED: protein STRUBBELIG-like                 119   2e-27   
ref|XP_010654321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    118   2e-27   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    117   3e-27   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative       117   4e-27   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    117   4e-27   
ref|XP_006449268.1|  hypothetical protein CICLE_v10014419mg             117   7e-27   
ref|XP_006582789.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    117   9e-27   
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             116   9e-27   
gb|KHN41147.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    116   1e-26   
gb|KHN22911.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    116   2e-26   
ref|XP_010458496.1|  PREDICTED: protein STRUBBELIG                      115   3e-26   
gb|KHG18089.1|  Protein STRUBBELIG -like protein                        115   3e-26   
gb|KHG30271.1|  protein strubbelig-receptor family 3                    108   4e-26   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    114   5e-26   
ref|XP_010492393.1|  PREDICTED: protein STRUBBELIG-like                 114   6e-26   
emb|CDP14731.1|  unnamed protein product                                114   7e-26   
ref|XP_010556827.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    114   7e-26   
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    113   1e-25   
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    113   1e-25   
gb|AFW66318.1|  putative STRUBBELIG family receptor protein kinase      112   1e-25   
ref|XP_010476014.1|  PREDICTED: protein STRUBBELIG-like                 113   2e-25   
ref|XP_003541551.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    113   2e-25   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                         113   2e-25   
ref|XP_006594332.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    112   2e-25   
gb|KJB69458.1|  hypothetical protein B456_011G024500                    112   2e-25   
gb|AFW66206.1|  putative STRUBBELIG family receptor protein kinase      110   2e-25   
gb|KJB69459.1|  hypothetical protein B456_011G024500                    112   3e-25   
ref|XP_008680888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    112   3e-25   
ref|XP_010317941.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    112   5e-25   
gb|KEH39082.1|  strubbelig receptor family protein                      111   6e-25   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   6e-25   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   7e-25   
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          111   7e-25   
gb|KEH29624.1|  strubbelig receptor family protein                      111   8e-25   
gb|KEH39081.1|  strubbelig receptor family protein                      111   8e-25   
gb|KEH29625.1|  strubbelig receptor family protein                      111   8e-25   
ref|XP_008646743.1|  PREDICTED: protein STRUBBELIG-like                 110   9e-25   
ref|XP_004497928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   9e-25   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   1e-24   
ref|XP_010905455.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   1e-24   
ref|XP_011468064.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|XP_010905439.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|NP_001169655.1|  uncharacterized LOC100383536 precursor             110   1e-24   
ref|XP_008658775.1|  PREDICTED: uncharacterized LOC100381650 isof...    110   1e-24   
ref|XP_002889850.1|  hypothetical protein ARALYDRAFT_888407             110   1e-24   
ref|XP_008371312.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    110   1e-24   
ref|XP_008679889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|XP_008658773.1|  PREDICTED: uncharacterized LOC100381650 isof...    110   1e-24   
ref|XP_004485734.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|XP_006648415.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|XP_008658776.1|  PREDICTED: uncharacterized LOC100381650 isof...    110   1e-24   
emb|CDY19342.1|  BnaC05g08510D                                          110   1e-24   
ref|XP_007132645.1|  hypothetical protein PHAVU_011G112700g             110   2e-24   
ref|XP_007159275.1|  hypothetical protein PHAVU_002G224200g             110   2e-24   
ref|XP_008443076.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   2e-24   
ref|XP_002453383.1|  hypothetical protein SORBIDRAFT_04g005115          110   2e-24   
ref|XP_003528433.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   2e-24   
emb|CDX97936.1|  BnaA06g06870D                                          110   2e-24   



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  61   IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  237
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLN  171



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  61   IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  237
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLN  171



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +1

Query  19   MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  198
            MRE+  L  AVALL   LL  P    ADTDP DA+VL  L+ SLNSP QLTKW  NGGDP
Sbjct  1    MREV-ELAAAVALLGCILLLGPSFTNADTDPNDAAVLFDLYKSLNSPSQLTKWNPNGGDP  59

Query  199  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  378
            C E+WKG++CSG+RVTEI++SGL LTGSMGF+LD+LKSVT FDIS NNLGN LP+QLP N
Sbjct  60   CNENWKGITCSGSRVTEIKLSGLGLTGSMGFELDKLKSVTNFDISNNNLGNQLPFQLPQN  119

Query  379  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            VQ+LNLAGNGF GGLPYS+SQM  L+YLNVSHNQ QG+++ MF SLT+LS
Sbjct  120  VQQLNLAGNGFNGGLPYSVSQMTSLKYLNVSHNQFQGQLSDMFASLTSLS  169



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP+DASVLR L++SLNSP QLTKW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  25   DTDPSDASVLRVLYTSLNSPAQLTKWSANGGDPCGESWTGITCSGNRVTEIKISGLGLSG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF GGLPYSISQM  L+Y
Sbjct  85   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFNGGLPYSISQMTSLQY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNL  525
            LNVSHNQ+QG VTV F SL+ L
Sbjct  145  LNVSHNQIQGSVTVAFDSLSAL  166



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  52   ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  231
            ALLIG     P S  ADTDPTDAS L  +++SLNSPP LT W  NGGDPCGESWKGVSCS
Sbjct  18   ALLIGI----PSSTNADTDPTDASTLNIMYTSLNSPPLLTNWKPNGGDPCGESWKGVSCS  73

Query  232  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  411
            G++VTEI+I GL LTG+MG+QLD+L SVTTFDIS NNLGN +P+QLPPNVQ+LNLAGNGF
Sbjct  74   GSKVTEIKIPGLGLTGNMGYQLDRLTSVTTFDISNNNLGNQIPFQLPPNVQRLNLAGNGF  133

Query  412  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             GGLPYSIS M  L YLNVSHNQ+QG+V V F SLT+LS
Sbjct  134  NGGLPYSISLMTSLRYLNVSHNQIQGQVNVQFNSLTSLS  172



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 133/164 (81%), Gaps = 9/164 (5%)
 Frame = +1

Query  61   IGFLLNAPPSAVA---------DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESW  213
            + FLL     AVA         +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW
Sbjct  1    MRFLLQVMVVAVALFFSSANGTETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESW  60

Query  214  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  393
             G++CSGNRVTEI+ISGL L+GSMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LN
Sbjct  61   TGITCSGNRVTEIKISGLALSGSMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLN  120

Query  394  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            LA +GF+GGLPYSISQM  L+YLNVSHNQ+QG VTV F SL+ L
Sbjct  121  LAASGFSGGLPYSISQMTSLQYLNVSHNQIQGSVTVAFDSLSAL  164



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  16   ETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSG  75

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  76   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  135

Query  460  LNVSHNQLQGEVTVMFVSLTNL  525
            LNVSHNQ+QG VTV F SL+ L
Sbjct  136  LNVSHNQIQGSVTVAFDSLSAL  157



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVS  225
            VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG++
Sbjct  11   VALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGIT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA N
Sbjct  68   CSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAAN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L
Sbjct  128  GFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSL  167



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVS  225
            VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG++
Sbjct  11   VALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGIT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA N
Sbjct  68   CSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAAN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L
Sbjct  128  GFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSL  167



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGE  207
            M L   VALL  F+L+      ADTDP+D S LR ++SSLNSP QLTKW++ +GGDPCGE
Sbjct  26   MSLVVKVALLF-FILHGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSDGGDPCGE  84

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNV++
Sbjct  85   SWKGITCSGNRVTEIQISGLGLSGSMGYQLMSLTSVTNFDISNNNLGNQIPYQLPPNVKR  144

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L
Sbjct  145  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSL  190



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            ++LLIG LL     A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++C
Sbjct  6    LSLLIGILLYCAYCAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITC  65

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SGNRVTEI+ISGL L+GS+G+QL  L SVT FDIS NNLGN LP+QLPPNVQ+LNLA NG
Sbjct  66   SGNRVTEIKISGLGLSGSLGYQLTSLTSVTNFDISNNNLGNQLPFQLPPNVQRLNLAANG  125

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            F GGLPYSISQM  L YLNVSHNQ+QG+VTVMF SL++L
Sbjct  126  FNGGLPYSISQMTSLRYLNVSHNQIQGQVTVMFDSLSSL  164



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 4/166 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLT  162



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 4/166 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLT  162



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADTDP DAS L  L++SLNSP QLT W A+GGDPCGESWKG++CSG RVTEI ISGL L+
Sbjct  22   ADTDPADASALNILYTSLNSPQQLTNWKASGGDPCGESWKGITCSGTRVTEINISGLGLS  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G+MG+QLD+L SVTTFDIS NNLGN +PYQLPPNVQ+LNLAGNGFT GLPYSIS M  L+
Sbjct  82   GNMGYQLDKLTSVTTFDISNNNLGNQIPYQLPPNVQRLNLAGNGFTAGLPYSISLMTSLK  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLNVSHNQ+QG V + F SLT LS
Sbjct  142  YLNVSHNQIQGPVAISFGSLTALS  165



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGE  207
            M L   VALL  F+ N      ADTDP+D S LR ++SSLNSP QLTKW+++ GGDPCGE
Sbjct  1    MSLVVKVALLF-FIFNGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSEGGDPCGE  59

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FD+S NNLGN +PYQLPP V++
Sbjct  60   SWKGITCSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDLSNNNLGNQIPYQLPPYVKR  119

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L
Sbjct  120  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSL  165



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGNRVTEIQISGL  267
            A A TDP+DAS LR ++SSLNSP QLTKW +++G DPCGESWKG++C GNRV EI +SGL
Sbjct  22   ANAGTDPSDASALRVMYSSLNSPAQLTKWNSSDGSDPCGESWKGITCYGNRVNEIHLSGL  81

Query  268  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  447
             L+GSMG+QL  L SV  FDIS NNLGN +PYQLPPNVQKLNLAGNGFTGGLPYSISQMA
Sbjct  82   GLSGSMGYQLTSLTSVINFDISNNNLGNQIPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  141

Query  448  PLEYLNVSHNQLQGEVTVMFVSLTNL  525
             L+YLNVSHNQ+QGE+  MF SL++L
Sbjct  142  SLQYLNVSHNQIQGELNDMFGSLSSL  167



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            W + +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G+
Sbjct  5    WRMLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGI  64

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C G+RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAG
Sbjct  65   TCKGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAG  124

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NGF GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+
Sbjct  125  NGFNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLT  166



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLG  80

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            L YLNVSHNQ+QG+VTV F SL++L+
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSLN  166



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G++C G
Sbjct  3    VLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITCKG  62

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            +RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAGNGF 
Sbjct  63   SRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAGNGFN  122

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+
Sbjct  123  GGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLT  160



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGG+PCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGNPCGESWTGITCSGNRVTEIKISGLG  80

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNL  525
            L YLNVSHNQ+QG+VTV F SL++L
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSL  165



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 122/158 (77%), Gaps = 4/158 (3%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            LLIG       +A A TDPTDAS L  L++SLNSP QLT W + GGDPCGESW+GV+CSG
Sbjct  8    LLIGVF----SAAGATTDPTDASTLNALYASLNSPQQLTNWKSTGGDPCGESWRGVTCSG  63

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            +RVT+I ISGL LTG+MG+QL  L +VTTFDIS NNLGN +PYQLPPNVQ LNLAG  F 
Sbjct  64   SRVTQIVISGLGLTGNMGYQLLSLTAVTTFDISNNNLGNQIPYQLPPNVQTLNLAGCNFN  123

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             GLPYSIS M  L YLNVSHNQLQG+V V F SLT LS
Sbjct  124  NGLPYSISYMNSLGYLNVSHNQLQGQVNVQFGSLTALS  161



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP+DASVLR L+++LNSP QLTKW ANGGDPCGESW G++CSGN+VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWNANGGDPCGESWTGITCSGNKVTEIKMSGLGLSG  85

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G QLD LKSVT FDIS NN+G+ LPYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQLPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  460  LNVSHNQLQGEVTVMFVSLTNL  525
            LNVSHNQ+QG V V F SL+ L
Sbjct  146  LNVSHNQIQGSVVVSFDSLSAL  167



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP+DASVLR L+++LNSP QLTKW+ANGGDPCGESW G++CSGN VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWSANGGDPCGESWTGITCSGNNVTEIKLSGLGLSG  85

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G QLD LKSVT FDIS NN+G+ +PYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQIPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  460  LNVSHNQLQGEVTVMFVSLTNL  525
            LNVSHNQ+QG V V F  L+ L
Sbjct  146  LNVSHNQIQGSVIVSFDLLSAL  167



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPAQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLGLSGS  85

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QLD LK+VT  D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSISQM  L YL
Sbjct  86   LGYQLDSLKAVTNLDLSNNNLAGALPYQLPPNLQRLNLANNRLSGGIPYSISQMPSLTYL  145

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQLQ ++  MF  LT+LS
Sbjct  146  NLGHNQLQNQLGDMFGQLTSLS  167



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            L+I  L+ +P S   DTD  DAS L G+F+S+N+P QLT WTA+GGDPCG+SWKGV+CSG
Sbjct  8    LIISILVLSPSSINGDTDQADASALNGMFTSMNNPAQLTGWTASGGDPCGQSWKGVTCSG  67

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            +RVT+I++  L LTGS+G+QL  L S+T FD+S NN G SL Y LPPN+Q+LNLA   F 
Sbjct  68   SRVTQIKLPNLGLTGSLGYQLQSLTSLTDFDLSHNNFGGSLTYNLPPNLQRLNLANCSFN  127

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            G +PYSIS M PLE+L++SHNQ  G++TV +  L +LS
Sbjct  128  GQIPYSISLMKPLEHLDLSHNQFNGQLTVDYSQLPSLS  165



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPGQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLALSGS  85

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QLD L +    D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSIS M  L YL
Sbjct  86   LGYQLDSLTAAMNLDLSNNNLAGALPYQLPPNLQRLNLANNKLSGGIPYSISLMRSLTYL  145

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQLQ ++  MF  LT+LS
Sbjct  146  NLGHNQLQSQLGDMFGQLTSLS  167



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDP DAS LRG+F+SL SP QLT+W ANGGDPC ESWKGV+CSG RVTEI++SGL L+G
Sbjct  25   NTDPNDASALRGMFTSLGSPGQLTQWKANGGDPCEESWKGVTCSGPRVTEIKLSGLALSG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
             MG+QL  L ++T  D+S NN+G  +PY LPPN+ +LNLA N FTG +PYSIS M  L Y
Sbjct  85   QMGYQLASLTALTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQFTGDIPYSISMMTKLTY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN++HNQLQ ++  MF  L++LS
Sbjct  145  LNIAHNQLQNQLNDMFGKLSSLS  167



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 128/176 (73%), Gaps = 13/176 (7%)
 Frame = +1

Query  19   MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  180
            MRE     W V +      ++GF L     A   TD +D S L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWT  53

Query  181  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  360
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  54   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  113

Query  361  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+
Sbjct  114  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLT  169



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 123/167 (74%), Gaps = 8/167 (5%)
 Frame = +1

Query  43   WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            W V  L     +GF L     A   TD +D S L  LF+S++SP QLT+WTA+ GDPCG+
Sbjct  5    WVVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFTSMHSPAQLTQWTASAGDPCGQ  61

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            +W+GV+CSG RVT+I+I  L+L+G++G+ LD+L ++T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  62   NWRGVTCSGTRVTQIKIPSLELSGTLGYMLDRLTNLTELDLSSNNLGGDLPYQLPPNLQR  121

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N FTG   YSISQMAPL+YLN+ HNQ +G++ V F  LT+L+
Sbjct  122  LNLAYNQFTGAAQYSISQMAPLKYLNLGHNQFKGQIAVDFSKLTSLT  168



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGT  72

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSIT  169



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 8/167 (5%)
 Frame = +1

Query  43   WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLT  169



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLS  167



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLS  167



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 8/167 (5%)
 Frame = +1

Query  43   WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLT  169



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 8/167 (5%)
 Frame = +1

Query  43   WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  7    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  63

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  64   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  123

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  124  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLT  170



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 123/157 (78%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF    P     DTD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKG++CSG+
Sbjct  15   IVGF---EPTFINGDTDSSDTSALNTMFTSMNSPGQLSQWTASGGDPCGQNWKGITCSGS  71

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  +PYQLPPN+++LNLA N FTG
Sbjct  72   RVTQIKLSGLGLSGSIGFMLDKLTSVTEFDLSNNNLGGDIPYQLPPNLERLNLANNQFTG  131

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSIS M P++Y+N++HNQL+ ++ + F  LT+LS
Sbjct  132  SAQYSISMMTPIKYINLAHNQLK-QLAIDFTKLTSLS  167



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSIT  169



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CSG+
Sbjct  17   IVGFELRLIHGA---TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSGS  73

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT++++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG
Sbjct  74   RVTQLKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTG  133

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSIS MA L+YLN+ HNQ +G+V V F  LT+L+
Sbjct  134  AAQYSISNMASLKYLNLGHNQFKGQVAVDFSKLTSLT  170



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIYGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSIT  169



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 8/167 (5%)
 Frame = +1

Query  43   WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            W V  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WVVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIPIDFTKLNSLT  169



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            T+ TDAS LR ++SSLNS  QLT W++ GGDPCG SWKG++CSG  VTEI++SGL LTGS
Sbjct  35   TNETDASALRIMYSSLNSAAQLTGWSSAGGDPCGNSWKGITCSGQAVTEIKLSGLGLTGS  94

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+QL  L S+TT DIS N LGN +PYQLPPNVQ+LNLAGN F GG+PYSISQM  L+YL
Sbjct  95   MGYQLSSLTSLTTLDISNNFLGNQIPYQLPPNVQQLNLAGNSFNGGIPYSISQMTSLKYL  154

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHNQLQG++  MF  L+ L+
Sbjct  155  NISHNQLQGQLNDMFGQLSALT  176



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  79   APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  258
            +P S  A TDPTD S L+ L+SSLNSP QLT+W  NG DPCG+SWKGV CSG+RVTEI +
Sbjct  20   SPSSINAATDPTDVSALKVLYSSLNSPSQLTQWIQNGDDPCGQSWKGVKCSGSRVTEIDL  79

Query  259  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  438
            SGLQL+G++G+QL  L ++T  D+S NNL  ++PYQLPPN+ +LNL GN F   +PYSIS
Sbjct  80   SGLQLSGTLGYQLQTLTALTNLDMSNNNLAGTIPYQLPPNMTRLNLGGNNFNQDIPYSIS  139

Query  439  QMAPLEYLNVSHNQLQGEVTVMF  507
            Q+  L YLN+SHNQ+Q ++  MF
Sbjct  140  QITSLTYLNISHNQIQNQLGDMF  162



>ref|XP_010928729.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Elaeis 
guineensis]
Length=684

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +1

Query  37   LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  216
            LP  +A+ +G +     SA+A+TD  D S L  LF SLNSPPQLT W+++GGDPCGE WK
Sbjct  5    LPVLLAVALGLVF----SALAETDQDDVSALNVLFLSLNSPPQLTGWSSSGGDPCGEDWK  60

Query  217  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  396
            GV CS   VTEI ++ L LTGS+G+QL  L S+T FD+S NNL  ++PYQLPP V+ LNL
Sbjct  61   GVKCSDLSVTEISLADLGLTGSLGYQLSSLTSITYFDMSKNNLRGNIPYQLPPKVEHLNL  120

Query  397  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            A N FTGG+PYSISQM  L+YLN+  NQL G++  +F  LT LS
Sbjct  121  AENAFTGGIPYSISQMTDLKYLNLGKNQLNGQLNDIFGKLTRLS  164



>gb|AAG51973.1|AC024260_11 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-7611 [Arabidopsis thaliana]
Length=516

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  19   MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  183
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  184  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  360
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  361  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLT  169



>ref|XP_010489831.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=404

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +1

Query  82   PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  261
            P   +  TD +D S L  +F+S+NSP QL++WTA+GGDPCG++W+GV+CSG+RVT+I++ 
Sbjct  22   PSFILGATDASDTSALNIMFTSMNSPGQLSQWTASGGDPCGQNWRGVTCSGSRVTQIKLP  81

Query  262  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  441
             L L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS 
Sbjct  82   SLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISL  141

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  142  MAPLKYLNLAHNQLK-QLAIDFTKLTSLS  169



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 114/156 (73%), Gaps = 1/156 (1%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            W + +    +L   PS++ A TDP D S L+ L+SSLNSP QLT+W+ANG DPCG+SWKG
Sbjct  7    WVLLVFSICILGWSPSSINAATDPADVSALKALYSSLNSPSQLTQWSANGDDPCGQSWKG  66

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V CSG+RVTEI +S LQL+GS+   L  L S+T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTSLTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             N F  G+PYSISQ+  LEYLN+SHNQLQ +V  +F
Sbjct  127  ANNFNQGIPYSISQITSLEYLNISHNQLQNQVDDIF  162



>ref|XP_008781708.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Phoenix 
dactylifera]
Length=686

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A+TD  D S +  LF SLN+PPQLT W++ GGDPCG+ WKGV CSG+ VTEI +SGL 
Sbjct  19   AFAETDQGDVSAVNVLFKSLNAPPQLTGWSSTGGDPCGDDWKGVKCSGSSVTEISLSGLG  78

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            LTGS+G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGSLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            L+YLN+  NQL G++  +F  L  LS
Sbjct  139  LKYLNLHRNQLNGQLNDIFGKLDRLS  164



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CS +RVT++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSRSRVTQLKLSGLELSGT  88

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M  L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMVSLKYL  148

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQ +G+V V F  LT+L+
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLT  170



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            VALL   ++   P  +   TD +D S L  ++SS+NSP QL++W  +GGDPCGE WKGV+
Sbjct  9    VALLTLCIVGLEPRFINGATDSSDTSALNTMYSSMNSPSQLSEWKPSGGDPCGEHWKGVT  68

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+RVTE+++  L L+GS+G+ LD+L +VT FD+S NNLG  LPYQLPP VQ+LNLA N
Sbjct  69   CSGSRVTEVKLPNLGLSGSLGYMLDKLSAVTEFDLSNNNLGGDLPYQLPPAVQRLNLANN  128

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS MA L+YLN++HNQ +G++ V F  LT+L+
Sbjct  129  QFTGSAQYSISLMASLKYLNLAHNQFKGQLAVDFTKLTSLT  169



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF    P   +  TD +D S L  +F S+NSP QL++WTA+GGDPCG++WKGV+CSG+
Sbjct  18   IVGF---EPSFILGATDASDTSALNIMFISMNSPGQLSQWTASGGDPCGQNWKGVTCSGS  74

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I++ GL L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG
Sbjct  75   RVTQIKLPGLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTG  134

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  135  SAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLS  170



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +AL++  ++   PS +  DTD +D S L  LF+S+NSP QL++WTA+GGDPCG++W+GV+
Sbjct  8    LALVLLCIVGFEPSFIHGDTDASDTSALNSLFTSMNSPGQLSQWTASGGDPCGQNWRGVT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+RVT+I++  L L+GS+GF LD+L SVT  D+S NNLG  L YQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLSYQLPPNLERLNLANN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  128  QFTGSAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLS  167



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG+
Sbjct  16   ILGFELRFIHGA---TDSSDTSALNMLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGS  72

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVT+I+I GL+L+G++GF LD+L S+T  D+S+NNLG  LPY LPPN+++LNLA N FTG
Sbjct  73   RVTQIKIPGLELSGTLGFMLDRLTSLTELDLSSNNLGGDLPYPLPPNLEQLNLANNQFTG  132

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
               YSISQMA L+YLN+ HNQ  G + V F  LT+L+
Sbjct  133  TAQYSISQMASLKYLNLGHNQFTGNIGVDFTKLTSLT  169



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GS+G+QL  L ++T  D+S NN G  +PY +PPN+++L+L  N FTG +PYSISQM  L+
Sbjct  90   GSVGYQLSSLTALTNLDLSNNNFGGDIPYNIPPNLERLDLENNKFTGNVPYSISQMKTLK  149

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            Y+N++HNQLQG++  MF  L +LS
Sbjct  150  YVNIAHNQLQGQLNDMFGQLPSLS  173



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKGV+CSG R+T+I++ GL L+GS
Sbjct  30   TDASDTSALNTMFNSMNSPGQLSQWTASGGDPCGQNWKGVTCSGLRITQIKLPGLGLSGS  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YL
Sbjct  90   LGYMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKYL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N++HNQL+ ++ + F  LT+LS
Sbjct  150  NLAHNQLK-QLAIDFTKLTSLS  170



>ref|XP_009408730.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TD  D S L  ++SSLNSPPQLT W+++GGDPCG +WKG+ CSG+ VT+I +SGLQLTG
Sbjct  24   NTDQADVSALNVMYSSLNSPPQLTGWSSSGGDPCGNNWKGIKCSGSSVTKITLSGLQLTG  83

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            +MG+QL  L SVT FD+S NNL   +PYQLPPN   LNLAGN  TGG+PYS+SQM  L+Y
Sbjct  84   TMGYQLSSLISVTYFDLSKNNLNGDIPYQLPPNTTHLNLAGNALTGGIPYSVSQMNHLKY  143

Query  460  LNVSHNQLQGEVTVMF  507
            LN++ NQL G++T MF
Sbjct  144  LNLASNQLSGQLTDMF  159



>ref|XP_010655240.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X2 [Vitis 
vinifera]
Length=611

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLT  166



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +1

Query  16   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  195
            + +++M + + + L I  L +   S  ADTDP+DA+ L+ ++S LN P QLT+W+++GGD
Sbjct  7    RKKKMMSV-FLIMLEICILGSTFTSINADTDPSDAAALQDMYSFLNQPSQLTQWSSSGGD  65

Query  196  PCGESWKGVSCSGNRVTEIQISGLQLTGS-MGFQLDQLKSVTTFDISTNNLGNSLPYQLP  372
            PCG+SWKG++CSG+RVTEI++ GL L+GS +G++L  L SVT  D+S NNLG  LPY +P
Sbjct  66   PCGQSWKGITCSGSRVTEIKLPGLGLSGSSIGYKLQSLTSVTNLDLSNNNLGGQLPYGVP  125

Query  373  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            PNVQ+LNLA N FTG +P+SI+Q++ L+YLN+ HNQLQG +  MF  L++L
Sbjct  126  PNVQRLNLANNQFTGQIPWSIAQLSSLKYLNLGHNQLQGALNDMFGQLSSL  176



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 15/176 (9%)
 Frame = +1

Query  19   MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  180
            MRE     W V +      ++GF L     A   TD +D   L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASD--TLNTLFSSMHSPAQLTQWT  51

Query  181  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  360
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  52   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  111

Query  361  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+
Sbjct  112  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLT  167



>ref|XP_010655239.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Vitis 
vinifera]
Length=687

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLT  166



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = +1

Query  55   LLIGFLLN--------APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            L +GFLL         +P S  A TDPTD S L+ L+ SLNSPPQLT+W+ NG DPCG+S
Sbjct  30   LEVGFLLVFCICILGWSPSSINAATDPTDVSALKVLYGSLNSPPQLTQWSQNGDDPCGQS  89

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKGV CSG+RVTEI +SGLQL+G++G+QL  L ++T  D+S NNL   +PY LPPN+ +L
Sbjct  90   WKGVKCSGSRVTEIDLSGLQLSGTLGYQLQSLTALTNLDVSNNNLAGGIPYSLPPNMTRL  149

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
            NL  N F   +PYSIS +  L+YLN+SHNQLQ +++ +F
Sbjct  150  NLGHNNFNQDIPYSISMITTLKYLNISHNQLQNQLSDIF  188



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  19   MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  183
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  184  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  360
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  361  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLT  169



>emb|CBI18374.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLT  166



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  19   MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  183
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  184  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  360
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  361  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLT  169



>ref|XP_011011656.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=700

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  58   LIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            L+GFL+ +         + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ 
Sbjct  11   LVGFLIVSLGILTTFVHSKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQ  70

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+ VT+I++SGL LTGS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ N
Sbjct  71   CSGSSVTQIKLSGLGLTGSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNN  130

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GFTG +PYSISQM  L+YLN++HN++ G+++ MF  LT L
Sbjct  131  GFTGNVPYSISQMTKLQYLNLNHNKINGQLSDMFQKLTKL  170



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D S L  LF+S++SP QLT+WTA+GGDPC ++W+GV+CS +R+T++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFTSMHSPGQLTQWTASGGDPCVQNWRGVTCSKSRITQLKLSGLELSGT  88

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS MA L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMASLKYL  148

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQ +G+V V F  LT+L+
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLT  170



>ref|XP_002320001.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=681

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
            YLN++HN++ G+++ MF  LT L
Sbjct  142  YLNLNHNKINGQLSDMFQKLTKL  164



>gb|KCW53999.1| hypothetical protein EUGRSUZ_J03194, partial [Eucalyptus grandis]
Length=708

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  13   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  72

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  73   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  132

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+
Sbjct  133  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLA  172



>ref|XP_010034888.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Eucalyptus 
grandis]
Length=716

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  26   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  85

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  86   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  145

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+
Sbjct  146  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLA  185



>ref|XP_011012291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=694

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  58   LIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            L+GFL+ +         + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ 
Sbjct  5    LVGFLIVSLGILTTFVHSKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIH  64

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+ VT+I++ GL LTGS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ N
Sbjct  65   CSGSSVTQIKLPGLGLTGSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNN  124

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GFTG +PYSISQM  L+YLN++HN++ G+++ MF  LT L
Sbjct  125  GFTGNVPYSISQMTKLQYLNLNHNKINGQLSDMFQKLTKL  164



>ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis]
 gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis]
Length=694

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  58   LIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            L+GFL+ +       A + T+  D S L  +F+ LNSP QL+ W ++GGDPC +SW+G++
Sbjct  5    LVGFLIVSLGFLSTLAHSKTNSQDVSALNVMFTGLNSPSQLSGWKSSGGDPCDDSWEGIT  64

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+ VT+I++SGL L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ N
Sbjct  65   CSGSSVTQIKLSGLGLSGSMGYQLSNLKSVTYFDMSKNNLDNDIPYQLPPNTAHLDLSNN  124

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GF+G +PYSISQM  LEYLN+ HNQL G+++ MF  L  L
Sbjct  125  GFSGNVPYSISQMTDLEYLNLGHNQLNGQLSDMFQKLPKL  164



>ref|XP_009398614.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D S L  ++SSL+SP +LT W++ GGDPCG  WKG+ CSG+ VTEI++SGL LTG+
Sbjct  26   TDSSDVSALNVMYSSLSSPSKLTGWSSGGGDPCGNDWKGIKCSGSSVTEIKLSGLGLTGT  85

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+QL  L SVT FD+S NNL   +PYQLPPNV  +NLAGNG TGG+PYSISQM+ L+YL
Sbjct  86   MGYQLASLTSVTYFDLSKNNLNGDIPYQLPPNVTHINLAGNGLTGGIPYSISQMSDLKYL  145

Query  463  NVSHNQLQGEVTVMF  507
            N+++NQL G++  MF
Sbjct  146  NLANNQLSGQLIDMF  160



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GSMG+QL  L ++T  D+S NN G  +PY +P N+++L+L  N FTG +PY  SQM  L+
Sbjct  90   GSMGYQLSSLTALTNLDLSNNNFGPDIPYNVPQNLERLDLGNNKFTGNVPYYFSQMKTLK  149

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN++HNQLQG++  MF  L +LS
Sbjct  150  YLNIAHNQLQGQLNDMFGQLPSLS  173



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  258
            +P S  ADTDP+D S L  ++SSLNSP QLT+W+A+ GDPCG+SWKGV C+ +RVTEI +
Sbjct  20   SPISINADTDPSDVSALTVMYSSLNSPSQLTQWSASSGDPCGQSWKGVKCTRSRVTEIDL  79

Query  259  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  438
            SGL L+GS G+ L  L ++T  D+S NNL   +PY LPPN+ +LNL GN FT G+PYS+S
Sbjct  80   SGLGLSGSFGYNLQSLTALTNLDMSNNNLAGGIPYNLPPNLTRLNLGGNQFTQGIPYSVS  139

Query  439  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             M  L+YLN+SHNQLQ  +  +F  L++L+
Sbjct  140  MMTSLKYLNISHNQLQNTLDDVFGKLSSLT  169



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  315
            +FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SV
Sbjct  1    MFSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSV  60

Query  316  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  495
            T FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YLN++HNQL+ ++
Sbjct  61   TEFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLK-QL  119

Query  496  TVMFVSLTNLS  528
             + F  LT+LS
Sbjct  120  AIDFTKLTSLS  130



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHNQLQ +V  MF  L++L+
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLA  171



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHNQLQ +V  MF  L++L+
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLA  171



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            W + +L   +L   P ++ A TDP D S L+ L+SSLNSP QLT+W+A+G DPCG+SWKG
Sbjct  7    WVLLVLSICILGWSPGSINAATDPADVSALKTLYSSLNSPSQLTQWSASGDDPCGQSWKG  66

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V CSG+RVTEI +S LQL+GS+   L  L ++T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTALTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             N F  G+PYSIS +  LEYLN+SHNQLQ +V  +F
Sbjct  127  ANNFNQGIPYSISLITSLEYLNISHNQLQNQVDDIF  162



>ref|XP_008668240.1| PREDICTED: uncharacterized protein LOC100381414 isoform X2 [Zea 
mays]
Length=671

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  234
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            GG+PYSISQM  LE LN+  N L G++T MF  L  LS
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLS  173



>ref|XP_008668239.1| PREDICTED: uncharacterized protein LOC100381414 isoform X1 [Zea 
mays]
Length=685

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  234
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            GG+PYSISQM  LE LN+  N L G++T MF  L  LS
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLS  173



>gb|KDP25030.1| hypothetical protein JCGZ_22565 [Jatropha curcas]
Length=705

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A + T+  D S L  +F+SLNSP QL+ W ++GGDPCG+SW+G++CSG+ VT I++SGL 
Sbjct  26   AHSKTNSQDVSALNVMFTSLNSPSQLSNWKSSGGDPCGDSWEGITCSGSSVTTIRLSGLG  85

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN+  L+L+ N F+G +PYSISQM  
Sbjct  86   LSGSMGYQLSNLKSVTYFDMSKNNLKNDIPYQLPPNMAHLDLSNNDFSGSVPYSISQMND  145

Query  451  LEYLNVSHNQLQGEVTVMF  507
            LEYLN+ HN+L G+ + MF
Sbjct  146  LEYLNLGHNKLNGQASDMF  164



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 3/170 (2%)
 Frame = +1

Query  19   MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  198
            M    G+   V+LLI  +      A   TDP DAS LR ++SSLNSP QLT+W+ NG DP
Sbjct  2    MENWRGVEVLVSLLIVCIFGCVNGA---TDPNDASALRIMYSSLNSPGQLTQWSPNGDDP  58

Query  199  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  378
            CG++WKG+ CSG RVTEI++  L L+GS+G+QL  L +VT  D+S NNL  ++P QLPPN
Sbjct  59   CGQNWKGIICSGLRVTEIKLPSLGLSGSLGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPN  118

Query  379  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +Q+LNLA N F+GG+PYSISQ+  L+YLN+ HNQLQ ++  +F  L +LS
Sbjct  119  LQQLNLANNQFSGGIPYSISQLPSLKYLNLGHNQLQNQLGDVFRQLPSLS  168



>ref|XP_010245765.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Nelumbo 
nucifera]
Length=760

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  118  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  297
             S L  +++SLNSP +LT W ++GGDPCG+SWKG+ CSG+ V EI++SGL LTGS+G++L
Sbjct  81   VSALHVMYTSLNSPSKLTNWKSSGGDPCGDSWKGIKCSGSHVKEIKLSGLGLTGSLGYKL  140

Query  298  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  477
              L S+T FD+S NNL +S+PYQLPPNV  +NLAGN FTG +PYSISQM  L+YLN+ HN
Sbjct  141  SSLTSLTYFDLSNNNLKDSIPYQLPPNVLHINLAGNSFTGTVPYSISQMLNLKYLNLGHN  200

Query  478  QLQGEVTVMFVSLTNL  525
            QL G+++ MF  LT L
Sbjct  201  QLSGQLSDMFGHLTRL  216



>gb|KDO67050.1| hypothetical protein CISIN_1g040888mg, partial [Citrus sinensis]
Length=495

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V   I +L +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG++C
Sbjct  7    VGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGITC  66

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ N 
Sbjct  67   SGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSENQ  126

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
            F+G +PYSISQM+ L+YLN+  NQL G+++ MF
Sbjct  127  FSGTVPYSISQMSELKYLNLGSNQLNGQLSDMF  159



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHNQLQ +V  MF  L++L+
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLA  171



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 123/177 (69%), Gaps = 14/177 (8%)
 Frame = +1

Query  19   MRELMGLPWAVA------LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  180
            MRE     WAV       +++GF L     A   TD +D S L  LFS ++SP QLT+WT
Sbjct  1    MRE----NWAVVALFTLCIVVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWT  53

Query  181  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSL  357
            A  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G + LD+L S+T  D+S+NNLG  L
Sbjct  54   AAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDL  113

Query  358  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            PYQ PPN+Q+L LA N FTG   YSISQ+  L+YLN+ HNQ +G++ + F  L +L+
Sbjct  114  PYQFPPNLQRLYLANNQFTGAAAYSISQITTLKYLNLGHNQFKGQIAIDFTKLDSLT  170



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHNQLQ +V  MF  L++L+
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLA  171



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  280  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  453
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  454  EYLNVSHNQLQGEVTVMFVSLTNLS  528
            EYLN++HNQLQG +  MF SL+NL+
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLA  174



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  280  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  453
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  454  EYLNVSHNQLQGEVTVMFVSLTNLS  528
            EYLN++HNQLQG +  MF SL+NL+
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLA  174



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  14   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  73

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  74   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  133

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  134  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLS  173



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  10   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  69

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  70   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  129

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  130  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLS  169



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  14   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  73

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  74   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  133

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  134  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLS  173



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A TD  DAS L  +FSSLNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSSLNSPQQLTGWTANNGDPCGQSWKGVTCSDQRVTEIKLSNLA  81

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GSMG+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSMGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  451  LEYLNVSHNQLQGEVTVMF  507
            L+YLN++HNQLQ +++ MF
Sbjct  142  LQYLNLAHNQLQNQLSDMF  160



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = +1

Query  82   PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  261
            P  A  DTDP D S L GL++SL SP QLT WT+NGGDPCG+SW GV+CSG+ VT I++S
Sbjct  16   PSFANGDTDPADVSALNGLYNSLQSPGQLTGWTSNGGDPCGQSWLGVTCSGSAVTTIKLS  75

Query  262  GLQLTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPPNVQKLNLAGNGFTGGLPYSI  435
            GL L+G++G+Q+  + S+T  D+S N L  G  + Y LP N+++LNLAGN FTG +PYSI
Sbjct  76   GLGLSGTLGYQMLSMTSLTELDMSNNKLGGGQQITYNLPLNLERLNLAGNQFTGNVPYSI  135

Query  436  SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            SQM PL+YLN+  NQLQG +  MF  LTNL+
Sbjct  136  SQMVPLKYLNLGRNQLQGSLNDMFGQLTNLT  166



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = +1

Query  13   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  192
            ++ + ++G+ WAV   I ++ N P  A   TD  D S L  L+ SL SP QLT W ++GG
Sbjct  6    VREKRMVGI-WAVLACI-WVWN-PSVANGATDSADVSALNVLYRSLQSPGQLTGWNSSGG  62

Query  193  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQ  366
            DPC +SW GV+CSG+ VT I++SGL+L+GS+G+Q+  + S+T  D+S NNL  G  +PY 
Sbjct  63   DPCEQSWLGVTCSGSAVTAIKLSGLELSGSLGYQMSSMTSLTELDMSNNNLGGGQQIPYN  122

Query  367  LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LPPN+++LNLAGN F G +PYSIS++ PL+YLN+ HNQLQG ++ MF  LTNL+
Sbjct  123  LPPNLERLNLAGNQFAGNVPYSISRIVPLKYLNLGHNQLQGNLSDMFGQLTNLT  176



>ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Citrus 
sinensis]
Length=696

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 115/155 (74%), Gaps = 4/155 (3%)
 Frame = +1

Query  55   LLIGFLL----NAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            LL+GF +    +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG+
Sbjct  5    LLVGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGI  64

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CSG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ 
Sbjct  65   TCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSE  124

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
            N F+G +PYSISQM+ L+YLN+  NQL G+++ MF
Sbjct  125  NQFSGTVPYSISQMSELKYLNLGSNQLNGQLSDMF  159



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WT +GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNTMFSSMNSPGQLSQWTTSGGDPCGQNWKGIT  67

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S NN+G  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSNNNIGGDLPYQLPPNLERLNLANN  127

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLS  167



>ref|XP_010087069.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
 gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
Length=697

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            + L I F        ++ T+  D S L  +++SLNSP QL+ W ++GGDPCG+SW+G+ C
Sbjct  6    LGLWIVFFGVIATRVLSKTNAPDVSALNVMYTSLNSPSQLSGWQSSGGDPCGDSWEGIKC  65

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SG+ VTEI +S L L+GSMG+QL  L SVT FD+S NN+   +PYQLPPN Q ++L+ NG
Sbjct  66   SGSSVTEINLSNLGLSGSMGYQLSSLTSVTYFDLSKNNIKGEIPYQLPPNAQYIDLSENG  125

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            FT  +PYS SQM  LEYLN++HNQL G+++ MF  LT L
Sbjct  126  FTNNVPYSFSQMTDLEYLNLAHNQLNGQLSDMFGKLTKL  164



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +1

Query  7    ASLKMRELMGLPWAVALLIGFLLNAPPSAVA-DTDPTDASVLRGLFSSLNSPPQLTKWTA  183
            A  + RE +    A+ +L   +L   P  V   TD  D S L  LF+SLNSP QLT W A
Sbjct  2    AKARGRETL----AIGVLFACILVGNPGGVGGATDQNDVSTLNVLFTSLNSPSQLTGWIA  57

Query  184  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN--SL  357
            NGGDPCG+SW GV+C+G+ +T I++SGL L+G++G+ L  + S+   D+S NN+G+   L
Sbjct  58   NGGDPCGQSWLGVTCTGSAITTIKLSGLGLSGTLGYNLQTMTSLAELDMSNNNIGSGGQL  117

Query  358  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            PY LPPN+Q LNL GN F+G +PYSIS M  L+YLN++HNQLQG +T MF  LTNL+
Sbjct  118  PYNLPPNLQSLNLGGNQFSGNIPYSISLMVTLKYLNLAHNQLQGNLTEMFGGLTNLT  174



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP DAS LR ++ SL SP QLT+W+ANG DPCG++WKG+ CSG+RVTEI++  L L GS
Sbjct  27   TDPNDASALRVMYISLQSPGQLTQWSANGDDPCGQNWKGIICSGSRVTEIKLPSLGLPGS  86

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L +VT  D+S NNL  ++P QLPPN+Q+LNLA N F+GG+PYSISQ+  L+YL
Sbjct  87   LGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPNLQQLNLANNQFSGGIPYSISQLPSLKYL  146

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQLQ ++  +F  L +LS
Sbjct  147  NLGHNQLQNQLGDVFGQLPSLS  168



>ref|XP_009391183.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D S L  L+ SLNSP QLT W+++GGDPCG  W+G+ CSG+ VTEI +SGL LTG+
Sbjct  24   TDPPDVSALNDLYRSLNSPSQLTGWSSSGGDPCGNDWQGIKCSGSSVTEIILSGLGLTGT  83

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTGG+ YSISQM  L YL
Sbjct  84   IGYQLSSLTSVTYFDLSKNNLHGDIPYQLPPNAIHIDLSGNVFTGGISYSISQMTDLNYL  143

Query  463  NVSHNQLQGEVTVMF  507
            N+++NQL G++T MF
Sbjct  144  NLANNQLSGQLTDMF  158



>gb|KJB67061.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=636

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  451  LEYLNVSHNQLQGEVTVMF  507
            L+YLN++HNQLQ +++ MF
Sbjct  142  LQYLNLAHNQLQNQLSDMF  160



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 125/164 (76%), Gaps = 4/164 (2%)
 Frame = +1

Query  37   LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  216
            LP  +  ++GF    P      TD +D S L  +FSS+ SP QL++WTA+GGDPCG++WK
Sbjct  8    LPLFILCIVGF---EPSLIHGATDASDTSALNTMFSSMGSPGQLSQWTASGGDPCGQNWK  64

Query  217  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  396
            G++CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S+NNLG  LPYQLPPNV++LNL
Sbjct  65   GITCSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSSNNLGGDLPYQLPPNVERLNL  124

Query  397  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            A N FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+L+
Sbjct  125  ANNQFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLT  167



>gb|KJB67062.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=622

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  451  LEYLNVSHNQLQGEVTVMF  507
            L+YLN++HNQLQ +++ MF
Sbjct  142  LQYLNLAHNQLQNQLSDMF  160



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  13   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  192
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  193  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  372
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGDIPYNIP  118

Query  373  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMF  163



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +L+G +  A P     TD +D   L+ +++S+NSPPQLT W ++GGDPCGESWKGV+C G
Sbjct  31   VLLGLVFAALPRISGTTDASDVQALQVMYTSVNSPPQLTNWKSSGGDPCGESWKGVTCEG  90

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
              V  I++SGL L+G+MG+ L  L S+  FD+S NN  + +PYQLPPN+  LNLA N F+
Sbjct  91   TAVVAIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDIIPYQLPPNLTSLNLARNNFS  150

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT  519
            G LPYSIS M  L YLNVSHN L   +  +F +L+
Sbjct  151  GNLPYSISAMGSLNYLNVSHNSLSQSIQDIFANLS  185



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 110/163 (67%), Gaps = 5/163 (3%)
 Frame = +1

Query  55   LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LNLA
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNLA  134

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             N FTG LPYSI+ M  L YLNVSHN L   V  MF +L  L+
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDMFANLVGLA  177



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 117/162 (72%), Gaps = 1/162 (1%)
 Frame = +1

Query  46   AVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
             VALLI  ++   P  +   TD +D S L  + SS+NSP QL++W   GGDPCGE+W+G+
Sbjct  8    VVALLILCIVGLEPRFIHGATDSSDTSALNTMHSSMNSPSQLSQWKPWGGDPCGENWQGI  67

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C  +RVT++++  L L+GS+G+ LD+L +VT FD+S NNLG  LPY LPPNVQ+LNLA 
Sbjct  68   TCLDSRVTQVKLPNLGLSGSLGYMLDKLTAVTEFDLSNNNLGGDLPYNLPPNVQQLNLAN  127

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N FTG   YSIS MA L+YL+++HNQ +G++ V F  LT+L+
Sbjct  128  NQFTGNGQYSISLMASLKYLSLAHNQFKGQLAVDFTKLTSLT  169



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  13   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  192
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  193  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  372
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGGIPYNIP  118

Query  373  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMF  163



>gb|EYU33875.1| hypothetical protein MIMGU_mgv1a002066mg [Erythranthe guttata]
Length=720

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            A TDP+D   L+ L++SLNSP QLT W ++GGDPCGESWKG++C G+ V  IQISGL +T
Sbjct  31   AATDPSDVQGLQVLYTSLNSPSQLTGWKSSGGDPCGESWKGITCQGSSVVSIQISGLGIT  90

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GSMG+ L  L S+ T D+S NN+ +S+PYQLPPN+  LNLAGN FTG +PYSI+ M  L 
Sbjct  91   GSMGYLLSNLASLKTLDMSNNNIHDSIPYQLPPNLTSLNLAGNNFTGNIPYSIATMGSLN  150

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN+S N L   +  MF + + L+
Sbjct  151  YLNISRNMLSQGIGDMFANHSALA  174



>ref|XP_004959657.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Setaria 
italica]
Length=693

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCG--ESWKGVSCSGNRVTEIQISGLQLT  276
            TD  D + L  +F+S+N P QL+ W ++GGDPCG  E WKG+ CSG+ VTEI +SGL L+
Sbjct  31   TDQPDVAALNVMFNSMNKPSQLSGWKSSGGDPCGGDEEWKGIECSGSSVTEINLSGLGLS  90

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  LKSVT FD S NNL   +PYQLPPN+ +LNL GN FTGG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDASNNNLNGDIPYQLPPNMVQLNLYGNSFTGGVPYSISQMEDLE  150

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
             LNV  N L G++T MF  L  LS
Sbjct  151  TLNVGKNHLNGQLTDMFSQLPKLS  174



>ref|XP_006845114.1| hypothetical protein AMTR_s00005p00184180 [Amborella trichopoda]
 gb|ERN06789.1| hypothetical protein AMTR_s00005p00184180 [Amborella trichopoda]
Length=179

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L  L+++LN P QLT W +NGGDPCGESWKG+SCSG  VT IQI GL L+G+
Sbjct  29   TDQSDVGALEILYNALNDPVQLTGWKSNGGDPCGESWKGISCSGTAVTSIQIPGLGLSGT  88

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T D+S NNL + +PYQLPPN   LNLA N F+G LPYSIS M  L YL
Sbjct  89   LGYGLSGLLSLITLDVSGNNLHDIIPYQLPPNTTFLNLANNNFSGNLPYSISGMTSLNYL  148

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N SHN L   +  +F +L +LS
Sbjct  149  NASHNSLSQSIGDLFTNLQDLS  170



>ref|XP_008445635.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Cucumis melo]
Length=706

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + T   D S L  +FSSLNSP QLT W ++GGDPCG+SW+G+ CSG+ VTEI +S   L+
Sbjct  22   SKTKAPDVSALNVMFSSLNSPSQLTGWGSSGGDPCGDSWEGIKCSGSSVTEISLSDFGLS  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GSMG+QL  L SVT FD+S N+L   +PYQLPPN   ++L+GN FTG +PYSISQM  LE
Sbjct  82   GSMGYQLSNLASVTYFDLSKNSLSGDIPYQLPPNAVHIDLSGNSFTGSVPYSISQMTELE  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
            +LN+ HNQL  +++ MF  L  L
Sbjct  142  FLNLGHNQLSNQLSDMFGKLAKL  164



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  DA+ L  L+SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G
Sbjct  21   DTDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNG  80

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G+QL  L ++ T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  81   TLGYQLSNLLALKTMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  E+  MF +LT LS
Sbjct  141  LNLSHNLLFQEIGEMFGNLTALS  163



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGV  222
            +AL I  ++   PS + A TD +D S L  +FS++NSP QL++WT++ GGDPCG++WKGV
Sbjct  9    LALFILCIVGLKPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQNWKGV  68

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA 
Sbjct  69   TCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLAS  128

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS
Sbjct  129  NQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLS  169



>ref|XP_009406399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=723

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = +1

Query  61   IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNR  240
            +G LL +P S+         S L  ++SSLNSP QLT W ++GGDPCG  WKG+ CSG+ 
Sbjct  45   VGTLLLSPTSSF--------SALNVMYSSLNSPSQLTGWGSSGGDPCGNDWKGIKCSGSS  96

Query  241  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG  420
            VTEI++SGL LTG+MG+QL  L SVT FD+S NNL   +PYQLPPN   +NLAGN  TGG
Sbjct  97   VTEIKLSGLGLTGTMGYQLSSLTSVTYFDLSKNNLQGDVPYQLPPNAIHINLAGNALTGG  156

Query  421  LPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
            +PYSISQM  L YLN+++NQL G++T +F
Sbjct  157  VPYSISQMTDLNYLNLANNQLSGQLTDVF  185



>ref|XP_008649053.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X3 [Zea mays]
Length=720

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN+SHN L  E+  +F SL +LS
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLS  167



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 114/174 (66%), Gaps = 5/174 (3%)
 Frame = +1

Query  10   SLKMRELMGLPWAVALLI-GFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN  186
            +LK  EL+   + V +LI GF    P      TDP D   L+ ++SSLNSP QLT W + 
Sbjct  2    ALKHFELLLFVFVVKVLISGF----PVLVQCTTDPNDVQALQAMYSSLNSPSQLTSWKSI  57

Query  187  GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ  366
            GGDPCGESWKG++C G+ V  +QISGL L G+MG+ L  L S+ TFD+S NN+ + LPYQ
Sbjct  58   GGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLRTFDLSDNNIHDPLPYQ  117

Query  367  LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LPPN+  LNLA N  +G LPYSIS M  L YLNVS N L   +  +F +L+ LS
Sbjct  118  LPPNLTSLNLAINNLSGNLPYSISTMVSLSYLNVSRNSLSQSIGDVFHNLSLLS  171



>ref|XP_008649054.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X4 [Zea mays]
Length=719

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN+SHN L  E+  +F SL +LS
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLS  167



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 112/165 (68%), Gaps = 6/165 (4%)
 Frame = +1

Query  40   PWAVALLIGFLLNAPPSAV--ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESW  213
            PW + L++ F++++  + V   DTDP D S L  LF S+NSP QL  W  NG DPCG+SW
Sbjct  5    PW-LMLMLMFIISSSCTFVINGDTDPNDVSALMALFQSMNSPSQLN-W--NGNDPCGQSW  60

Query  214  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  393
             G++CSGNR+TEI++ G QLTG++GFQL  L SVT  D+S NNL  +LPYQ PPN+Q LN
Sbjct  61   TGITCSGNRITEIKLPGRQLTGTLGFQLQSLSSVTNLDLSNNNLAGTLPYQFPPNLQHLN  120

Query  394  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LA N F GG+PYS S    L  LN  HNQ Q  + + F  LT+L+
Sbjct  121  LANNNFNGGIPYSFSDTPSLISLNFGHNQFQQALNLNFQKLTSLT  165



>ref|XP_008649051.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=735

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN+SHN L  E+  +F SL +LS
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLS  167



>ref|XP_008649052.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=734

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN+SHN L  E+  +F SL +LS
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLS  167



>gb|KCW77015.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=696

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLT  176



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 110/163 (67%), Gaps = 5/163 (3%)
 Frame = +1

Query  55   LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LN+A
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNIA  134

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             N FTG LPYSI+ M  L YLNVSHN L   V  +F +L  L+
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDIFANLVGLA  177



>ref|XP_004159012.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=715

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDPTDAS LR L++SLNSP QLT+W ANG DPCG+SWKG++CSG+RVTEI +SGL L+G
Sbjct  27   NTDPTDASALRVLYTSLNSPSQLTQWNANGDDPCGQSWKGITCSGSRVTEINLSGLGLSG  86

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL  + SVT  D+S NN G  + Y LPPN+++LNL  N F  G+PYSIS M  L+Y
Sbjct  87   SLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPPNLKRLNLGRNNFNKGIPYSISMMTSLQY  146

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHNQLQ  +  ++  LT+LS
Sbjct  147  LNISHNQLQDPLNDVYGQLTSLS  169



>gb|KJB67277.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
 gb|KJB67281.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=568

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +++G +  + P+    TD +D   L+ +++SLNSP +LT W  NGGDPCGESW+GV+C G
Sbjct  21   VVLGLIFASTPAQCV-TDSSDVQALQVMYTSLNSPSKLTNWKTNGGDPCGESWEGVTCEG  79

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  + ISGL L+G+MG+ L  L S+ T D+S NNL +++PYQLPPNV  +NLAGN F+
Sbjct  80   SAVVSLDISGLGLSGTMGYLLSDLMSLKTLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFS  139

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVSHN L   V   F +L  L
Sbjct  140  GNLPYSISAMITLTYLNVSHNMLSLSVGDYFANLARL  176



>gb|EEC85048.1| hypothetical protein OsI_32379 [Oryza sativa Indica Group]
Length=677

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  276
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI++SGL L+
Sbjct  31   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEIKLSGLGLS  90

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  150

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
             LN+  NQL G++T MF  L  L+
Sbjct  151  TLNLGKNQLSGQLTDMFSQLPKLT  174



>gb|KGN45936.1| hypothetical protein Csa_6G024930 [Cucumis sativus]
Length=696

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV---ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            +A L+ +++      V   + T   D S L  +FSSLNSP QL+ W ++GGDPCG SW+G
Sbjct  3    IATLVFWIIQISIHGVGVFSKTKAPDVSALNVMFSSLNSPSQLSGWGSSGGDPCGNSWEG  62

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            + CSG+ VTEI +S   L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN   ++L+
Sbjct  63   IQCSGSSVTEISLSDFGLSGSMGYQLSNLASVTYFDLSKNNLNGEIPYQLPPNAVHIDLS  122

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            GN FTG +PYSISQM+ LE+LN+ HN+L  +++ MF  L  L
Sbjct  123  GNSFTGSVPYSISQMSELEFLNLGHNKLSNQLSDMFGKLAKL  164



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLT  176



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  390
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  391  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLT  176



>gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDPTDAS LR L++SLNSP QLT+W ANG DPCG+SWKG++CSG+RVTEI +SGL L+G
Sbjct  27   NTDPTDASALRVLYTSLNSPSQLTQWNANGDDPCGQSWKGITCSGSRVTEINLSGLGLSG  86

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL  + SVT  D+S NN G  + Y LPPN+++LNL  N F  G+PYSIS M  L+Y
Sbjct  87   SLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPPNLKRLNLGRNNFNKGIPYSISMMTSLQY  146

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHNQLQ  +  ++  LT+LS
Sbjct  147  LNISHNQLQDPLMDVYGQLTSLS  169



>gb|KJB67280.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=608

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +++G +  + P+    TD +D   L+ +++SLNSP +LT W  NGGDPCGESW+GV+C G
Sbjct  21   VVLGLIFASTPAQCV-TDSSDVQALQVMYTSLNSPSKLTNWKTNGGDPCGESWEGVTCEG  79

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  + ISGL L+G+MG+ L  L S+ T D+S NNL +++PYQLPPNV  +NLAGN F+
Sbjct  80   SAVVSLDISGLGLSGTMGYLLSDLMSLKTLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFS  139

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVSHN L   V   F +L  L
Sbjct  140  GNLPYSISAMITLTYLNVSHNMLSLSVGDYFANLARL  176



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGV  222
            +AL +  ++   PS + A TD +D S L  +FS++NSP QL++WT++ GGDPCG++WKGV
Sbjct  9    LALFMLCIVGLKPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQNWKGV  68

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA 
Sbjct  69   TCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLAS  128

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS
Sbjct  129  NQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLS  169



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            +AL I  ++   PS +  DT+ +DA  L  LFSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  13   LALFILCIVGLKPSFILGDTNASDAVALNNLFSSMNSPGQLSQWTASGGDPCGQNWKGIT  72

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  405
            CS +RV +I++SGL L+GS+GF LD+L SVT  D+S NNLG  LPYQLPPN+++LNLA N
Sbjct  73   CSVSRVIQIKLSGLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLPYQLPPNLERLNLANN  132

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS
Sbjct  133  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLS  172



>gb|KJB67278.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=672

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +++G +  + P+    TD +D   L+ +++SLNSP +LT W  NGGDPCGESW+GV+C G
Sbjct  21   VVLGLIFASTPAQCV-TDSSDVQALQVMYTSLNSPSKLTNWKTNGGDPCGESWEGVTCEG  79

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  + ISGL L+G+MG+ L  L S+ T D+S NNL +++PYQLPPNV  +NLAGN F+
Sbjct  80   SAVVSLDISGLGLSGTMGYLLSDLMSLKTLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFS  139

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVSHN L   V   F +L  L
Sbjct  140  GNLPYSISAMITLTYLNVSHNMLSLSVGDYFANLARL  176



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  315
            ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+
Sbjct  1    MYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSL  60

Query  316  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  495
            T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  LN+SHNQLQ +V
Sbjct  61   TNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISLNMSHNQLQNQV  120

Query  496  TVMFVSLTNLS  528
              MF  L++L+
Sbjct  121  NDMFWKLSSLA  131



>gb|KJB67276.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=710

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +++G +  + P+    TD +D   L+ +++SLNSP +LT W  NGGDPCGESW+GV+C G
Sbjct  21   VVLGLIFASTPAQCV-TDSSDVQALQVMYTSLNSPSKLTNWKTNGGDPCGESWEGVTCEG  79

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  + ISGL L+G+MG+ L  L S+ T D+S NNL +++PYQLPPNV  +NLAGN F+
Sbjct  80   SAVVSLDISGLGLSGTMGYLLSDLMSLKTLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFS  139

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVSHN L   V   F +L  L
Sbjct  140  GNLPYSISAMITLTYLNVSHNMLSLSVGDYFANLARL  176



>ref|XP_007139054.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11048.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=575

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  82   PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  261
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  262  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  441
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +  L  LN+ HNQLQ  + V F++L+ LS
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLS  167



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  46   AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            A+ +++ FL  AP  A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVVLFLAAAPFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  402
            CSG+RVT I++ G++L G++G+ ++Q+ ++   D+S NNLG S +PY LPPN++ LNLA 
Sbjct  65   CSGSRVTTIKLPGMRLNGTLGYNMNQMTALIQLDMSNNNLGGSDIPYNLPPNMEILNLAS  124

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N FTG +PYSISQM  L+ LN+ HNQL   +  MF  LTNL+
Sbjct  125  NNFTGTVPYSISQMVALKNLNLGHNQL-SNINDMFNQLTNLT  165



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D S L  +++SLNSP QL+ WT+NGGDPCG++W+GV+CSG+ VTE+++SGL L+GS
Sbjct  28   TDAADVSALNVMYNSLNSPGQLSGWTSNGGDPCGQNWRGVTCSGSSVTELKLSGLGLSGS  87

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L S+TTFD+S NN GN +PYQLPPN+ +LNLA N FTG + YSI+QM+ L+YL
Sbjct  88   LGYQLTSLTSLTTFDVSNNNFGNDIPYQLPPNLSRLNLAENSFTGNIQYSIAQMSALQYL  147

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+ HNQLQG+++ +F  L++L+
Sbjct  148  NIGHNQLQGQLSDIFGQLSSLT  169



>gb|EEE70214.1| hypothetical protein OsJ_30326 [Oryza sativa Japonica Group]
Length=676

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  276
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  29   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  88

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  89   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  148

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
             LN+  NQL G++T MF  L  L+
Sbjct  149  TLNLGKNQLSGQLTDMFSQLPKLT  172



>ref|XP_011072790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Sesamum indicum]
Length=717

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D S L  +++S+NSP  L  WT++GGDPCGESWKG+SCSG++VTEI +SGL LTGS
Sbjct  42   TDSSDVSGLNVMYTSMNSPSVLDGWTSSGGDPCGESWKGISCSGSKVTEINLSGLGLTGS  101

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
             G++L  LKSVT FD+S N+   ++PYQLPPN+Q ++L+GN F G +PYSISQM  L+ +
Sbjct  102  FGYKLSDLKSVTRFDLSKNSFKGNIPYQLPPNLQLIDLSGNEFDGNVPYSISQMTDLKEM  161

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            ++++N+L G+++ MF  L+ L+
Sbjct  162  DLNNNKLNGQLSDMFGKLSKLT  183



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 1/160 (1%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V +    L   P  A A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++C
Sbjct  9    VCITTCILCWMPNGATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITC  67

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
            SGNRVTEI++S L LTGS+ + L  L S+T  D+S+N+LG S+PYQLPP +Q LNLA N 
Sbjct  68   SGNRVTEIKLSNLGLTGSLPYGLQVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNN  127

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             TG +PYSIS +  L  LN SHNQLQ  + V F++L+ LS
Sbjct  128  ITGTVPYSISNLTALTDLNFSHNQLQQGLGVDFLNLSTLS  167



>ref|NP_001063921.1| Os09g0559900 [Oryza sativa Japonica Group]
 dbj|BAF25835.1| Os09g0559900 [Oryza sativa Japonica Group]
Length=685

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  276
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  53   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  112

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  113  GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  172

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
             LN+  NQL G++T MF  L  L+
Sbjct  173  TLNLGKNQLSGQLTDMFSQLPKLT  196



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 1/163 (1%)
 Frame = +1

Query  43   WAVA-LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            W +  +LI   L A P     TD +D   L+ L++S+NSP QLT W ++GGDPCGESWKG
Sbjct  15   WLIEFVLIASALAALPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKSSGGDPCGESWKG  74

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V+C G+ V  +++SGL L+G+MG+ L  L S+  FD+S NN  +++PYQLPPN+  LNLA
Sbjct  75   VTCEGSAVVAVEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTIPYQLPPNLTSLNLA  134

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             N FTG +PYSI+ M  L YLNVS N L   +  +F  L NL+
Sbjct  135  RNNFTGNIPYSIANMVSLNYLNVSRNSLSQSIGDIFAHLVNLA  177



>ref|XP_010913801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X3 [Elaeis guineensis]
Length=589

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +EY+N+  NQL G++  +F  L+ LS
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLS  164



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  82   PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  261
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  262  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  441
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +  L  LN+ HNQLQ  + V F++L+ LS
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLS  167



>ref|XP_007023606.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
 gb|EOY26228.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
Length=818

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
             +N+SHNQL G+++ MF  L  L
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKL  370



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = +1

Query  46   AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  225
            A+ ++  FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVALFLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  226  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  402
            CSG+RVT I +SG++L G++G+ ++QL ++   D S NNLG S +PY LPPN+Q LNL G
Sbjct  65   CSGSRVTAINLSGMRLNGTLGYNMNQLTALVQLDASNNNLGGSDIPYNLPPNLQSLNLEG  124

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N FTG +PYSISQM  L  LN+ HNQL   +  MF  LTNL+
Sbjct  125  NNFTGTVPYSISQMVALRNLNLGHNQL-SNINDMFSQLTNLT  165



>ref|XP_010913799.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Elaeis guineensis]
Length=685

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +EY+N+  NQL G++  +F  L+ LS
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLS  164



>ref|XP_007023605.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
 gb|EOY26227.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
Length=908

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
             +N+SHNQL G+++ MF  L  L
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKL  370



>ref|XP_007135873.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
 gb|ESW07867.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
Length=689

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            L +  L  +  S    T   D + L  ++SSLNSP +L+ W ++GGDPCGESWKG+ CSG
Sbjct  10   LWLALLAVSTTSVHCKTSSEDVAALNVMYSSLNSPSKLSGWKSSGGDPCGESWKGIKCSG  69

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + VTEI +S + L+GS G+QL  L SVT FD+S NNL   +PYQLPP  + ++L+ NGFT
Sbjct  70   SSVTEINLSDMGLSGSTGYQLSSLSSVTYFDLSNNNLKGDIPYQLPPKARHIDLSNNGFT  129

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G +P+S+SQM  L  LN+ HNQLQ ++  MF  LT L
Sbjct  130  GSIPFSVSQMDELSQLNLGHNQLQNQLGDMFEKLTKL  166



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DT   D S L  L+SSLNSP QLT WT+N GDPCG+SW GV+CSG  VT I++SGL L+G
Sbjct  32   DTKSDDVSALNVLYSSLNSPSQLTGWTSNAGDPCGQSWLGVTCSGQAVTTIKLSGLGLSG  91

Query  280  SMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  453
            S+G+Q+  + S+T  D+S NNL  G  +PY LPPN++KLNLAGN FTG +PYSISQM PL
Sbjct  92   SLGYQMSGMTSLTELDMSNNNLGGGQQIPYNLPPNLEKLNLAGNQFTGNVPYSISQMIPL  151

Query  454  EYLNVSHNQLQGEVTVMFVSLTNLS  528
            +YLN+SHNQLQG ++ MF  LTNL+
Sbjct  152  KYLNLSHNQLQGNLSDMFGQLTNLT  176



>ref|XP_002316561.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
 gb|EEE97173.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
Length=689

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = +1

Query  10   SLKMRELMGLPWAVALLI-GFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN  186
            +LK  EL+   + V +LI GF    P      TD  D   L+ ++SSLNSP QLT W + 
Sbjct  2    ALKHFELLLFVFVVKVLIFGF----PVLVQCTTDANDVQALQSMYSSLNSPSQLTSWKSI  57

Query  187  GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ  366
            GGDPCGESWKG++C G+ V  +QISGL L G+MG+ L  L S+ TFD+S NN+ + LPYQ
Sbjct  58   GGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLRTFDLSDNNIHDPLPYQ  117

Query  367  LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LPPN+  LNLA N  +G LPYSIS M  L YLNVS N L   +  +F +L+ LS
Sbjct  118  LPPNLTSLNLAINNLSGNLPYSISTMVSLSYLNVSRNSLSQSIGDVFHNLSLLS  171



>ref|XP_003604115.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AES86312.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=790

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 114/169 (67%), Gaps = 0/169 (0%)
 Frame = +1

Query  19   MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  198
            +R+ M +   ++ L   +L +  S    T   D S L  +++SLNSP QL+ W ++GGDP
Sbjct  87   LRKKMHINHNLSWLWIIVLISTASVQCKTSSQDVSALNVMYTSLNSPSQLSGWKSSGGDP  146

Query  199  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  378
            CGE+W+G+ CSG+ VTEI +S L L+GS+G+QL QL SVT FD+S NN    +PYQLPPN
Sbjct  147  CGENWEGIKCSGSSVTEINLSDLGLSGSLGYQLSQLTSVTDFDLSNNNFKGDIPYQLPPN  206

Query  379  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
             + ++L+ N FTG +PYSI QM  L  LN++HN+L  ++  MF +LT L
Sbjct  207  ARNVDLSKNAFTGNIPYSIGQMKELTSLNLAHNKLNNQLGDMFTTLTKL  255



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 1/163 (1%)
 Frame = +1

Query  43   WAVA-LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  219
            W +  +LI   L A P     TD +D   L+ L++S+NSP QL  WT++GGDPCGESWKG
Sbjct  15   WLIEFVLIASALAALPLVSGTTDASDVQALQVLYTSVNSPSQLXGWTSSGGDPCGESWKG  74

Query  220  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  399
            V+C G+ V  +++SGL L+G+MG+ L  L S+  FD+S NN  +++PYQLPPN+  LNLA
Sbjct  75   VTCEGSAVVAVEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTIPYQLPPNLTSLNLA  134

Query  400  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             N FTG LPYSI+ M  L YLNVS N L   +  +F  L +L+
Sbjct  135  RNNFTGNLPYSIANMVSLSYLNVSRNSLSQSIGDIFAHLVSLA  177



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  16   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  195
            + RE++ L     +++  L + P      TDPTDAS L+ L++SLNSP QLT+W ANG D
Sbjct  4    RWREVISL-----IILCILWSKPICIQGTTDPTDASALKVLYTSLNSPSQLTQWNANGDD  58

Query  196  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  375
            PCG+SW+G++CSG+RVTEI +SGL L+GS+G+QL  + SVT  D+S NNLG  + Y LPP
Sbjct  59   PCGQSWRGITCSGSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNLGGEIGYNLPP  118

Query  376  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             +++LNL  N F  G+PYS+S M  L+YLN+SHNQLQ  +  ++  LT+LS
Sbjct  119  KLKRLNLGRNNFNKGIPYSVSLMTSLQYLNISHNQLQDPLNDVYGQLTSLS  169



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = +1

Query  67   FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT  246
            FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT
Sbjct  13   FLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVT  72

Query  247  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGL  423
             I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA N FTG +
Sbjct  73   AIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTV  132

Query  424  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            PYSISQM  L  LN+ HNQL   +  MF  LTNL+
Sbjct  133  PYSISQMVALRDLNLDHNQL-SNINDMFSQLTNLT  166



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  82   PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  261
            P SA A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTEI++S
Sbjct  22   PNSATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLS  80

Query  262  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  441
             L LTGS+ + L  L S+   D+S+N LG S+PYQLPP +Q+LNLA N  TG +PYSIS 
Sbjct  81   NLGLTGSVPYGLQVLTSLNDLDMSSNRLGGSIPYQLPPYLQRLNLAYNNITGTVPYSISN  140

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            +  L  LN+ HNQLQ  + V F +L+ LS
Sbjct  141  LTALTDLNLGHNQLQQGLGVDFHNLSTLS  169



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+I +  L 
Sbjct  39   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIILPNLS  98

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  441
            LTG++ + ++ L S+   D+S NNLG+   +PY LP   ++KLNLAGN F G LPYSIS 
Sbjct  99   LTGTLAYNMNNLGSLVELDMSQNNLGSGAQIPYNLPNMKLEKLNLAGNQFGGNLPYSIST  158

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            M  L+YLN++HNQLQG ++ +F SL +LS
Sbjct  159  MPNLKYLNLNHNQLQGNISDVFSSLYSLS  187



>gb|EPS68087.1| hypothetical protein M569_06686, partial [Genlisea aurea]
Length=632

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  118  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  297
             S L  +F+++NSP QL  W ++GGDPC +SWKG+SCSG++VTEI +SGL LTGS+G+ L
Sbjct  1    VSALNVMFATMNSPSQLDGWKSSGGDPCHDSWKGISCSGSKVTEIDLSGLGLTGSIGYML  60

Query  298  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  477
              LKSV  FD+S N   +S+PYQLPPNVQ+++L+GN F G +PYSIS+M+ L+ +  S+N
Sbjct  61   SDLKSVVNFDVSKNKFKSSIPYQLPPNVQRIDLSGNEFQGTVPYSISEMSHLKQIYFSNN  120

Query  478  QLQGEVTVMFVSLTNLS  528
            +L G++  MFV LT L+
Sbjct  121  KLNGQLNDMFVKLTKLT  137



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD TD   L+ ++++LNSP +LT W  NGGDPCGESWKGV+C G+ V  + ISGL L+G+
Sbjct  36   TDSTDVQALQVMYTALNSPAKLTNWKTNGGDPCGESWKGVTCEGSAVVSVDISGLGLSGA  95

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+ T D+S NN+ +++PYQLPPN+  LNLAGN  +G LPYSIS M  L YL
Sbjct  96   MGYLLSDLMSLRTLDLSNNNIHDTIPYQLPPNLTSLNLAGNNLSGNLPYSISTMVTLTYL  155

Query  463  NVSHNQLQGEVTVMFVSLTNL  525
            N+SHN L   V  +F +L +L
Sbjct  156  NLSHNSLSLSVGDIFANLADL  176



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TD +D   L+ +++SLNSP QLT W ++GGDPC ESWKGV+C G+ V  +QISGL L G
Sbjct  36   NTDASDVQALQVMYTSLNSPSQLTNWKSDGGDPCAESWKGVTCEGSAVVSLQISGLGLNG  95

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            +MG+ L  L S+ TFD+S NNL +S+PYQLPPN+  LNLAGN  +G LPYS+S M  L Y
Sbjct  96   TMGYLLSNLMSLRTFDLSDNNLHDSIPYQLPPNLTSLNLAGNNLSGNLPYSLSTMFSLTY  155

Query  460  LNVSHNQLQGEVTVMFVSLT  519
            LNVSHN L   +  +F +L+
Sbjct  156  LNVSHNSLAQSIGDVFSNLS  175



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 3/161 (2%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVAD-TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  231
            +L+  +L   P  V   TD TDAS L  LF+SLNSP QLT W  +GGDPCG+SW GV+C+
Sbjct  14   VLLACILAGDPGGVGGITDETDASSLNILFTSLNSPSQLTGWVPSGGDPCGDSWLGVTCT  73

Query  232  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPPNVQKLNLAGN  405
            G+ VT I++SGL+L G+ G+ L  + S+   D+S NNL  G+ +PY LPPN+Q LN  GN
Sbjct  74   GSAVTAIKLSGLELAGTPGYNLASMSSLAELDMSNNNLGGGDPIPYNLPPNLQSLNFGGN  133

Query  406  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
             F   +PYSI QM  L+YLN++HNQLQG ++ MF SL+NL+
Sbjct  134  QFGANIPYSIFQMVTLKYLNLAHNQLQGNLSDMFGSLSNLT  174



>gb|KHN38109.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Glycine soja]
Length=690

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  12   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  71

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  72   SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  131

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L
Sbjct  132  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKL  168



>gb|AFW70556.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=668

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDP DA+ L  L++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L G
Sbjct  24   ETDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDG  83

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN +  ++  +F SL +LS
Sbjct  144  LNLSHNSISQQLGDIFGSLNSLS  166



>ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Glycine 
max]
Length=725

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  47   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  106

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  107  SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  166

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L
Sbjct  167  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKL  203



>gb|KGN45432.1| hypothetical protein Csa_7G447940 [Cucumis sativus]
Length=263

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  16   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  195
            + REL+       +++  L + P      T+PTDAS LR L+ SL+SP +LT+W ANGGD
Sbjct  4    RWRELISF-----IILCILWSKPICIQGTTNPTDASALRVLYISLDSPSRLTQWNANGGD  58

Query  196  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  375
            PCG+SWKG++CS +RVTEI +SGL L+GS+G+QL  + SVT  D+S NN G  + Y LPP
Sbjct  59   PCGQSWKGITCSDSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPP  118

Query  376  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N+++LNL  N F   +PYSIS    L+YLN+SHNQLQ  +  ++  LT+LS
Sbjct  119  NLKRLNLGRNNFNKAIPYSISLTTSLQYLNISHNQLQDPLMDVYGQLTSLS  169



>ref|XP_006425179.1| hypothetical protein CICLE_v10030356mg, partial [Citrus clementina]
 gb|ESR38419.1| hypothetical protein CICLE_v10030356mg, partial [Citrus clementina]
Length=578

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  121  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  300
            S L  +++SL+SP QL+ W A GGDPCGE WKG++CSG+ VTEI++SGL L G +G+QL 
Sbjct  1    SALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGITCSGSSVTEIKLSGLGLNGQLGYQLT  60

Query  301  QLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ  480
             LKSV+  D+S NNL +S+PYQLPPN++ L+L+ N F+G +PYSISQM+ L+YLN+  NQ
Sbjct  61   NLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSENQFSGTVPYSISQMSELKYLNLGSNQ  120

Query  481  LQGEVTVMF  507
            L G+++ MF
Sbjct  121  LNGQLSDMF  129



>ref|XP_004159013.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=263

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  16   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  195
            + REL+       +++  L + P      T+PTDAS LR L+ SL+SP +LT+W ANGGD
Sbjct  4    RWRELISF-----IILCILWSKPICIQGTTNPTDASALRVLYISLDSPSRLTQWNANGGD  58

Query  196  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  375
            PCG+SWKG++CS +RVTEI +SGL L+GS+G+QL  + SVT  D+S NN G  + Y LPP
Sbjct  59   PCGQSWKGITCSDSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPP  118

Query  376  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N+++LNL  N F   +PYSIS    L+YLN+SHNQLQ  +  ++  LT+LS
Sbjct  119  NLKRLNLGRNNFNKAIPYSISLTTSLQYLNISHNQLQDPLMDVYGQLTSLS  169



>ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
 ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
Length=662

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  315
            +FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+GSMG+QL  L SV
Sbjct  1    MFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLSGSMGYQLSNLASV  60

Query  316  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  495
            T FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE+LN+ HN+L  ++
Sbjct  61   TYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELEFLNLGHNKLSNQL  120

Query  496  TVMFVSLTNL  525
            + MF  L  L
Sbjct  121  SDMFGKLAKL  130



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDP DA+ L  L++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L G
Sbjct  24   ETDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDG  83

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN +  ++  +F SL +LS
Sbjct  144  LNLSHNSISQQLGDIFGSLNSLS  166



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 112/174 (64%), Gaps = 1/174 (1%)
 Frame = +1

Query  10   SLKMRELMGLPWAVALL-IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN  186
            SL       +  A+AL  +  ++  PP   A TDP D   L+ L+ SLNSPP+LT W + 
Sbjct  8    SLSTSRFFTVSSAIALATLTTVIFTPPLVRATTDPLDVQSLQVLYVSLNSPPRLTGWKSG  67

Query  187  GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ  366
            GGDPCGESWKGV C G+ V  IQ+ GL L+G++G+ L  L S+ T D+S NN+ +S+PYQ
Sbjct  68   GGDPCGESWKGVICQGSAVVAIQLPGLGLSGTLGYMLSSLFSLRTLDLSDNNIHDSIPYQ  127

Query  367  LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LPPN+  LNLA N  +G LPYSIS M  L YLN+SHN +   +  +F +L  LS
Sbjct  128  LPPNLTSLNLASNNLSGNLPYSISSMVSLNYLNLSHNSIFQSIGDIFANLQGLS  181



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +T+ +D++ L  L++S NSPPQL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L G
Sbjct  23   NTESSDSAALGNLYTSWNSPPQLAGWSASGGDPCGAGWQGVSCTGSGVTEIKLAGTGLNG  82

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G++L  L S+ T D+S N++  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EY
Sbjct  83   SLGYELSNLFSLKTLDLSNNHIQGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEY  142

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  ++  +F +LT+LS
Sbjct  143  LNLSHNALAQQIGDLFGNLTSLS  165



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF    P   + +TD  DAS L  +++SLNSP QLT WTA+ GDPCG+SWKGV+CS  
Sbjct  18   ILGF---KPRCVIGETDQADASALGVMYTSLNSPQQLTGWTASNGDPCGQSWKGVTCSNK  74

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   PN+Q+LNL  N FTG
Sbjct  75   RVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLPNLQRLNLEYNQFTG  134

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             +P++ISQM  L+YLN++HNQLQ  +T MF
Sbjct  135  SVPFAISQMPSLQYLNLAHNQLQNALTDMF  164



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 123/158 (78%), Gaps = 5/158 (3%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSG  234
            ++GF    P   +A T+ +D S L  +FS++NSP QL+ WT++ GGDPC ++WKG++C G
Sbjct  4    IVGF---KPSLILAATNASDTSALNFMFSAMNSPGQLSHWTSSSGGDPCEQNWKGITCFG  60

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            +RVT+I++SGL L+GS+G+ LD L SVT  D+S NNLG  LPYQLPPN+++LNLA N FT
Sbjct  61   SRVTQIKLSGLGLSGSLGYALDNLTSVTELDLSNNNLGGDLPYQLPPNLERLNLASNQFT  120

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            G LPYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS
Sbjct  121  GSLPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLS  157



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP+D   L  L+SSLNSPPQL+ WT++GGDPC +SWKG++CSG+ VT IQ+SG+ L G+
Sbjct  25   TDPSDVQALGVLYSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMGLNGT  84

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T DIS NNL   +PYQLPPN+  LNLA    +G LP+SIS M  L Y 
Sbjct  85   LGYLLSDLLSLKTLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVSLNYF  144

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L  ++  +F +L +LS
Sbjct  145  NLSHNSLSQQIGDIFANLQDLS  166



>ref|XP_004488910.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cicer arietinum]
Length=706

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  231
            L I FL+    + V   T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CS
Sbjct  11   LWIAFLIAVSTTTVHCKTSSQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCS  70

Query  232  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  411
             + VTEI++S L L+GS+G+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ N F
Sbjct  71   SSSVTEIKLSDLGLSGSVGYQLASLTSVTYFDLSNNNLKGDIPYQLPPNARDIDLSKNQF  130

Query  412  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            +G +PYSISQM  L  LN++HNQL  ++  MF SLT L
Sbjct  131  SGSIPYSISQMKELNSLNLAHNQLNNQLGDMFGSLTKL  168



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 105/151 (70%), Gaps = 4/151 (3%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  237
            ++GF    P  A   TD  DAS L G+FSSLNSP QLT WT++ GDPCG+SWKGV+CSG 
Sbjct  18   ILGF---KPRCANGATDQGDASALGGMFSSLNSPQQLTGWTSSNGDPCGQSWKGVTCSGQ  74

Query  238  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  417
            RVTEI++S L L+GS+ + L  L S+   D+S NN+   +PY LPPN+Q+LNLA N FTG
Sbjct  75   RVTEIKLSNLGLSGSI-YNLQSLTSLKELDMSQNNIAGEIPYNLPPNLQQLNLAFNQFTG  133

Query  418  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFV  510
             +PY    M  L+YLN+ HNQLQ ++  MF 
Sbjct  134  SVPYVFHDMPSLQYLNLGHNQLQNQLNDMFA  164



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L 
Sbjct  48   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLS  107

Query  271  LTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  441
            LTG++ + ++ L S+   D+S NNL  G  + Y LP   ++KLNLAGN F G LPYSIS 
Sbjct  108  LTGNLAYNMNNLGSLVELDMSQNNLGGGGQIQYNLPNMKLEKLNLAGNQFGGNLPYSIST  167

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            M  L+YLN++HNQLQG ++ +F +L +LS
Sbjct  168  MPNLKYLNLNHNQLQGNISDVFSNLYSLS  196



>gb|KJB69229.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=537

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVS N L   V  +F +LT+L
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDL  182



>ref|XP_008228078.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Prunus mume]
Length=719

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            W V  L GF         + T+  D S L  +++S+NS  +L+ W ++GGDPCG+SWKG+
Sbjct  21   WVV--LFGFFTTG---VYSKTNSQDVSSLNVMYNSINSRSKLSGWKSSGGDPCGDSWKGI  75

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
             CSG+ VTEI ++ L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  76   KCSGSSVTEIDLADLGLSGSMGYQLASLTSVTRFDLSKNNLNGDIPYQLPPNAKYIDLSQ  135

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            NGFT  +PYSISQM+ LE LN+  N+L G++T MF  LT L
Sbjct  136  NGFTNTVPYSISQMSDLETLNLGRNKLNGQLTDMFGKLTKL  176



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +1

Query  52   ALLIGFLLNA---PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            ALL+ F  +A   P S    TDP+D   L+ +++SLN P QLT WT + GDPCGESWKGV
Sbjct  21   ALLVLFSFSAILPPLSVYGATDPSDVQGLQVIYNSLNGPSQLTGWTNSSGDPCGESWKGV  80

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C G+ V  IQISGL L G+MG+ L    S+ T D+S NN+ +++PYQLPPN+  LNLA 
Sbjct  81   TCEGSAVVSIQISGLGLNGTMGYLLSNFLSLRTLDMSDNNIHDTIPYQLPPNLTNLNLAS  140

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N  TG  PYSIS M  L YLNVSHN +   +  +F  L  L+
Sbjct  141  NNLTGSFPYSISTMVSLNYLNVSHNSISQSIGDIFAKLAGLT  182



>gb|AFW87368.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=734

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  E+  +F SL++LS
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLS  167



>ref|XP_008659801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=724

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  E+  +F SL++LS
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLS  167



>gb|AFW87367.1| putative STRUBBELIG family receptor protein kinase, partial [Zea 
mays]
Length=743

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  E+  +F SL++LS
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLS  167



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP+D   L  L+SSLNSPPQL+ WT++GGDPC +SWKG++CSG+ VT IQ+SG+ L G+
Sbjct  25   TDPSDVQALGVLYSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMGLNGT  84

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T DIS NNL   +PYQLPPN+  LNLA    +G LP+SIS M  L Y 
Sbjct  85   LGYLLSDLLSLKTLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVSLNYF  144

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L  ++  +F +L +LS
Sbjct  145  NLSHNSLSQQIGDIFANLQDLS  166



>gb|KJB69230.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=684

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVS N L   V  +F +LT+L
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDL  182



>ref|XP_006389935.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
 gb|ESQ27221.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
Length=699

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            V L I  L      A A T+  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C
Sbjct  6    VRLFIASLAIIVTLAQAKTENQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKC  65

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
             G+ VTE+Q+SGL+L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+L+ N 
Sbjct  66   KGSSVTELQLSGLELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDLSENE  125

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
              G +PYS+SQM  LE +N+ HN++ GE++ MF  L+ L
Sbjct  126  LDGNVPYSLSQMNRLESINLGHNKINGELSDMFQKLSKL  164



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  24   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  80

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL+ L SVT  D+S NN+G ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  81   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  140

Query  460  LNVSHNQLQGEVTVMF  507
            LN+ HNQLQ  + V F
Sbjct  141  LNLGHNQLQQALNVDF  156



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVASLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL+ + SVT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPMSSVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLIV  139

Query  460  LNVSHNQLQGEVTVMF  507
            LN+ HNQLQ  + V F
Sbjct  140  LNLGHNQLQQALNVDF  155



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +1

Query  67   FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT  246
            FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT
Sbjct  13   FLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVT  72

Query  247  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGL  423
             I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA N FTG +
Sbjct  73   AIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTV  132

Query  424  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            PYSISQM  L  L++S+N   G++   F SLT+L
Sbjct  133  PYSISQMVALRDLDLSYNTFSGDIPHSFNSLTSL  166



>ref|XP_009385265.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D   L  L++SLNSP QL+ WT +GGDPCG+SWKGVSCSG+ VT +Q+SGL L GS
Sbjct  30   TDSLDVQALGVLYASLNSPSQLSGWTPSGGDPCGDSWKGVSCSGSSVTAVQLSGLGLNGS  89

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T D+S N++  ++PYQLPPN+  LNLAGN  +G LPYSIS MA L YL
Sbjct  90   LGYLLSDLLSLKTLDLSNNDIRETIPYQLPPNLTYLNLAGNNLSGNLPYSISAMASLNYL  149

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L   V  +F +L +LS
Sbjct  150  NLSHNLLSQAVGDIFRNLQDLS  171



>ref|NP_001174920.1| Os06g0634500 [Oryza sativa Japonica Group]
 dbj|BAH93648.1| Os06g0634500 [Oryza sativa Japonica Group]
Length=155

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  DA+ L  L+SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G
Sbjct  21   DTDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNG  80

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G+QL  L ++ T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  81   TLGYQLSNLLALKTMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140

Query  460  LNV  468
            L +
Sbjct  141  LKL  143



>ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brachypodium 
distachyon]
Length=715

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM  285
            + +DA+ L  L++S NSP QL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L GS+
Sbjct  23   ESSDAAALGNLYTSWNSPSQLAGWSASGGDPCGAGWQGVSCNGSGVTEIKLAGTGLNGSL  82

Query  286  GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN  465
            G++L  L S+ T D+S NN+  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EYLN
Sbjct  83   GYELSNLYSLKTLDLSNNNIHGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEYLN  142

Query  466  VSHNQLQGEVTVMFVSLTNLS  528
            +SHN L  ++  +F +L +LS
Sbjct  143  ISHNSLSQQIGDLFRNLNSLS  163



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +1

Query  31   MGLPWAVALLIGF----LLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  195
            M   W  AL++      +L   P  V  +TD  DAS L  +++SLNSP QLT WTA+ GD
Sbjct  1    MVKKWKKALILVLFTVCILGFKPRCVNGETDQADASALGVMYTSLNSPQQLTGWTASNGD  60

Query  196  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  375
            PCG+SWKGV+CS  RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   P
Sbjct  61   PCGQSWKGVTCSNKRVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLP  120

Query  376  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
            N+Q+LNL  N FTG +P++ISQM  L+YLN++HNQLQ  +T MF
Sbjct  121  NLQRLNLEYNQFTGSIPFAISQMPSLQYLNLAHNQLQNALTDMF  164



>gb|KJB69228.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=726

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVS N L   V  +F +LT+L
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDL  182



>gb|KHG11352.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=726

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILVGLVISVFIPAQCFTDSTDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ + +PYQLPP +  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDMIPYQLPPILTSLNVAGNNLS  145

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYSIS M  L YLNVSHN L   V  +F +LT+L
Sbjct  146  GSLPYSISTMVTLTYLNVSHNSLSPSVGDVFANLTDL  182



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL+ L SVT  D+S NN+G ++PYQ PPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQFPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  139

Query  460  LNVSHNQLQGEVTVMF  507
            LN+ HNQLQ  + V F
Sbjct  140  LNLGHNQLQQALNVDF  155



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D   L  L+SSLNSPPQL+ WT +GGDPCG+SWKG++CSG+ VT +Q+SG+ L G+
Sbjct  46   TDPFDVQALGVLYSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMGLNGT  105

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T D+S N++ + +PYQLPPN+  LNLA N  +G LPYSI  M  L YL
Sbjct  106  LGYLLSDLLSLKTLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVSLNYL  165

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L  ++  +F +L +LS
Sbjct  166  NLSHNSLSQQIGDIFANLQDLS  187



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  136  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  315
            +FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+
Sbjct  1    MFSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSL  60

Query  316  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  495
               D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++
Sbjct  61   KELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQL  120

Query  496  TVMF  507
              MF
Sbjct  121  NDMF  124



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TDP D + L+ +F S+NSPPQL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  24   ETDPNDVASLKVMFQSMNSPPQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  80

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G+QL+ L  VT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+SQ   L  
Sbjct  81   SLGYQLESLSLVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGEVPYSLSQKTSLVV  140

Query  460  LNVSHNQLQGEVTVMF  507
            +N+ HNQLQ  + V F
Sbjct  141  VNLGHNQLQQALNVDF  156



>ref|XP_002465165.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
 gb|EER92163.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
Length=718

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = +1

Query  94   VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  273
             ADT+  D + L   ++++NSP QLT W    GDPCG+SW GV+CSG+RVT I++ G+ L
Sbjct  22   TADTNSDDVTALNTFYTTVNSPSQLTNWAPQNGDPCGQSWLGVTCSGSRVTTIKVPGMGL  81

Query  274  TGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
             G++G+ ++ L  ++  D+S NNLG S +PY LPPN+++LNL  N F G LPYSISQMA 
Sbjct  82   KGTLGYNMNLLTELSELDVSNNNLGGSDIPYNLPPNLERLNLEKNNFIGTLPYSISQMAA  141

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            L+YLN+ HNQL  ++ VMF  LTNL+
Sbjct  142  LKYLNLGHNQL-SDINVMFDQLTNLT  166



>ref|XP_002310348.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE90798.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=672

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDIPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
             LN++ N+L G+++ MF  L+ L
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKL  164



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  58   LIGFLLNAPPSAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            L+G   +A     A   P +    L+ +++SLNSP QLT WT+NGGDPCGESWKG++C G
Sbjct  28   LVGAFTDASDEIFATAYPDNFVQALQVMYTSLNSPSQLTGWTSNGGDPCGESWKGITCEG  87

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  414
            + V  I+ISGL L+G+MG+ L  L S+  FD+S NN+ +++PYQLPPN+  LNLA N  +
Sbjct  88   SAVVSIEISGLGLSGTMGYMLANLVSLRKFDLSDNNIHDTIPYQLPPNLTSLNLAKNNLS  147

Query  415  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            G LPYS S M+ L YLNVS N L   +  +FV+L++L
Sbjct  148  GNLPYSFSTMSSLNYLNVSRNSLAQSIGDVFVNLSSL  184



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            +A+A++   ++   P   + TD +D   L+ L+SSLNS P LT W +N GDPCGESWKGV
Sbjct  19   YAIAVVALTVIFTLPLVRSATDSSDVQALQVLYSSLNSSPLLTGWKSNAGDPCGESWKGV  78

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C G+ V  IQISGL L+G++G+ L  L S+   D+S NN+ +S+PYQLPPN+  LNLA 
Sbjct  79   TCQGSSVVAIQISGLGLSGTLGYMLSSLFSLKALDLSGNNIHDSIPYQLPPNLTSLNLAN  138

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            N  +G LPYSIS M  L YLN+ HN +   +  +F +L +LS
Sbjct  139  NNLSGNLPYSISTMVSLNYLNLGHNSISQSIGDIFANLQSLS  180



>ref|XP_004965804.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=716

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            DTD  D + L  L+SS NSP QLT W+A GGDPCG +W GV+CSG  VT I++SG++L G
Sbjct  26   DTDAGDVAALGNLYSSWNSPAQLTGWSAAGGDPCGAAWAGVTCSGTAVTSIKLSGMELNG  85

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G++L  L+++ T D+S N L +S+PYQLP N+  LNLA N  +G LPYSIS M  LEY
Sbjct  86   TLGYELSSLQALKTMDLSNNFLHDSIPYQLPSNLTYLNLAKNNLSGNLPYSISTMVSLEY  145

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  E+  +F SL +LS
Sbjct  146  LNLSHNSLFQEIGELFGSLNSLS  168



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TDP D   L  L+SSLNSPPQL+ WT +GGDPCG+SWKG++CSG+ VT +Q+SG+ L G+
Sbjct  46   TDPFDVQALGVLYSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMGLNGT  105

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T D+S N++ + +PYQLPPN+  LNLA N  +G LPYSI  M  L YL
Sbjct  106  LGYLLSDLLSLKTLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVSLNYL  165

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L  ++  +F +L +LS
Sbjct  166  NLSHNSLSQQIGDIFANLQDLS  187



>ref|XP_010537758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537760.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X3 [Tarenaya 
hassleriana]
Length=700

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            +A+ + F+        A TD  + S L  +F+SLNSP +L  W ++GGDPC ++W G+ C
Sbjct  15   IAVFVAFVR-------AKTDSQEVSALNVMFTSLNSPSKLKGWKSSGGDPCNDAWDGIKC  67

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
             GN+V EIQ+S LQL+GS+G+QL  LKS+TT D+S N L  ++PYQLPPN+  L+ + N 
Sbjct  68   DGNKVIEIQLSELQLSGSLGYQLSNLKSLTTLDLSKNKLSGNMPYQLPPNIVHLDFSENE  127

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
              G +PYS+SQM  L+ +N+ HN+L+G++  MF  L+ L
Sbjct  128  IDGNVPYSLSQMNHLQSVNLGHNKLEGDLQDMFQKLSKL  166



>ref|XP_009346024.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=698

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            W V  L+GF         + T+  D S L  +++SL S  +L+ W ++GGDPCG+SWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSLQSRSKLSGWKSSGGDPCGDSWKGI  65

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CSG+ VT+I +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  66   TCSGSSVTQIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPNAKYIDLSQ  125

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L
Sbjct  126  NGFSNTVPYSVSQMSDLETLNLGRNKLNGQLSDMFGKLTKL  166



>ref|XP_011031253.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Populus euphratica]
Length=672

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SG  LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGFGLT  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDMPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
             LN++ N+L G+++ MF  L+ L
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKL  164



>gb|EAY90345.1| hypothetical protein OsI_11922 [Oryza sativa Indica Group]
Length=753

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  387
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLA  183



>ref|XP_006586762.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN40858.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=711

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            + +AL   F+  A P ++A TDP+D   L  +++ LNSP QLT W   GGDPCGESWKGV
Sbjct  6    FPLALCFSFIFVALPLSLATTDPSDVQALEVMYNVLNSPTQLTGWKIGGGDPCGESWKGV  65

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C G+ V  I++SGL L G++G+ L  L S+   D+S N + +++PYQLPPN+  LN A 
Sbjct  66   TCEGSAVVSIKLSGLGLDGTLGYLLSDLMSLRDLDLSDNKIHDTIPYQLPPNLTSLNFAR  125

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            N  +G LPYSIS M  L YLN+S+N L   V  +F SL +L
Sbjct  126  NNLSGNLPYSISAMGSLNYLNLSNNALSMTVGDIFASLQDL  166



>gb|AAP12946.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF96436.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
Length=753

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  387
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLA  183



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  100  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            +TD  DA+ L  L++S N P QL  W+A GGDPCG +W+GV+CSG  VTEI++ G+ L G
Sbjct  24   NTDSADAAALGNLYASWNGPSQLAGWSAGGGDPCGAAWQGVTCSGAGVTEIKLPGIGLNG  83

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNLA N F+G LPYSI+ +A +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTYLNLASNDFSGNLPYSITNLASIEY  143

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  ++  +F +L++LS
Sbjct  144  LNLSHNSLLNQMGELFGNLSSLS  166



>emb|CDX88495.1| BnaC06g39390D [Brassica napus]
Length=692

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            + LLI  L      A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C
Sbjct  2    MRLLIASLAIIVTLAHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKC  61

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
             G+ VTE+Q+SG +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  62   KGSSVTELQLSGYELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENE  121

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
              G +PYS+SQM  L+ +N+  N+L GE++ MF  L+ L
Sbjct  122  LDGNVPYSLSQMNKLKSINLGQNKLDGELSDMFQKLSKL  160



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L+ +++SL+SPPQLT WT +GGDPC ESWKGV+C G+ V  I+ISGL L G+
Sbjct  25   TDASDVQALQVMYTSLDSPPQLTGWTVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGT  84

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L    S+   D+S NN+ +++PYQLPPN+  LN+A N   G LPYS S MA L YL
Sbjct  85   MGYALSSFLSLKKLDMSDNNIHDAIPYQLPPNLTSLNMAKNSLIGNLPYSFSTMASLNYL  144

Query  463  NVSHNQLQGEVTVMFVSLTNL  525
            N+SHN L   +  +F +LT L
Sbjct  145  NMSHNLLSQVIGDVFTNLTTL  165



>ref|XP_006597598.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN32995.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=710

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 109/161 (68%), Gaps = 0/161 (0%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            + +++L+  +  A P ++A+TDP+D   L  ++++LNSP QLT W   GGDPCGESWKGV
Sbjct  6    FPLSILLSLVFVALPLSLANTDPSDVQALEVMYNALNSPTQLTGWKIGGGDPCGESWKGV  65

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +C G+ V  I++SGL L G++G+ L  L S+   D+S N + +++PYQLPPN+  LN A 
Sbjct  66   TCEGSAVVSIKLSGLGLDGTLGYLLSDLMSLRELDLSDNKIHDTIPYQLPPNLTSLNFAR  125

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            N  +G LPYSIS M  L YLN+S+N L   V  +F SL +L
Sbjct  126  NNLSGNLPYSISAMVSLNYLNLSNNALSMTVGDIFASLQDL  166



>ref|XP_009106613.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Brassica rapa]
Length=692

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNL  525
            L+ +N+  N+L GE++ MF  L+ L
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKL  160



>emb|CDX87418.1| BnaA07g34550D [Brassica napus]
Length=692

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNL  525
            L+ +N+  N+L GE++ MF  L+ L
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKL  160



>ref|XP_006648399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=720

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  279
            TD +DAS L  L+SS NSP QL  W+A  GGDPCG  W+GV+CSG  VTEI+++GL L G
Sbjct  25   TDSSDASALGNLYSSWNSPSQLAGWSAAGGGDPCGAGWQGVTCSGAGVTEIRLAGLGLDG  84

Query  280  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  459
            ++G++L  L S+ T D+S N+L  S+PYQLPPN+  LNLA N  +G LPYSIS M  LEY
Sbjct  85   TLGYELSSLFSLKTLDLSNNHLHGSIPYQLPPNLTYLNLANNNLSGNLPYSISNMVSLEY  144

Query  460  LNVSHNQLQGEVTVMFVSLTNLS  528
            LN+SHN L  ++  +F SL +LS
Sbjct  145  LNISHNSLSQQIGDLFGSLNSLS  167



>ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
 gb|EMJ18898.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
Length=670

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  315
            +++S+NS  +L+ W ++GGDPCG+SWKG+ CSG+ VTEI +S L L+GSMG+QL  L SV
Sbjct  1    MYNSINSRSKLSGWKSSGGDPCGDSWKGIKCSGSSVTEIDLSDLGLSGSMGYQLASLTSV  60

Query  316  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  495
            T FD+S NNL   +PYQLPPN + ++L+ NGFT  +PYSISQM+ LE LN+  N+L G++
Sbjct  61   TRFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFTNTVPYSISQMSDLETLNLGRNKLNGQL  120

Query  496  TVMFVSLTNL  525
            T MF  LT L
Sbjct  121  TDMFGKLTKL  130



>gb|EAZ27223.1| hypothetical protein OsJ_11161 [Oryza sativa Japonica Group]
Length=831

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  387
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLA  183



>ref|XP_009344017.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 5/161 (3%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CSG+ VTEI +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKL  166



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  55   LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  234
            LL+   +  P      T+  D S L  L+SSLNSP QLT WT+NGGDPCG+SW GV+CSG
Sbjct  17   LLVCIWIWNPSFVHGATNSADVSALNVLYSSLNSPGQLTGWTSNGGDPCGQSWLGVTCSG  76

Query  235  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPPNVQKLNLAGNG  408
              VT I++SGL L+GS+G+Q+  + S+T  DIS NNL  G  +PY LPPN+++LNLAGN 
Sbjct  77   QAVTTIKLSGLGLSGSLGYQMASMASLTELDISNNNLGGGQQIPYNLPPNLERLNLAGNQ  136

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            F G +PYSIS M PL+YLN+ HNQLQG ++ +F  LTNL+
Sbjct  137  FNGNVPYSISLMFPLKYLNLGHNQLQGNLSDIFGKLTNLT  176



>ref|XP_010696137.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=688

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D S L  +F+SLNSP +L  W ++GGDPCG+ WKG+ CSG+ +TEI +SGL L+GS
Sbjct  23   TDSKDVSALNVMFTSLNSPKKLKYWESSGGDPCGDGWKGIECSGSSITEINLSGLGLSGS  82

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L SVT FD S N L   +PYQLPPNV+ L+L+ NGF+G +PYSISQ+  L+ L
Sbjct  83   LGYQLSSLSSVTYFDTSDNKLSGDIPYQLPPNVKHLDLSNNGFSGTVPYSISQLKSLKDL  142

Query  463  NVSHNQLQGEVTVMFVSLTNL  525
            ++SHNQL G++T MF SL+NL
Sbjct  143  DLSHNQLNGQITDMFSSLSNL  163



>ref|XP_010322795.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X2 [Solanum lycopersicum]
Length=700

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
             ++ TD    S L  ++  L    +L  W +NGG+PC +SW GV CSG+ VTEI +SGL 
Sbjct  25   VLSKTDSQQVSALNDMYQYLKPHSKLDGWKSNGGNPCDDSWTGVKCSGSDVTEINLSGLG  84

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            LTGS+GFQLD+L  VT FD+S NNL +++PYQLPP  Q L+L+GN F G +PYSISQM  
Sbjct  85   LTGSLGFQLDKLDKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFGGTVPYSISQMTE  144

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            L+ +N++HN+L G ++ +F  LT L+
Sbjct  145  LKSMNLNHNKLSGSLSDLFGKLTKLT  170



>ref|XP_004241857.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Solanum lycopersicum]
Length=720

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
             ++ TD    S L  ++  L    +L  W +NGG+PC +SW GV CSG+ VTEI +SGL 
Sbjct  45   VLSKTDSQQVSALNDMYQYLKPHSKLDGWKSNGGNPCDDSWTGVKCSGSDVTEINLSGLG  104

Query  271  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  450
            LTGS+GFQLD+L  VT FD+S NNL +++PYQLPP  Q L+L+GN F G +PYSISQM  
Sbjct  105  LTGSLGFQLDKLDKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFGGTVPYSISQMTE  164

Query  451  LEYLNVSHNQLQGEVTVMFVSLTNLS  528
            L+ +N++HN+L G ++ +F  LT L+
Sbjct  165  LKSMNLNHNKLSGSLSDLFGKLTKLT  190



>ref|XP_008799289.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Phoenix dactylifera]
Length=737

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            T P+D   L  L+  LNSPPQL  WT++GGDPC +SWKG++CSG+ VT I++SG+ L G+
Sbjct  41   TKPSDVRALGVLYGFLNSPPQLAGWTSSGGDPCRDSWKGITCSGSAVTAIEVSGMGLNGT  100

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T DIS NN+   +PYQLPPN+  LNLA N  +G LP+SIS M  L YL
Sbjct  101  LGYLLSDLLSLKTLDISNNNVHEGIPYQLPPNLTYLNLAKNNLSGNLPFSISTMVSLNYL  160

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            NVSHN L  ++  +F +L +LS
Sbjct  161  NVSHNSLSQQIGDIFANLQDLS  182



>gb|KJB56462.1| hypothetical protein B456_009G120500 [Gossypium raimondii]
Length=710

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D + L  +F SL +P QL+ W  +GGDPC +SW+GV CSG+RVTEI +S   L G 
Sbjct  24   TDSRDVNALNVMFKSLKAPSQLSGWRVSGGDPCSDSWQGVKCSGSRVTEISLSNYGLNGE  83

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+QL  L S+T+ D+S NNL + +PYQLPPN  ++NL+ N FTG +PYSISQM+ +E +
Sbjct  84   LGYQLSNLTSLTSLDVSKNNLNDQIPYQLPPNAVRINLSHNQFTGNVPYSISQMSNIESI  143

Query  463  NVSHNQLQGEVTVMFVSLTNL  525
            N+S+N+L G ++ MF  +  L
Sbjct  144  NLSNNKLDGTLSDMFAKVKKL  164



>ref|NP_178019.2| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
 sp|Q6R2K1.1|SRF5_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 5; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF5; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99873.1| strubbelig receptor family 5 [Arabidopsis thaliana]
 gb|ACN59278.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36188.1| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
Length=699

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            A TD  + S L  +F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L 
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELG  81

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  456
            GS G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  82   GSRGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQ  141

Query  457  YLNVSHNQLQGEVTVMFVSLTNL  525
             +N+  N+L GE+  MF  L+ L
Sbjct  142  SINLGQNKLNGELPDMFQKLSKL  164



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
              ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++  L 
Sbjct  30   VAADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLPSLG  89

Query  271  LTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQ  441
            L+G++ + ++ + S+   D+S NNL  G  + Y LP N +++LNLAGN FTG LPYSI  
Sbjct  90   LSGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNLPYSIFS  149

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            M+ L+YLN++HNQLQG +T +F SL +L+
Sbjct  150  MSNLKYLNLNHNQLQGNITDVFSSLYSLT  178



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D   L+ +++SLNSP QLT W +NGGDPC ESWKG++C G+ V  IQISGL L G+
Sbjct  26   TDANDVQALQVMYTSLNSPSQLTNWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGT  85

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+ T D+S N+L +S PYQLPPN+  LNLA N  +G +PYS+S M  L YL
Sbjct  86   MGYLLANLMSLRTLDLSDNHLRDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLNYL  145

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+S N L   +  +F++L+ L+
Sbjct  146  NISRNSLAQSIGDVFLNLSLLA  167



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +1

Query  31   MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  210
            +G+   V LL  FL  A   A A+TD  D + L   ++++NSPPQL  W +   DPCG+S
Sbjct  14   VGIGAGVVLL--FLATASLGANANTDSNDVTALNVFYTTMNSPPQLKNWVSQNADPCGQS  71

Query  211  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQK  387
            W G++C G+RVT I++SG+ L G++G+ ++ L ++   D+S NNLG S +PY LPPN++K
Sbjct  72   WNGITCLGSRVTTIKLSGMGLNGTLGYNMNLLTALVQLDMSNNNLGGSDIPYNLPPNLEK  131

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLAGN FTG  PYSISQM  L+ LN++HNQ+   ++ MF  LTNL+
Sbjct  132  LNLAGNHFTGTTPYSISQMFALKDLNLAHNQI-STISDMFNQLTNLT  177



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 100/147 (68%), Gaps = 0/147 (0%)
 Frame = +1

Query  85   PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISG  264
            P   A TD +D   L+ +++SL+SPPQLT W  +GGDPC ESWKGV+C G+ V  I+ISG
Sbjct  19   PFLRAHTDASDVQALQVMYTSLDSPPQLTGWIVSGGDPCAESWKGVTCEGSAVVSIEISG  78

Query  265  LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  444
            L L G+MG+ L    S+   D+S N++ +++PYQLPPN+  LN+A N   G LPYS+S M
Sbjct  79   LGLNGTMGYALSSFLSLKKLDMSDNSIHDAVPYQLPPNLTSLNMAKNSLIGNLPYSLSTM  138

Query  445  APLEYLNVSHNQLQGEVTVMFVSLTNL  525
            A L YLN+SHN L   +  +F +LT L
Sbjct  139  ASLNYLNMSHNLLSQVIGDVFTNLTTL  165



>gb|KDO78353.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=442

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            NVS N L   +  +F +L  L+
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLA  180



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = +1

Query  49   VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  228
            VA+L G L     +   +TD  D + L+ L++ LNSPPQLT W +NGGDPC ESWKG++C
Sbjct  23   VAILSGLL-----AVDGNTDQNDLTALQVLYNVLNSPPQLTGWKSNGGDPCAESWKGITC  77

Query  229  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  408
             G+ V  +Q+SGL L G+MG+ L+ L S+ T D+S N + + +PYQLPPN+  LNLA N 
Sbjct  78   QGSAVVSLQLSGLGLNGTMGYSLNSLMSLKTLDLSGNMIYDPIPYQLPPNLTSLNLAYNN  137

Query  409  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  507
             +G LPYS+S MA L YLNVSHN L   +  +F
Sbjct  138  ISGNLPYSLSGMAALSYLNVSHNSLSQSIVDVF  170



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  94   VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  273
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  274  TGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  444
            TG++ + ++ L S+   D+S NNL  G  + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  445  APLEYLNVSHNQLQGEVTVMFVSLTNLS  528
              L+YLN++HNQLQG +T +F +L +LS
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLS  183



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  94   VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  273
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  274  TGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  444
            TG++ + ++ L S+   D+S NNL  G  + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  445  APLEYLNVSHNQLQGEVTVMFVSLTNLS  528
              L+YLN++HNQLQG +T +F +L +LS
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLS  183



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A ADTDP+D +VL  LF+SLNSP QL  W ANGGDPCG+SWKG++CSG+ VT+I +S L 
Sbjct  38   AAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNLG  97

Query  271  LTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPP-NVQKLNLAGNGFTGGLPYSISQ  441
            L+G++ + ++ L S+   D+S N+L  G+ + Y LP   +++LNLAGN F G LPYSIS 
Sbjct  98   LSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIST  157

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            M  L+YLN++HNQLQG ++ +F SL +L+
Sbjct  158  MTNLKYLNLNHNQLQGNISDVFSSLYSLT  186



>ref|XP_008380425.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Malus domestica]
Length=697

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +1

Query  43   WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  222
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  223  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  402
            +CSG+ VTEI +  L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLXDLGLSGSMGYQLASLTSVTXFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  403  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  525
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKL  166



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = +1

Query  115  DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQ  294
            +   L+ ++SSLNSP QLT W + GGDPCGESWKG++C G+ V  +QISGL L G+MG+ 
Sbjct  11   EIQALQAMYSSLNSPSQLTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYM  70

Query  295  LDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH  474
            L  L S+ TFD+S NN+ + LPYQLPPN+  LNLA N  +G LPYSIS M  L YLNVS 
Sbjct  71   LSNLMSLRTFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSYLNVSR  130

Query  475  NQLQGEVTVMFVSLTNLS  528
            N L   +  +F +L+ LS
Sbjct  131  NSLSQSIGDVFHNLSLLS  148



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  91   AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  270
            A ADTDP+D +VL  LF+SLNSP QL  W ANGGDPCG+SWKG++CSG+ VT+I +S L 
Sbjct  38   AAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNLG  97

Query  271  LTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPP-NVQKLNLAGNGFTGGLPYSISQ  441
            L+G++ + ++ L S+   D+S N+L  G+ + Y LP   +++LNLAGN F G LPYSIS 
Sbjct  98   LSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIST  157

Query  442  MAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            M  L+YLN++HNQLQG ++ +F SL +L+
Sbjct  158  MTNLKYLNLNHNQLQGNISDVFSSLYSLT  186



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +1

Query  94   VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  273
             ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++S L L
Sbjct  28   AADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLSSLGL  87

Query  274  TGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  444
            +G++ + ++ + S+   D+S NNL  G  + Y LP   +++LNLAGN FTG LPYSI  M
Sbjct  88   SGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTSKLERLNLAGNQFTGNLPYSIFSM  147

Query  445  APLEYLNVSHNQLQGEVTVMFVSLTNLS  528
              L+YLN++HNQLQG +T +F SL +L+
Sbjct  148  NNLKYLNLNHNQLQGNITDVFSSLYSLT  175



>ref|XP_006650171.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=741

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = +1

Query  97   ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  276
            ADT   D + L   +++LNSP  LT W A  GDPCG+SW G++CSG+RV  I++  + L 
Sbjct  37   ADTTSDDVTALNTFYTTLNSPSPLTNWVAQNGDPCGQSWLGITCSGSRVITIKLPSMGLQ  96

Query  277  GSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  453
            G++G+ ++ L ++   D+S NNLG S +PY LPPN+++LNL  N F+G LPYSISQM+ L
Sbjct  97   GTLGYNMNILTALVELDVSNNNLGGSDIPYNLPPNLERLNLENNSFSGTLPYSISQMSSL  156

Query  454  EYLNVSHNQLQGEVTVMFVSLTNLS  528
            +YLN+ HNQL G + VMF  LTNL+
Sbjct  157  KYLNIGHNQLSG-INVMFNQLTNLT  180



>gb|KDO78351.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78352.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=577

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            NVS N L   +  +F +L  L+
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLA  180



>ref|XP_009386651.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD  D   L  L++SLNSP QL+ WT +GGDPCG SW GVSCSG+ V  I +SGL L GS
Sbjct  43   TDSLDVPALGVLYASLNSPRQLSGWTRSGGDPCGTSWLGVSCSGSAVVAIHLSGLGLNGS  102

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            +G+ L  L S+ T D+S NN+  ++PYQLPPN+  LNLAGN  +G LPYSIS M  L YL
Sbjct  103  LGYLLSDLLSLKTLDLSNNNIHETIPYQLPPNLTYLNLAGNDLSGNLPYSISSMVSLNYL  162

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            N+SHN L   V  +F  L +LS
Sbjct  163  NLSHNLLSQTVGDIFSDLQDLS  184



>gb|KDO78348.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=621

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            NVS N L   +  +F +L  L+
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLA  180



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 107/167 (64%), Gaps = 3/167 (2%)
 Frame = +1

Query  28   LMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  207
            L  L + + LL G  L       A+TD  DA  L  L+ +LN+P QLT W A+GGDPCGE
Sbjct  3    LNSLSFCILLLFGISLVL---VRANTDANDAQALHVLYGALNNPSQLTGWKADGGDPCGE  59

Query  208  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  387
            SWKGV C G+ V  + ISGL ++G+MG+ L  L S+ T D+S NN+ +++P+QLPPN+  
Sbjct  60   SWKGVKCDGSAVVSLDISGLGVSGTMGYLLTNLASLKTLDMSDNNIHDAIPFQLPPNLTS  119

Query  388  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS  528
            LNLA N  +GGLPYSI  M  L YLNVS N L   +  +F + T L+
Sbjct  120  LNLAHNNLSGGLPYSIVSMVSLAYLNVSSNSLSQPIADVFSNHTALA  166



>gb|KDO78349.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78350.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=618

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  282
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  283  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  462
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  463  NVSHNQLQGEVTVMFVSLTNLS  528
            NVS N L   +  +F +L  L+
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLA  180



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  106  DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM  285
            DP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L LTG++
Sbjct  1    DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL  60

Query  286  GFQLDQLKSVTTFDISTNNL--GNSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLE  456
             + ++ L S+   D+S NNL  G  + Y LP   ++KLNLAGN F G LPYSIS M  L+
Sbjct  61   AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK  120

Query  457  YLNVSHNQLQGEVTVMFVSLTNLS  528
            YLN++HNQLQG ++ +F +L +LS
Sbjct  121  YLNLNHNQLQGNISDVFSNLYSLS  144



Lambda      K        H        a         alpha
   0.317    0.134    0.402    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400